F445083

General Info

Members Datasets Scaffolds Average Seq Length
443 225 886 348

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10000383|Ga0157380_1000038313
Length 356
Sequence MELGVYTFADMMPDKVSGRAINAHTRIQQLLEEIQLADQVSLDIFAVGEHHRPDYAISAPAVVLGAAAAITKNIKLSSAVTVLSSDDPVRVFQAFATVDLISGGRAEIMVGRGSFIESFPLFGYDLNEYDELFAEKLELLLKINQNEIVSWKGKHRRSLINLGVYPRPLQPSLPIWQAVGGTPQSAVRAGTLGLPMALAIIGGYPDKFVPFINLYRESGQKAGHENLPLGINSHVYVAETSQQAGDEFYPAYSAMMNRIGRERGWAPLRRMDFDAMRSPTGSLLVGSVDEVVDKILYEHSLFKNSRFLAQMSVGIMPHDKILRSIELFGNKVAPAVKKALAAPVDKTKAKQEVNEK

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
116 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
117 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
118 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
121 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
122 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
174 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
175 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
192 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
193 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
200 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
201 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
202 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
218 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
219 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
223 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
224 2818991444 Filimonas endophytica 3197 Isolate Unclassified
225 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0
Isolates 0.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.68
Nodule 0
Rhizoplane 2.48
Rhizosphere 92.33
Stem 0
Stem Tuber 0
Unclassified 5.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10000383 3300014326 Bacteria 26712
2 SwRhRL2b_contig_254312 2162886007 Bacteria 3901
3 JGI24735J21928_10053640 3300002067 Unclassified 1162
4 JGI25406J46586_10006818 3300003203 Bacteria 5245
5 rootL2_10076218 3300003322 Bacteria 1728
6 rootL2_10168539 3300003322 Bacteria 6265
7 rootH1_10005049 3300003323 Bacteria 11651
8 Ga0070658_10077638 3300005327 Bacteria 2724
9 Ga0070658_10106805 3300005327 Unclassified 2316
10 Ga0070658_10214326 3300005327 Bacteria 1627
11 Ga0070683_100000236 3300005329 Bacteria 37800
12 Ga0070683_100015553 3300005329 Bacteria 6688
13 Ga0070670_100228845 3300005331 Bacteria 1618
14 Ga0070670_100286993 3300005331 Bacteria 1437
15 Ga0070677_10009308 3300005333 Bacteria 3328
16 Ga0070680_100028337 3300005336 Bacteria 4491
17 Ga0070680_100037636 3300005336 Unclassified 3909
18 Ga0070680_100045335 3300005336 Bacteria 3574
19 Ga0070682_100000315 3300005337 Bacteria 33359
20 Ga0068868_100150844 3300005338 Unclassified 1914
21 Ga0070660_100004805 3300005339 Bacteria 9345
22 Ga0070660_100021267 3300005339 Bacteria 4781
23 Ga0070660_100060283 3300005339 Bacteria 2945
24 Ga0070660_100402811 3300005339 Bacteria 1131
25 Ga0070689_100151430 3300005340 Bacteria 1871
26 Ga0070691_10000896 3300005341 Bacteria 12075
27 Ga0070671_100183094 3300005355 Bacteria 1774
28 Ga0070674_100075580 3300005356 Bacteria 2393
29 Ga0070673_100090424 3300005364 Bacteria 2501
30 Ga0070673_100370041 3300005364 Unclassified 1276
31 Ga0070659_100040509 3300005366 Bacteria 3641
32 Ga0070659_100041451 3300005366 Bacteria 3598
33 Ga0070659_100061700 3300005366 Bacteria 2963
34 Ga0070659_100211169 3300005366 Bacteria 1600
35 Ga0070667_100100663 3300005367 Bacteria 2496
36 Ga0070709_10000842 3300005434 Bacteria 17172
37 Ga0070714_100019674 3300005435 Bacteria 5504
38 Ga0070714_100027027 3300005435 Bacteria 4748
39 Ga0070711_100061528 3300005439 Bacteria 2614
40 Ga0070708_100000022 3300005445 Bacteria 113297
41 Ga0070708_100063220 3300005445 Bacteria 3313
42 Ga0070663_100029008 3300005455 Bacteria 3775
43 Ga0070663_100094816 3300005455 Bacteria 2217
44 Ga0070678_100013313 3300005456 Bacteria 5152
45 Ga0070678_100129349 3300005456 Bacteria 2004
46 Ga0070662_100205634 3300005457 Bacteria 1564
47 Ga0070681_10052182 3300005458 Bacteria 4078
48 Ga0070681_10078008 3300005458 Bacteria 3269
49 Ga0070681_10318721 3300005458 Bacteria 1464
50 Ga0070685_10020157 3300005466 Bacteria 3607
51 Ga0070685_10036049 3300005466 Bacteria 2795
52 Ga0070706_100001535 3300005467 Bacteria 24133
53 Ga0070698_100050706 3300005471 Unclassified 4229
54 Ga0070699_100035352 3300005518 Bacteria 4319
55 Ga0070699_100140001 3300005518 Bacteria 2136
56 Ga0070679_100005166 3300005530 Bacteria 12080
57 Ga0070679_100010126 3300005530 Bacteria 8938
58 Ga0070679_100032553 3300005530 Bacteria 5158
59 Ga0070679_100090965 3300005530 Unclassified 3039
60 Ga0070679_100230837 3300005530 Unclassified 1810
61 Ga0070684_100001605 3300005535 Bacteria 16331
62 Ga0068853_100042831 3300005539 Bacteria 3872
63 Ga0068853_100067655 3300005539 Bacteria 3104
64 Ga0070672_100154910 3300005543 Unclassified 1898
65 Ga0070695_100054599 3300005545 Bacteria 2572
66 Ga0070693_100014807 3300005547 Bacteria 4006
67 Ga0070693_100030967 3300005547 Bacteria 2929
68 Ga0070665_100133748 3300005548 Bacteria 2482
69 Ga0068855_100007528 3300005563 Bacteria 13178
70 Ga0068855_100016426 3300005563 Bacteria 8899
71 Ga0068855_100095266 3300005563 Bacteria 3431
72 Ga0068855_100100676 3300005563 Bacteria 3327
73 Ga0068855_100105976 3300005563 Bacteria 3232
74 Ga0070664_100005547 3300005564 Bacteria 10133
75 Ga0068857_100096266 3300005577 Bacteria 2653
76 Ga0068857_100276843 3300005577 Bacteria 1543
77 Ga0068857_100400893 3300005577 Unclassified 1276
78 Ga0068856_100025417 3300005614 Bacteria 5776
79 Ga0070702_100079183 3300005615 Bacteria 1963
80 Ga0068866_10042854 3300005718 Bacteria 2255
81 Ga0068851_10000171 3300005834 Bacteria 33294
82 Ga0081455_10005121 3300005937 Bacteria 14453
83 Ga0081538_10011368 3300005981 Bacteria 7217
84 Ga0081538_10042943 3300005981 Bacteria 2846
85 Ga0081540_1003249 3300005983 Bacteria 12929
86 Ga0081539_10002306 3300005985 Bacteria 27511
87 Ga0081539_10004967 3300005985 Bacteria 14091
88 Ga0081539_10015145 3300005985 Bacteria 5633
89 Ga0070712_100090975 3300006175 Bacteria 2235
90 Ga0075367_10109305 3300006178 Bacteria 1696
91 Ga0097621_100318129 3300006237 Bacteria 1378
92 Ga0075431_100021106 3300006847 Bacteria 6656
93 Ga0075431_100056847 3300006847 Bacteria 4035
94 Ga0075429_100009688 3300006880 Bacteria 8352
95 Ga0075429_100035192 3300006880 Bacteria 4354
96 Ga0068865_100111955 3300006881 Bacteria 2015
97 Ga0075435_100039549 3300007076 Bacteria 3764
98 Ga0105240_10016585 3300009093 Bacteria 9967
99 Ga0111539_10033471 3300009094 Bacteria 6239
100 Ga0105245_10210283 3300009098 Bacteria 1872
101 Ga0114129_10025797 3300009147 Bacteria 8324
102 Ga0114129_10137924 3300009147 Bacteria 3346
103 Ga0114129_10295619 3300009147 Bacteria 2160
104 Ga0114129_10824425 3300009147 Bacteria 1181
105 Ga0105243_10000003 3300009148 Bacteria 712931
106 Ga0105243_10427060 3300009148 Bacteria 1238
107 Ga0105241_10010626 3300009174 Bacteria 6750
108 Ga0105248_10043814 3300009177 Bacteria 5018
109 Ga0105237_10206465 3300009545 Bacteria 1965
110 Ga0105237_10261111 3300009545 Bacteria 1734
111 Ga0105238_10001579 3300009551 Bacteria 22813
112 Ga0157373_10009211 3300013100 Bacteria 7301
113 Ga0157373_10013071 3300013100 Bacteria 6091
114 Ga0157373_10048853 3300013100 Bacteria 3016
115 Ga0157371_10000584 3300013102 Bacteria 43265
116 Ga0157371_10001101 3300013102 Bacteria 29303
117 Ga0157371_10003314 3300013102 Bacteria 14722
118 Ga0157371_10005044 3300013102 Bacteria 11291
119 Ga0157371_10006737 3300013102 Bacteria 9393
120 Ga0157371_10029488 3300013102 Bacteria 3967
121 Ga0157371_10058113 3300013102 Bacteria 2744
122 Ga0157371_10112750 3300013102 Bacteria 1930
123 Ga0157371_10137067 3300013102 Unclassified 1743
124 Ga0157370_10000821 3300013104 Bacteria 39240
125 Ga0157370_10001675 3300013104 Bacteria 27295
126 Ga0157370_10061411 3300013104 Bacteria 3567
127 Ga0157370_10065875 3300013104 Bacteria 3427
128 Ga0157370_10089620 3300013104 Bacteria 2889
129 Ga0157370_10173980 3300013104 Bacteria 2001
130 Ga0157370_10229755 3300013104 Bacteria 1717
131 Ga0157369_10062214 3300013105 Bacteria 4023
132 Ga0157369_10121014 3300013105 Bacteria 2778
133 Ga0157369_10134430 3300013105 Bacteria 2619
134 Ga0163162_10095354 3300013306 Bacteria 3062
135 Ga0157372_10021733 3300013307 Bacteria 6935
136 Ga0157372_10027898 3300013307 Bacteria 6154
137 Ga0157372_10030583 3300013307 Bacteria 5891
138 Ga0157372_10061828 3300013307 Bacteria 4194
139 Ga0157372_10078405 3300013307 Unclassified 3733
140 Ga0157372_10085048 3300013307 Bacteria 3587
141 Ga0157372_10256905 3300013307 Bacteria 2028
142 Ga0157372_10354850 3300013307 Bacteria 1709
143 Ga0157372_10384146 3300013307 Bacteria 1636
144 Ga0157372_10384556 3300013307 Bacteria 1635
145 Ga0157372_10389001 3300013307 Unclassified 1625
146 Ga0157375_10001388 3300013308 Bacteria 20910
147 Ga0157375_10167313 3300013308 Bacteria 2344
148 Ga0163163_10097337 3300014325 Bacteria 2963
149 Ga0157380_10000067 3300014326 Bacteria 58606
150 Ga0157380_10014932 3300014326 Bacteria 5695
151 Ga0157380_10067083 3300014326 Bacteria 2888
152 Ga0157380_10186368 3300014326 Bacteria 1828
153 Ga0182008_10014581 3300014497 Bacteria 4111
154 Ga0157379_10043387 3300014968 Bacteria 4015
155 Ga0157379_10290298 3300014968 Bacteria 1489
156 Ga0157376_10493963 3300014969 Bacteria 1201
157 Ga0182007_10002043 3300015262 Bacteria 10364
158 Ga0182007_10003083 3300015262 Bacteria 8026
159 Ga0213876_10001274 3300021384 Bacteria 15905
160 Ga0213876_10003196 3300021384 Bacteria 9414
161 Ga0213876_10072671 3300021384 Unclassified 1816
162 Ga0213875_10000693 3300021388 Bacteria 26070
163 Ga0207656_10000250 3300025321 Bacteria 18780
164 Ga0207642_10032685 3300025899 Bacteria 2194
165 Ga0207680_10011709 3300025903 Bacteria 4442
166 Ga0207647_10065956 3300025904 Unclassified 2196
167 Ga0207699_10005231 3300025906 Bacteria 6210
168 Ga0207705_10018439 3300025909 Unclassified 4991
169 Ga0207705_10021406 3300025909 Bacteria 4614
170 Ga0207705_10050391 3300025909 Bacteria 2997
171 Ga0207705_10072741 3300025909 Bacteria 2494
172 Ga0207705_10135055 3300025909 Bacteria 1838
173 Ga0207684_10029871 3300025910 Bacteria 4640
174 Ga0207654_10012479 3300025911 Bacteria 4354
175 Ga0207707_10000456 3300025912 Bacteria 42593
176 Ga0207707_10031689 3300025912 Bacteria 4627
177 Ga0207707_10280275 3300025912 Bacteria 1444
178 Ga0207695_10242171 3300025913 Bacteria 1705
179 Ga0207671_10046745 3300025914 Bacteria 3203
180 Ga0207693_10213637 3300025915 Bacteria 1516
181 Ga0207660_10025045 3300025917 Bacteria 4047
182 Ga0207660_10029276 3300025917 Unclassified 3775
183 Ga0207657_10010191 3300025919 Bacteria 9389
184 Ga0207657_10015465 3300025919 Bacteria 7392
185 Ga0207657_10023224 3300025919 Bacteria 5780
186 Ga0207657_10087659 3300025919 Bacteria 2603
187 Ga0207657_10198653 3300025919 Bacteria 1614
188 Ga0207657_10212548 3300025919 Bacteria 1552
189 Ga0207649_10022703 3300025920 Bacteria 3625
190 Ga0207652_10000383 3300025921 Bacteria 46096
191 Ga0207652_10000831 3300025921 Bacteria 29402
192 Ga0207652_10000939 3300025921 Bacteria 27425
193 Ga0207652_10037201 3300025921 Bacteria 4119
194 Ga0207700_10051634 3300025928 Bacteria 3069
195 Ga0207700_10160746 3300025928 Bacteria 1865
196 Ga0207664_10190584 3300025929 Bacteria 1765
197 Ga0207664_10216687 3300025929 Bacteria 1658
198 Ga0207690_10121928 3300025932 Bacteria 1895
199 Ga0207690_10126222 3300025932 Bacteria 1866
200 Ga0207709_10000008 3300025935 Bacteria 713099
201 Ga0207665_10029800 3300025939 Bacteria 3606
202 Ga0207691_10073421 3300025940 Bacteria 3085
203 Ga0207711_10298780 3300025941 Bacteria 1485
204 Ga0207661_10007962 3300025944 Bacteria 7554
205 Ga0207661_10119193 3300025944 Bacteria 2244
206 Ga0207661_10228146 3300025944 Bacteria 1648
207 Ga0207667_10013719 3300025949 Bacteria 9262
208 Ga0207667_10015447 3300025949 Bacteria 8672
209 Ga0207667_10038893 3300025949 Bacteria 5073
210 Ga0207667_10098002 3300025949 Bacteria 3025
211 Ga0207667_10108731 3300025949 Bacteria 2860
212 Ga0207667_10228629 3300025949 Bacteria 1905
213 Ga0207658_10355203 3300025986 Bacteria 1277
214 Ga0207639_10035987 3300026041 Bacteria 3666
215 Ga0207678_10021475 3300026067 Bacteria 5660
216 Ga0207702_10050237 3300026078 Bacteria 3520
217 Ga0207702_10098049 3300026078 Bacteria 2581
218 Ga0207648_10065526 3300026089 Bacteria 3167
219 Ga0207674_10006140 3300026116 Bacteria 14191
220 Ga0207683_10003439 3300026121 Bacteria 13800
221 Ga0207683_10091228 3300026121 Bacteria 2714
222 Ga0268265_10133411 3300028380 Bacteria 2068
223 Ga0265322_10004498 3300028654 Bacteria 4149
224 Ga0265330_10002857 3300031235 Bacteria 9237
225 Ga0265332_10061071 3300031238 Bacteria 1612
226 Ga0265327_10000234 3300031251 Bacteria 112034
227 Ga0265327_10034543 3300031251 Bacteria 2804
228 Ga0307408_100016961 3300031548 Bacteria 4869
229 Ga0307408_100028097 3300031548 Bacteria 3884
230 Ga0307408_100123170 3300031548 Bacteria 2012
231 Ga0265342_10000391 3300031712 Bacteria 48414
232 Ga0316576_10080975 3300031727 Bacteria 2409
233 Ga0307516_10028154 3300031730 Bacteria 5689
234 Ga0307405_10008832 3300031731 Bacteria 5133
235 Ga0307405_10019981 3300031731 Bacteria 3732
236 Ga0307413_10003399 3300031824 Bacteria 6695
237 Ga0307413_10094431 3300031824 Bacteria 1958
238 Ga0307413_10150789 3300031824 Bacteria 1620
239 Ga0307413_10295294 3300031824 Bacteria 1226
240 Ga0307410_10062399 3300031852 Bacteria 2553
241 Ga0307410_10107631 3300031852 Bacteria 2011
242 Ga0307406_10003498 3300031901 Bacteria 8551
243 Ga0307412_10006717 3300031911 Bacteria 6522
244 Ga0307409_100024644 3300031995 Bacteria 4200
245 Ga0307409_100271241 3300031995 Bacteria 1563
246 Ga0307416_100000645 3300032002 Bacteria 17987
247 Ga0307416_100009110 3300032002 Bacteria 6468
248 Ga0307416_100014539 3300032002 Bacteria 5401
249 Ga0307416_100099362 3300032002 Bacteria 2527
250 Ga0307414_10002657 3300032004 Bacteria 9407
251 Ga0307414_10010586 3300032004 Bacteria 5361
252 Ga0307414_10101653 3300032004 Bacteria 2165
253 Ga0307414_10102579 3300032004 Bacteria 2156
254 Ga0307411_10163906 3300032005 Bacteria 1668
255 Ga0307415_100001074 3300032126 Bacteria 12718
256 Ga0307415_100016388 3300032126 Bacteria 4416
257 Ga0307415_100060415 3300032126 Bacteria 2619
258 Ga0307415_100158415 3300032126 Bacteria 1752
259 Ga0373955_0024699 3300035172 Bacteria 3076
260 Ga0373933_0047088 3300035724 Bacteria 2563
261 Ga0373937_0011668 3300036401 Bacteria 7709
262 Ga0395899_0006917 3300037312 Bacteria 8785
263 Ga0395899_0009618 3300037312 Bacteria 7419
264 Ga0395899_0048931 3300037312 Bacteria 3143
265 Ga0395899_0091217 3300037312 Bacteria 2208
266 Ga0395900_0000203 3300037418 Bacteria 93536
267 Ga0395900_0027824 3300037418 Bacteria 5792
268 Ga0395900_0041156 3300037418 Bacteria 4764
269 Ga0395900_0061350 3300037418 Bacteria 3865
270 Ga0395900_0078098 3300037418 Bacteria 3401
271 Ga0395898_0001285 3300037466 Bacteria 36916
272 Ga0395898_0120233 3300037466 Bacteria 2516
273 Ga0395898_0247238 3300037466 Bacteria 1701
274 Ga0436364_0040101 3300037853 Bacteria 5260
275 Ga0436364_0638094 3300037853 Bacteria 6292
276 Ga0436364_1156440 3300037853 Bacteria 43375
277 Ga0395901_0002230 3300038443 Bacteria 19784
278 Ga0395901_0071453 3300038443 Bacteria 3617
279 Ga0395901_0201345 3300038443 Bacteria 2087
280 Ga0395901_0247845 3300038443 Bacteria 1856
281 Ga0436365_0004784 3300039437 Bacteria 42373
282 Ga0436365_0226253 3300039437 Bacteria 24079
283 Ga0436365_1207904 3300039437 Bacteria 13850
284 Ga0436365_1709655 3300039437 Unclassified 1816
285 Ga0436362_1129554 3300039453 Bacteria 2924
286 Ga0451577_0000723 3300042876 Bacteria 51136
287 Ga0451577_0101910 3300042876 Bacteria 2565
288 Ga0451577_0265560 3300042876 Bacteria 1554
289 Ga0453683_0000747 3300044673 Bacteria 32801
290 Ga0466966_0004073 3300044684 Bacteria 9650
291 Ga0466966_0063806 3300044684 Bacteria 2320
292 Ga0466961_0099188 3300044693 Bacteria 1836
293 Ga0466961_0134056 3300044693 Bacteria 1552
294 Ga0466963_0001189 3300044694 Bacteria 13695
295 Ga0453684_0000033 3300044712 Bacteria 734012
296 Ga0453684_0007166 3300044712 Bacteria 20738
297 Ga0453684_0016322 3300044712 Bacteria 11626
298 Ga0466971_0143981 3300044719 Bacteria 1111
299 Ga0466959_0038572 3300045049 Bacteria 3530
300 Ga0466959_0072964 3300045049 Bacteria 2483
301 Ga0451576_0004888 3300045051 Bacteria 17124
302 Ga0466967_0067161 3300045976 Bacteria 3198
303 Ga0495603_0179565 3300046455 Bacteria 1225
304 Ga0495653_0000907 3300046463 Bacteria 22917
305 Ga0495664_0111251 3300046477 Bacteria 1653
306 Ga0495608_0143089 3300046511 Bacteria 1526
307 Ga0495645_0000022 3300046543 Bacteria 137019
308 Ga0495657_0000041 3300046675 Bacteria 115251
309 Ga0495613_0143852 3300046689 Bacteria 1703
310 Ga0495636_0000333 3300047318 Bacteria 18073
311 Ga0495674_0199008 3300047319 Bacteria 1663
312 Ga0495674_0245097 3300047319 Bacteria 1476
313 Ga0495680_0090707 3300047322 Bacteria 2292
314 Ga0495684_0058470 3300047471 Bacteria 2937
315 Ga0496101_0098620 3300048904 Bacteria 2183
316 Ga0496102_0040605 3300048905 Bacteria 4209
317 Ga0496104_0114190 3300048907 Bacteria 2590
318 Ga0496106_0057241 3300048909 Bacteria 2948
319 Ga0496107_0292594 3300048910 Bacteria 1212
320 Ga0496107_0306097 3300048910 Bacteria 1183
321 Ga0496111_0064027 3300048914 Bacteria 2667
322 Ga0496111_0291865 3300048914 Bacteria 1209
323 Ga0496112_0350928 3300048915 Bacteria 1418
324 Ga0496113_0055725 3300048916 Bacteria 2965
325 Ga0496114_0105473 3300048917 Bacteria 2411
326 Ga0496122_0014325 3300048925 Bacteria 7676
327 Ga0496123_0007946 3300048926 Bacteria 9846
328 Ga0496125_0157164 3300048928 Bacteria 1551
329 Ga0501031_0011072 3300049568 Bacteria 5878
330 Ga0501031_0064622 3300049568 Bacteria 2383
331 Ga0501031_0094239 3300049568 Bacteria 1954
332 Ga0501032_0023957 3300049569 Bacteria 4216
333 Ga0501032_0041693 3300049569 Bacteria 3116
334 Ga0501033_0017096 3300049570 Bacteria 5482
335 Ga0501033_0036122 3300049570 Bacteria 3703
336 Ga0501033_0068449 3300049570 Bacteria 2610
337 Ga0501033_0141884 3300049570 Bacteria 1736
338 Ga0501034_0002811 3300049571 Bacteria 20358
339 Ga0501034_0009934 3300049571 Bacteria 9946
340 Ga0501034_0024790 3300049571 Bacteria 6103
341 Ga0501034_0049541 3300049571 Bacteria 4238
342 Ga0501034_0102285 3300049571 Bacteria 2858
343 Ga0501034_0161392 3300049571 Bacteria 2212
344 Ga0501034_0184583 3300049571 Bacteria 2050
345 Ga0501036_0028227 3300049572 Unclassified 4744
346 Ga0501036_0081803 3300049572 Bacteria 2729
347 Ga0501037_0047899 3300049573 Bacteria 3132
348 Ga0501037_0057356 3300049573 Bacteria 2843
349 Ga0501037_0093647 3300049573 Bacteria 2172
350 Ga0501038_0021286 3300049574 Bacteria 5822
351 Ga0501038_0033830 3300049574 Unclassified 4498
352 Ga0501038_0100699 3300049574 Bacteria 2406
353 Ga0501039_0001109 3300049575 Bacteria 19797
354 Ga0501039_0134797 3300049575 Bacteria 1938
355 Ga0501039_0141451 3300049575 Bacteria 1890
356 Ga0501040_0013383 3300049576 Bacteria 5391
357 Ga0501040_0058005 3300049576 Bacteria 2658
358 Ga0501040_0070009 3300049576 Bacteria 2420
359 Ga0501041_0004521 3300049577 Bacteria 8066
360 Ga0501041_0029786 3300049577 Bacteria 3293
361 Ga0501041_0074044 3300049577 Bacteria 2092
362 Ga0501042_0005712 3300049578 Bacteria 8032
363 Ga0501043_0015884 3300049579 Bacteria 5902
364 Ga0501043_0016048 3300049579 Bacteria 5873
365 Ga0501043_0239628 3300049579 Unclassified 1399
366 Ga0501046_0004485 3300049580 Bacteria 12657
367 Ga0501046_0030253 3300049580 Bacteria 4395
368 Ga0501047_0004075 3300049581 Bacteria 13749
369 Ga0501047_0039448 3300049581 Bacteria 4567
370 Ga0501047_0044308 3300049581 Bacteria 4298
371 Ga0501047_0153102 3300049581 Bacteria 2181
372 Ga0501047_0250728 3300049581 Bacteria 1619
373 Ga0501048_0213807 3300049582 Bacteria 1367
374 Ga0501067_0075306 3300049583 Bacteria 1870
375 Ga0501068_0137473 3300049584 Bacteria 1530
376 Ga0501069_0021149 3300049585 Bacteria 3529
377 Ga0501069_0094041 3300049585 Bacteria 1696
378 Ga0501070_0000631 3300049586 Bacteria 32396
379 Ga0501070_0004818 3300049586 Bacteria 11531
380 Ga0501071_0021014 3300049587 Bacteria 4543
381 Ga0501071_0022767 3300049587 Bacteria 4370
382 Ga0501072_0011740 3300049588 Bacteria 6693
383 Ga0501072_0104293 3300049588 Bacteria 2254
384 Ga0501073_0062219 3300049589 Bacteria 2604
385 Ga0501073_0097286 3300049589 Bacteria 2044
386 Ga0501073_0207868 3300049589 Unclassified 1353
387 Ga0501074_0089764 3300049590 Bacteria 2201
388 Ga0501075_0003196 3300049591 Bacteria 10963
389 Ga0501075_0085301 3300049591 Bacteria 2392
390 Ga0501076_0006378 3300049592 Bacteria 8555
391 Ga0501076_0205645 3300049592 Bacteria 1608
392 Ga0501077_0013105 3300049593 Bacteria 5195
393 Ga0501077_0132366 3300049593 Bacteria 1581
394 Ga0501233_012733 3300049668 Bacteria 1694
395 Ga0501079_0018948 3300049741 Bacteria 5258
396 Ga0501079_0178009 3300049741 Bacteria 1659
397 Ga0501080_0000128 3300049742 Bacteria 53662
398 Ga0501080_0005261 3300049742 Bacteria 11525
399 Ga0501080_0100066 3300049742 Bacteria 2690
400 Ga0501080_0328673 3300049742 Bacteria 1383
401 Ga0501081_0016359 3300049743 Bacteria 4902
402 Ga0501083_0006737 3300049744 Bacteria 8150
403 Ga0501083_0017225 3300049744 Bacteria 5037
404 Ga0501264_000054 3300049761 Bacteria 16104
405 Ga0501035_0000245 3300049822 Bacteria 65283
406 Ga0501035_0000933 3300049822 Bacteria 30964
407 Ga0501035_0013047 3300049822 Bacteria 7667
408 Ga0501035_0016699 3300049822 Bacteria 6768
409 Ga0501035_0022130 3300049822 Bacteria 5839
410 Ga0501035_0033365 3300049822 Unclassified 4682
411 Ga0501035_0088440 3300049822 Bacteria 2730
412 Ga0501035_0170972 3300049822 Bacteria 1877
413 Ga0501035_0177674 3300049822 Bacteria 1836
414 Ga0501044_0004353 3300049823 Bacteria 15860
415 Ga0501044_0007335 3300049823 Bacteria 12117
416 Ga0501044_0019783 3300049823 Bacteria 7192
417 Ga0501044_0068381 3300049823 Bacteria 3618
418 Ga0501044_0099209 3300049823 Bacteria 2931
419 Ga0501044_0110884 3300049823 Bacteria 2752
420 Ga0501044_0150987 3300049823 Bacteria 2305
421 Ga0501044_0193547 3300049823 Bacteria 1995
422 Ga0501045_0011906 3300049824 Bacteria 6114
423 Ga0501045_0034741 3300049824 Bacteria 3660
424 Ga0501045_0043890 3300049824 Bacteria 3256
425 nmdc:mga05p37_25918_c1 3300050507 Bacteria 7128
426 nmdc:mga05p37_342004_c1 3300050507 Bacteria 1764
427 nmdc:mga05p37_40942_c1 3300050507 Bacteria 5689
428 nmdc:mga09592_143475_c1 3300050508 Bacteria 2059
429 nmdc:mga0qj67_204581_c1 3300050509 Bacteria 1604
430 nmdc:mga06r32_37809_c1 3300050510 Bacteria 4567
431 nmdc:mga0rr50_308967_c1 3300050513 Bacteria 1324
432 Ga0495601_0004765 3300053077 Bacteria 7868
433 Ga0495612_0000103 3300053078 Bacteria 36230
434 Ga0500568_0009400 3300053139 Bacteria 4650
435 Ga0500616_0092481 3300053153 Bacteria 1495
436 Ga0501084_0001744 3300054114 Bacteria 17275
437 Ga0501082_0012543 3300060353 Bacteria 7281
438 Ga0501082_0368181 3300060353 Unclassified 1254
439 Ga0530510_0019730 3300061734 Bacteria 4789
440 Ga0530510_0021970 3300061734 Bacteria 4542
441 2722731070 2721755487 Bacteria 6357185
442 2819589350 2818991444 Bacteria 6968812
443 2929922281 2929921140 Bacteria 8649150
444 Ga0157380_10000383
445 SwRhRL2b_contig_254312
446 JGI24735J21928_10053640
447 JGI25406J46586_10006818
448 rootL2_10076218
449 rootL2_10168539
450 rootH1_10005049
451 Ga0070658_10077638
452 Ga0070658_10106805
453 Ga0070658_10214326
454 Ga0070683_100000236
455 Ga0070683_100015553
456 Ga0070670_100228845
457 Ga0070670_100286993
458 Ga0070677_10009308
459 Ga0070680_100028337
460 Ga0070680_100037636
461 Ga0070680_100045335
462 Ga0070682_100000315
463 Ga0068868_100150844
464 Ga0070660_100004805
465 Ga0070660_100021267
466 Ga0070660_100060283
467 Ga0070660_100402811
468 Ga0070689_100151430
469 Ga0070691_10000896
470 Ga0070671_100183094
471 Ga0070674_100075580
472 Ga0070673_100090424
473 Ga0070673_100370041
474 Ga0070659_100040509
475 Ga0070659_100041451
476 Ga0070659_100061700
477 Ga0070659_100211169
478 Ga0070667_100100663
479 Ga0070709_10000842
480 Ga0070714_100019674
481 Ga0070714_100027027
482 Ga0070711_100061528
483 Ga0070708_100000022
484 Ga0070708_100063220
485 Ga0070663_100029008
486 Ga0070663_100094816
487 Ga0070678_100013313
488 Ga0070678_100129349
489 Ga0070662_100205634
490 Ga0070681_10052182
491 Ga0070681_10078008
492 Ga0070681_10318721
493 Ga0070685_10020157
494 Ga0070685_10036049
495 Ga0070706_100001535
496 Ga0070698_100050706
497 Ga0070699_100035352
498 Ga0070699_100140001
499 Ga0070679_100005166
500 Ga0070679_100010126
501 Ga0070679_100032553
502 Ga0070679_100090965
503 Ga0070679_100230837
504 Ga0070684_100001605
505 Ga0068853_100042831
506 Ga0068853_100067655
507 Ga0070672_100154910
508 Ga0070695_100054599
509 Ga0070693_100014807
510 Ga0070693_100030967
511 Ga0070665_100133748
512 Ga0068855_100007528
513 Ga0068855_100016426
514 Ga0068855_100095266
515 Ga0068855_100100676
516 Ga0068855_100105976
517 Ga0070664_100005547
518 Ga0068857_100096266
519 Ga0068857_100276843
520 Ga0068857_100400893
521 Ga0068856_100025417
522 Ga0070702_100079183
523 Ga0068866_10042854
524 Ga0068851_10000171
525 Ga0081455_10005121
526 Ga0081538_10011368
527 Ga0081538_10042943
528 Ga0081540_1003249
529 Ga0081539_10002306
530 Ga0081539_10004967
531 Ga0081539_10015145
532 Ga0070712_100090975
533 Ga0075367_10109305
534 Ga0097621_100318129
535 Ga0075431_100021106
536 Ga0075431_100056847
537 Ga0075429_100009688
538 Ga0075429_100035192
539 Ga0068865_100111955
540 Ga0075435_100039549
541 Ga0105240_10016585
542 Ga0111539_10033471
543 Ga0105245_10210283
544 Ga0114129_10025797
545 Ga0114129_10137924
546 Ga0114129_10295619
547 Ga0114129_10824425
548 Ga0105243_10000003
549 Ga0105243_10427060
550 Ga0105241_10010626
551 Ga0105248_10043814
552 Ga0105237_10206465
553 Ga0105237_10261111
554 Ga0105238_10001579
555 Ga0157373_10009211
556 Ga0157373_10013071
557 Ga0157373_10048853
558 Ga0157371_10000584
559 Ga0157371_10001101
560 Ga0157371_10003314
561 Ga0157371_10005044
562 Ga0157371_10006737
563 Ga0157371_10029488
564 Ga0157371_10058113
565 Ga0157371_10112750
566 Ga0157371_10137067
567 Ga0157370_10000821
568 Ga0157370_10001675
569 Ga0157370_10061411
570 Ga0157370_10065875
571 Ga0157370_10089620
572 Ga0157370_10173980
573 Ga0157370_10229755
574 Ga0157369_10062214
575 Ga0157369_10121014
576 Ga0157369_10134430
577 Ga0163162_10095354
578 Ga0157372_10021733
579 Ga0157372_10027898
580 Ga0157372_10030583
581 Ga0157372_10061828
582 Ga0157372_10078405
583 Ga0157372_10085048
584 Ga0157372_10256905
585 Ga0157372_10354850
586 Ga0157372_10384146
587 Ga0157372_10384556
588 Ga0157372_10389001
589 Ga0157375_10001388
590 Ga0157375_10167313
591 Ga0163163_10097337
592 Ga0157380_10000067
593 Ga0157380_10014932
594 Ga0157380_10067083
595 Ga0157380_10186368
596 Ga0182008_10014581
597 Ga0157379_10043387
598 Ga0157379_10290298
599 Ga0157376_10493963
600 Ga0182007_10002043
601 Ga0182007_10003083
602 Ga0213876_10001274
603 Ga0213876_10003196
604 Ga0213876_10072671
605 Ga0213875_10000693
606 Ga0207656_10000250
607 Ga0207642_10032685
608 Ga0207680_10011709
609 Ga0207647_10065956
610 Ga0207699_10005231
611 Ga0207705_10018439
612 Ga0207705_10021406
613 Ga0207705_10050391
614 Ga0207705_10072741
615 Ga0207705_10135055
616 Ga0207684_10029871
617 Ga0207654_10012479
618 Ga0207707_10000456
619 Ga0207707_10031689
620 Ga0207707_10280275
621 Ga0207695_10242171
622 Ga0207671_10046745
623 Ga0207693_10213637
624 Ga0207660_10025045
625 Ga0207660_10029276
626 Ga0207657_10010191
627 Ga0207657_10015465
628 Ga0207657_10023224
629 Ga0207657_10087659
630 Ga0207657_10198653
631 Ga0207657_10212548
632 Ga0207649_10022703
633 Ga0207652_10000383
634 Ga0207652_10000831
635 Ga0207652_10000939
636 Ga0207652_10037201
637 Ga0207700_10051634
638 Ga0207700_10160746
639 Ga0207664_10190584
640 Ga0207664_10216687
641 Ga0207690_10121928
642 Ga0207690_10126222
643 Ga0207709_10000008
644 Ga0207665_10029800
645 Ga0207691_10073421
646 Ga0207711_10298780
647 Ga0207661_10007962
648 Ga0207661_10119193
649 Ga0207661_10228146
650 Ga0207667_10013719
651 Ga0207667_10015447
652 Ga0207667_10038893
653 Ga0207667_10098002
654 Ga0207667_10108731
655 Ga0207667_10228629
656 Ga0207658_10355203
657 Ga0207639_10035987
658 Ga0207678_10021475
659 Ga0207702_10050237
660 Ga0207702_10098049
661 Ga0207648_10065526
662 Ga0207674_10006140
663 Ga0207683_10003439
664 Ga0207683_10091228
665 Ga0268265_10133411
666 Ga0265322_10004498
667 Ga0265330_10002857
668 Ga0265332_10061071
669 Ga0265327_10000234
670 Ga0265327_10034543
671 Ga0307408_100016961
672 Ga0307408_100028097
673 Ga0307408_100123170
674 Ga0265342_10000391
675 Ga0316576_10080975
676 Ga0307516_10028154
677 Ga0307405_10008832
678 Ga0307405_10019981
679 Ga0307413_10003399
680 Ga0307413_10094431
681 Ga0307413_10150789
682 Ga0307413_10295294
683 Ga0307410_10062399
684 Ga0307410_10107631
685 Ga0307406_10003498
686 Ga0307412_10006717
687 Ga0307409_100024644
688 Ga0307409_100271241
689 Ga0307416_100000645
690 Ga0307416_100009110
691 Ga0307416_100014539
692 Ga0307416_100099362
693 Ga0307414_10002657
694 Ga0307414_10010586
695 Ga0307414_10101653
696 Ga0307414_10102579
697 Ga0307411_10163906
698 Ga0307415_100001074
699 Ga0307415_100016388
700 Ga0307415_100060415
701 Ga0307415_100158415
702 Ga0373955_0024699
703 Ga0373933_0047088
704 Ga0373937_0011668
705 Ga0395899_0006917
706 Ga0395899_0009618
707 Ga0395899_0048931
708 Ga0395899_0091217
709 Ga0395900_0000203
710 Ga0395900_0027824
711 Ga0395900_0041156
712 Ga0395900_0061350
713 Ga0395900_0078098
714 Ga0395898_0001285
715 Ga0395898_0120233
716 Ga0395898_0247238
717 Ga0436364_0040101
718 Ga0436364_0638094
719 Ga0436364_1156440
720 Ga0395901_0002230
721 Ga0395901_0071453
722 Ga0395901_0201345
723 Ga0395901_0247845
724 Ga0436365_0004784
725 Ga0436365_0226253
726 Ga0436365_1207904
727 Ga0436365_1709655
728 Ga0436362_1129554
729 Ga0451577_0000723
730 Ga0451577_0101910
731 Ga0451577_0265560
732 Ga0453683_0000747
733 Ga0466966_0004073
734 Ga0466966_0063806
735 Ga0466961_0099188
736 Ga0466961_0134056
737 Ga0466963_0001189
738 Ga0453684_0000033
739 Ga0453684_0007166
740 Ga0453684_0016322
741 Ga0466971_0143981
742 Ga0466959_0038572
743 Ga0466959_0072964
744 Ga0451576_0004888
745 Ga0466967_0067161
746 Ga0495603_0179565
747 Ga0495653_0000907
748 Ga0495664_0111251
749 Ga0495608_0143089
750 Ga0495645_0000022
751 Ga0495657_0000041
752 Ga0495613_0143852
753 Ga0495636_0000333
754 Ga0495674_0199008
755 Ga0495674_0245097
756 Ga0495680_0090707
757 Ga0495684_0058470
758 Ga0496101_0098620
759 Ga0496102_0040605
760 Ga0496104_0114190
761 Ga0496106_0057241
762 Ga0496107_0292594
763 Ga0496107_0306097
764 Ga0496111_0064027
765 Ga0496111_0291865
766 Ga0496112_0350928
767 Ga0496113_0055725
768 Ga0496114_0105473
769 Ga0496122_0014325
770 Ga0496123_0007946
771 Ga0496125_0157164
772 Ga0501031_0011072
773 Ga0501031_0064622
774 Ga0501031_0094239
775 Ga0501032_0023957
776 Ga0501032_0041693
777 Ga0501033_0017096
778 Ga0501033_0036122
779 Ga0501033_0068449
780 Ga0501033_0141884
781 Ga0501034_0002811
782 Ga0501034_0009934
783 Ga0501034_0024790
784 Ga0501034_0049541
785 Ga0501034_0102285
786 Ga0501034_0161392
787 Ga0501034_0184583
788 Ga0501036_0028227
789 Ga0501036_0081803
790 Ga0501037_0047899
791 Ga0501037_0057356
792 Ga0501037_0093647
793 Ga0501038_0021286
794 Ga0501038_0033830
795 Ga0501038_0100699
796 Ga0501039_0001109
797 Ga0501039_0134797
798 Ga0501039_0141451
799 Ga0501040_0013383
800 Ga0501040_0058005
801 Ga0501040_0070009
802 Ga0501041_0004521
803 Ga0501041_0029786
804 Ga0501041_0074044
805 Ga0501042_0005712
806 Ga0501043_0015884
807 Ga0501043_0016048
808 Ga0501043_0239628
809 Ga0501046_0004485
810 Ga0501046_0030253
811 Ga0501047_0004075
812 Ga0501047_0039448
813 Ga0501047_0044308
814 Ga0501047_0153102
815 Ga0501047_0250728
816 Ga0501048_0213807
817 Ga0501067_0075306
818 Ga0501068_0137473
819 Ga0501069_0021149
820 Ga0501069_0094041
821 Ga0501070_0000631
822 Ga0501070_0004818
823 Ga0501071_0021014
824 Ga0501071_0022767
825 Ga0501072_0011740
826 Ga0501072_0104293
827 Ga0501073_0062219
828 Ga0501073_0097286
829 Ga0501073_0207868
830 Ga0501074_0089764
831 Ga0501075_0003196
832 Ga0501075_0085301
833 Ga0501076_0006378
834 Ga0501076_0205645
835 Ga0501077_0013105
836 Ga0501077_0132366
837 Ga0501233_012733
838 Ga0501079_0018948
839 Ga0501079_0178009
840 Ga0501080_0000128
841 Ga0501080_0005261
842 Ga0501080_0100066
843 Ga0501080_0328673
844 Ga0501081_0016359
845 Ga0501083_0006737
846 Ga0501083_0017225
847 Ga0501264_000054
848 Ga0501035_0000245
849 Ga0501035_0000933
850 Ga0501035_0013047
851 Ga0501035_0016699
852 Ga0501035_0022130
853 Ga0501035_0033365
854 Ga0501035_0088440
855 Ga0501035_0170972
856 Ga0501035_0177674
857 Ga0501044_0004353
858 Ga0501044_0007335
859 Ga0501044_0019783
860 Ga0501044_0068381
861 Ga0501044_0099209
862 Ga0501044_0110884
863 Ga0501044_0150987
864 Ga0501044_0193547
865 Ga0501045_0011906
866 Ga0501045_0034741
867 Ga0501045_0043890
868 nmdc:mga05p37_25918_c1
869 nmdc:mga05p37_342004_c1
870 nmdc:mga05p37_40942_c1
871 nmdc:mga09592_143475_c1
872 nmdc:mga0qj67_204581_c1
873 nmdc:mga06r32_37809_c1
874 nmdc:mga0rr50_308967_c1
875 Ga0495601_0004765
876 Ga0495612_0000103
877 Ga0500568_0009400
878 Ga0500616_0092481
879 Ga0501084_0001744
880 Ga0501082_0012543
881 Ga0501082_0368181
882 Ga0530510_0019730
883 Ga0530510_0021970
884 2722731070
885 2819589350
886 2929922281

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

1

304

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i7g-assembly1.cif.gz_A crystal structure of monooxygenase from agrobacterium tumefaciens 0.9717 1 342
2i7g-assembly1.cif.gz_A crystal structure of monooxygenase from agrobacterium tumefaciens 0.9634 1 342
7bip-assembly1.cif.gz_B crystal structure of monooxygenase rslo1 from streptomyces bottropensis 0.8881 1 337
7bip-assembly1.cif.gz_B crystal structure of monooxygenase rslo1 from streptomyces bottropensis 0.8805 1 337
1luc-assembly1.cif.gz_A bacterial luciferase 0.8764 1 338
ID Description Score Start End Superfamily
2i7gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9678 1 342 3.20.20.30
af_Q2G136_3_353_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9646 1 343 3.20.20.30
2i7gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9621 1 342 3.20.20.30
af_Q2G136_3_353_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9482 1 343 3.20.20.30
1bslA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8664 1 343 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A2W6S7C1-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9922 1 140 GO:0004497
GO:0005829
GO:0016705
AF-A0A2W6S7C1-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9852 1 140 GO:0004497
GO:0005829
GO:0016705
AF-A0A0F2E5X6-F1-model_v4 deleted 0.9816 32 234
AF-A0A2W4U291-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9798 1 297 GO:0004497
GO:0005829
GO:0016705
AF-A0A6J4T203-F1-model_v4 Oxidoreductase 0.9796 136 346 GO:0004497
GO:0005829
GO:0016705

Map