F445087

General Info

Members Datasets Scaffolds Average Seq Length
443 259 886 413

Family's Representative Sequence

Representative Sequence 3300025295|Ga0209564_1003913|Ga0209564_10039136
Length 468
Sequence MDEAEFVGHKGRNDLRGGGRAESLPFPSAAAATTNRSGPRPRGEPMNRRFAFLIIAAMVLGILVGWVCNQYLDPAQTAEAVKWFKMGTDLFLRLIKMIIAPLVFTTLVAGIAHMEDAAAVGRIGAKTMGWFISASAVSLLLGLLMVHLLHPGAGLVLNEATSAAANAPAASTETFTLQGFLTHLVPTSIFDAMAKNEILQIVVFSLFVGTAVASLDNKAPHILELAEQGAQIMLKVTGFVMKLAPLAIFCALASTIAAQGLSMLAVYGKFVLGFYATMGTLWLLLFIAAFLVLGKRAVPLFGTIREPALLAFSTASSEAAYPRILDALPKLGIRRRIVSFVLPLGYSFNLDGSMLYCTFATVFILQAHGVHLSIQQQIFMLLLLMVTSKGIAGVPRASLVVIMATLTYFGLPETWIALVLGVDHLLDMGRSATNVVGNSVAAAVVAKWEGELDDPEPDVAAEAEAAKA

Samples

Sample ID Description Type Environment
1 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
86 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
130 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
133 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
134 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
140 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
141 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
142 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
154 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
155 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
156 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
160 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
161 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
162 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
163 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
164 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
165 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
166 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
167 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
168 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
169 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
170 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
171 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
172 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
173 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
176 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
179 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
180 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
181 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
182 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
183 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
184 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
193 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
194 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
197 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
204 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
205 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
206 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
207 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
208 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
209 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
210 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
211 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
212 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
213 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
214 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
215 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
216 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
217 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
218 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
219 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
220 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
221 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
222 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
223 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
224 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
225 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
226 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
227 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
228 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
229 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
230 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
231 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
232 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
233 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
234 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
235 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
236 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
237 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
238 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
239 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
240 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
241 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
242 2643221583 Caulobacter sp. Root655 Isolate Unclassified
243 2643221584 Caulobacter sp. Root656 Isolate Unclassified
244 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
245 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
246 2643221640 Caulobacter sp. Root342 Isolate Unclassified
247 2643221642 Caulobacter sp. Root343 Isolate Unclassified
248 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
249 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
250 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
251 2818991435 Caulobacter henricii 536 Isolate Unclassified
252 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
253 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
254 2851153111 Caulobacter radicis 736 Isolate Unclassified
255 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
256 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
257 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
258 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
259 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93
Metatranscriptomes 0
Isolates 7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.83
Nodule 0
Rhizoplane 2.71
Rhizosphere 67.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209564_1003913 3300025295 Bacteria 9537
2 JGI24736J21556_1000037 3300001904 Bacteria 22185
3 JGI24740J21852_10012740 3300001979 Bacteria 3161
4 JGI24739J22299_10003077 3300001989 Bacteria 6367
5 JGI24737J22298_10007624 3300001990 Bacteria 3645
6 JGI24735J21928_10007565 3300002067 Bacteria 3541
7 JGI24750J21931_1000681 3300002070 Bacteria 4943
8 JGI24748J21848_1000015 3300002074 Bacteria 143883
9 JGI24738J21930_10000334 3300002075 Bacteria 12870
10 JGI24749J21850_1000240 3300002076 Bacteria 8545
11 JGI24034J26672_10000006 3300002239 Bacteria 294495
12 JGI24742J22300_10001113 3300002244 Bacteria 4164
13 JGI24751J29686_10000135 3300002459 Bacteria 37169
14 JGI25153J46596_10034394 3300003215 Bacteria 1657
15 Ga0055537_1001888 3300003773 Bacteria 7521
16 Ga0055524_1012190 3300003775 Bacteria 3314
17 Ga0055524_1017739 3300003775 Bacteria 2498
18 Ga0055528_1009909 3300003790 Bacteria 3933
19 Ga0055530_10002060 3300003791 Bacteria 13517
20 Ga0055531_10000930 3300003794 Bacteria 23675
21 Ga0055531_10001767 3300003794 Bacteria 15393
22 Ga0065165_1001513 3300005262 Bacteria 24537
23 Ga0065165_1006815 3300005262 Bacteria 5828
24 Ga0065707_10083538 3300005295 Bacteria 8829
25 Ga0070658_10000708 3300005327 Bacteria 28835
26 Ga0070658_10021907 3300005327 Bacteria 5125
27 Ga0070658_10057143 3300005327 Bacteria 3173
28 Ga0070658_10073661 3300005327 Bacteria 2801
29 Ga0070690_100000074 3300005330 Bacteria 48493
30 Ga0070670_100000090 3300005331 Bacteria 86222
31 Ga0068869_100037418 3300005334 Bacteria 3450
32 Ga0070666_10000014 3300005335 Bacteria 224479
33 Ga0068868_100138717 3300005338 Bacteria 1995
34 Ga0070660_100052011 3300005339 Bacteria 3156
35 Ga0070661_100037056 3300005344 Bacteria 3547
36 Ga0070668_100001179 3300005347 Bacteria 18500
37 Ga0070669_100000093 3300005353 Bacteria 87563
38 Ga0070669_100000304 3300005353 Bacteria 38742
39 Ga0070669_100002305 3300005353 Bacteria 13824
40 Ga0070671_100002815 3300005355 Bacteria 13518
41 Ga0070688_100010173 3300005365 Bacteria 5177
42 Ga0070659_100058404 3300005366 Bacteria 3044
43 Ga0070659_100108718 3300005366 Bacteria 2237
44 Ga0070667_100001444 3300005367 Bacteria 21298
45 Ga0070667_100022770 3300005367 Bacteria 5195
46 Ga0070667_100045508 3300005367 Bacteria 3690
47 Ga0070662_100028593 3300005457 Bacteria 3881
48 Ga0070681_10007565 3300005458 Bacteria 10617
49 Ga0070679_100014656 3300005530 Bacteria 7534
50 Ga0068853_100004158 3300005539 Bacteria 11155
51 Ga0068853_100010230 3300005539 Bacteria 7585
52 Ga0068853_100100521 3300005539 Bacteria 2557
53 Ga0068853_100186988 3300005539 Bacteria 1881
54 Ga0068853_100348593 3300005539 Bacteria 1377
55 Ga0070686_100000002 3300005544 Bacteria 336303
56 Ga0070665_100000025 3300005548 Bacteria 367488
57 Ga0070665_100002155 3300005548 Bacteria 21958
58 Ga0070665_100026184 3300005548 Bacteria 5873
59 Ga0068855_100007416 3300005563 Bacteria 13279
60 Ga0068855_100010626 3300005563 Bacteria 11098
61 Ga0068855_100011377 3300005563 Bacteria 10744
62 Ga0068855_100029762 3300005563 Bacteria 6529
63 Ga0068854_100000843 3300005578 Bacteria 18349
64 Ga0068856_100208743 3300005614 Bacteria 1968
65 Ga0068856_100382966 3300005614 Bacteria 1426
66 Ga0068852_100000337 3300005616 Bacteria 31862
67 Ga0068859_100001618 3300005617 Bacteria 23030
68 Ga0068859_100009705 3300005617 Bacteria 9718
69 Ga0068859_100013233 3300005617 Bacteria 8278
70 Ga0068864_100000067 3300005618 Bacteria 115834
71 Ga0068864_100000127 3300005618 Bacteria 74135
72 Ga0068864_100002381 3300005618 Bacteria 15540
73 Ga0068864_100011026 3300005618 Bacteria 7471
74 Ga0068861_100001742 3300005719 Bacteria 13972
75 Ga0068861_100036270 3300005719 Bacteria 3658
76 Ga0068863_100000237 3300005841 Bacteria 58657
77 Ga0068863_100000541 3300005841 Bacteria 38515
78 Ga0068863_100015575 3300005841 Bacteria 7306
79 Ga0068858_100000020 3300005842 Bacteria 175896
80 Ga0068858_100002657 3300005842 Bacteria 17987
81 Ga0068858_100023998 3300005842 Bacteria 5682
82 Ga0068860_100000001 3300005843 Bacteria 703043
83 Ga0068860_100000027 3300005843 Bacteria 267207
84 Ga0068860_100023882 3300005843 Bacteria 5910
85 Ga0068862_100000048 3300005844 Bacteria 150043
86 Ga0068862_100000126 3300005844 Bacteria 89210
87 Ga0068862_100017037 3300005844 Bacteria 6045
88 Ga0068862_100144412 3300005844 Bacteria 2114
89 Ga0070717_10076777 3300006028 Bacteria 2796
90 Ga0075368_10004849 3300006042 Bacteria 4586
91 Ga0075364_10000499 3300006051 Bacteria 19964
92 Ga0075369_10018205 3300006186 Bacteria 2858
93 Ga0075369_10074201 3300006186 Bacteria 1500
94 Ga0075366_10032544 3300006195 Bacteria 3069
95 Ga0068865_100009151 3300006881 Bacteria 6129
96 Ga0097620_100001618 3300006931 Bacteria 23030
97 Ga0097620_100009706 3300006931 Bacteria 9718
98 Ga0097620_100013233 3300006931 Bacteria 8278
99 Ga0105251_10000241 3300009011 Bacteria 54940
100 Ga0105250_10007725 3300009092 Bacteria 4608
101 Ga0105240_10000156 3300009093 Bacteria 139950
102 Ga0105240_10004673 3300009093 Bacteria 20699
103 Ga0105247_10055785 3300009101 Bacteria 2438
104 Ga0105242_10121033 3300009176 Bacteria 2246
105 Ga0105248_10000155 3300009177 Bacteria 79121
106 Ga0105248_10000454 3300009177 Bacteria 46692
107 Ga0105248_10004217 3300009177 Bacteria 15903
108 Ga0105248_10008368 3300009177 Bacteria 11362
109 Ga0105248_10010014 3300009177 Bacteria 10436
110 Ga0105237_10001457 3300009545 Bacteria 31207
111 Ga0105237_10408949 3300009545 Bacteria 1362
112 Ga0105238_10007800 3300009551 Bacteria 10707
113 Ga0105249_10000005 3300009553 Bacteria 362467
114 Ga0105249_10003389 3300009553 Bacteria 13802
115 Ga0105239_10001406 3300010375 Bacteria 32187
116 Ga0105239_10197671 3300010375 Bacteria 2252
117 Ga0105239_10202515 3300010375 Bacteria 2224
118 Ga0157371_10001910 3300013102 Bacteria 20840
119 Ga0157370_10160109 3300013104 Bacteria 2095
120 Ga0157369_10018155 3300013105 Bacteria 7890
121 Ga0157369_10040454 3300013105 Bacteria 5088
122 Ga0157369_10145843 3300013105 Bacteria 2503
123 Ga0163162_10090598 3300013306 Bacteria 3140
124 Ga0157372_10089995 3300013307 Bacteria 3488
125 Ga0163163_10004271 3300014325 Bacteria 12174
126 Ga0163163_10021751 3300014325 Bacteria 6058
127 Ga0157380_10000137 3300014326 Bacteria 40923
128 Ga0157380_10000223 3300014326 Bacteria 33890
129 Ga0157379_10001771 3300014968 Bacteria 17815
130 Ga0157379_10003874 3300014968 Bacteria 12752
131 Ga0163161_10000559 3300017792 Bacteria 29995
132 Ga0213876_10010428 3300021384 Bacteria 4987
133 Ga0207672_1001347 3300025223 Bacteria 1964
134 Ga0209565_1000179 3300025263 Bacteria 79300
135 Ga0209673_1001240 3300025273 Bacteria 26584
136 Ga0209675_1014925 3300025291 Bacteria 2336
137 Ga0209676_1000253 3300025292 Bacteria 113412
138 Ga0209758_1000894 3300025297 Bacteria 40579
139 Ga0209050_1000173 3300025298 Bacteria 149800
140 Ga0209050_1000649 3300025298 Bacteria 53856
141 Ga0209050_1001834 3300025298 Bacteria 20662
142 Ga0209256_1005813 3300025299 Bacteria 6875
143 Ga0209256_1010954 3300025299 Bacteria 3710
144 Ga0209256_1023109 3300025299 Bacteria 1863
145 Ga0209051_1002693 3300025303 Bacteria 12365
146 Ga0209257_1000196 3300025304 Bacteria 149656
147 Ga0209257_1000364 3300025304 Bacteria 91820
148 Ga0209257_1001017 3300025304 Bacteria 37734
149 Ga0209257_1002949 3300025304 Bacteria 15613
150 Ga0207696_1013327 3300025711 Bacteria 2870
151 Ga0207713_1029629 3300025735 Bacteria 2448
152 Ga0207680_10000004 3300025903 Bacteria 827324
153 Ga0207647_10000038 3300025904 Bacteria 94897
154 Ga0207647_10045722 3300025904 Bacteria 2730
155 Ga0207705_10000157 3300025909 Bacteria 73563
156 Ga0207705_10001784 3300025909 Bacteria 16963
157 Ga0207654_10024848 3300025911 Bacteria 3226
158 Ga0207695_10000250 3300025913 Bacteria 139984
159 Ga0207695_10001288 3300025913 Bacteria 42577
160 Ga0207695_10002305 3300025913 Bacteria 28454
161 Ga0207695_10003077 3300025913 Bacteria 23893
162 Ga0207695_10053728 3300025913 Bacteria 4210
163 Ga0207671_10001429 3300025914 Bacteria 27685
164 Ga0207671_10003755 3300025914 Bacteria 14950
165 Ga0207660_10000681 3300025917 Bacteria 22727
166 Ga0207660_10035160 3300025917 Bacteria 3476
167 Ga0207660_10049656 3300025917 Bacteria 2976
168 Ga0207657_10001673 3300025919 Bacteria 23919
169 Ga0207657_10110429 3300025919 Bacteria 2271
170 Ga0207652_10004669 3300025921 Bacteria 11109
171 Ga0207652_10042913 3300025921 Bacteria 3850
172 Ga0207681_10000005 3300025923 Bacteria 555724
173 Ga0207681_10000152 3300025923 Bacteria 57600
174 Ga0207681_10001688 3300025923 Bacteria 14203
175 Ga0207694_10005393 3300025924 Bacteria 9841
176 Ga0207694_10071428 3300025924 Bacteria 2712
177 Ga0207650_10000004 3300025925 Bacteria 743372
178 Ga0207650_10000452 3300025925 Bacteria 34879
179 Ga0207650_10050044 3300025925 Bacteria 3088
180 Ga0207650_10060470 3300025925 Bacteria 2827
181 Ga0207644_10000956 3300025931 Bacteria 18437
182 Ga0207644_10016847 3300025931 Bacteria 4923
183 Ga0207690_10000116 3300025932 Bacteria 65776
184 Ga0207706_10051090 3300025933 Bacteria 3651
185 Ga0207686_10230260 3300025934 Bacteria 1343
186 Ga0207670_10010762 3300025936 Bacteria 5281
187 Ga0207711_10000017 3300025941 Bacteria 441730
188 Ga0207711_10000464 3300025941 Bacteria 42035
189 Ga0207711_10001118 3300025941 Bacteria 25658
190 Ga0207711_10001710 3300025941 Bacteria 20197
191 Ga0207711_10021499 3300025941 Bacteria 5390
192 Ga0207667_10000006 3300025949 Bacteria 679876
193 Ga0207667_10000091 3300025949 Bacteria 148651
194 Ga0207667_10005755 3300025949 Bacteria 15129
195 Ga0207667_10041526 3300025949 Bacteria 4892
196 Ga0207667_10094032 3300025949 Bacteria 3095
197 Ga0207667_10101163 3300025949 Bacteria 2973
198 Ga0207712_10000001 3300025961 Bacteria 750309
199 Ga0207712_10000113 3300025961 Bacteria 88030
200 Ga0207640_10000766 3300025981 Bacteria 18386
201 Ga0207658_10000119 3300025986 Bacteria 86779
202 Ga0207658_10000483 3300025986 Bacteria 36812
203 Ga0207658_10000907 3300025986 Bacteria 24619
204 Ga0207658_10076185 3300025986 Bacteria 2554
205 Ga0207677_10066126 3300026023 Bacteria 2526
206 Ga0207703_10000082 3300026035 Bacteria 110579
207 Ga0207703_10003897 3300026035 Bacteria 12390
208 Ga0207639_10000185 3300026041 Bacteria 48694
209 Ga0207639_10026976 3300026041 Bacteria 4179
210 Ga0207678_10007379 3300026067 Bacteria 9732
211 Ga0207678_10037093 3300026067 Bacteria 4241
212 Ga0207702_10332321 3300026078 Bacteria 1450
213 Ga0207641_10000007 3300026088 Bacteria 441443
214 Ga0207641_10000008 3300026088 Bacteria 424415
215 Ga0207641_10000033 3300026088 Bacteria 219261
216 Ga0207641_10014295 3300026088 Bacteria 6504
217 Ga0207648_10168795 3300026089 Bacteria 1934
218 Ga0207676_10000006 3300026095 Bacteria 681936
219 Ga0207676_10000019 3300026095 Bacteria 305653
220 Ga0207676_10002060 3300026095 Bacteria 14590
221 Ga0207676_10005298 3300026095 Bacteria 9134
222 Ga0207674_10009512 3300026116 Bacteria 11097
223 Ga0207675_100000171 3300026118 Bacteria 58198
224 Ga0207675_100000385 3300026118 Bacteria 42428
225 Ga0207675_100033773 3300026118 Bacteria 4767
226 Ga0207698_10000333 3300026142 Bacteria 27984
227 Ga0209981_1000450 3300027378 Bacteria 5205
228 Ga0268266_10000003 3300028379 Bacteria 1701703
229 Ga0268266_10000028 3300028379 Bacteria 425294
230 Ga0268266_10009290 3300028379 Bacteria 8674
231 Ga0268266_10066004 3300028379 Bacteria 3129
232 Ga0268266_10105644 3300028379 Bacteria 2488
233 Ga0268265_10000001 3300028380 Bacteria 1230727
234 Ga0268265_10000011 3300028380 Bacteria 343832
235 Ga0268265_10000071 3300028380 Bacteria 132890
236 Ga0268265_10004520 3300028380 Bacteria 9629
237 Ga0268265_10031272 3300028380 Bacteria 3843
238 Ga0268264_10000006 3300028381 Bacteria 827324
239 Ga0268264_10000181 3300028381 Bacteria 134092
240 Ga0268264_10011436 3300028381 Bacteria 7330
241 Ga0307517_10003203 3300028786 Bacteria 25702
242 Ga0307517_10070948 3300028786 Bacteria 3130
243 Ga0307515_10076827 3300028794 Bacteria 4421
244 Ga0307515_10085750 3300028794 Bacteria 4025
245 Ga0307515_10097211 3300028794 Bacteria 3601
246 Ga0307515_10167003 3300028794 Bacteria 2213
247 Ga0265338_10050438 3300028800 Bacteria 3762
248 Ga0265327_10000287 3300031251 Bacteria 99268
249 Ga0265327_10002320 3300031251 Bacteria 20341
250 Ga0307513_10000077 3300031456 Bacteria 134167
251 Ga0307513_10003660 3300031456 Bacteria 20800
252 Ga0307513_10007104 3300031456 Bacteria 14560
253 Ga0307513_10018914 3300031456 Bacteria 8213
254 Ga0307516_10000030 3300031730 Bacteria 159694
255 Ga0307413_10032906 3300031824 Bacteria 2945
256 Ga0307410_10111005 3300031852 Bacteria 1984
257 Ga0307406_10138352 3300031901 Bacteria 1720
258 Ga0307414_10000202 3300032004 Bacteria 40091
259 Ga0307414_10049900 3300032004 Bacteria 2896
260 Ga0307510_10043919 3300033180 Bacteria 4849
261 Ga0307510_10069742 3300033180 Bacteria 3518
262 Ga0373960_0009148 3300035121 Bacteria 2392
263 Ga0373946_0048624 3300035171 Bacteria 1766
264 Ga0373961_0020618 3300035241 Bacteria 1745
265 Ga0373931_0001350 3300035691 Bacteria 10502
266 Ga0373927_0000831 3300035695 Bacteria 23649
267 Ga0373925_0000984 3300037068 Bacteria 25954
268 Ga0395899_0000486 3300037312 Bacteria 44413
269 Ga0395900_0000008 3300037418 Bacteria 480459
270 Ga0395900_0026680 3300037418 Bacteria 5914
271 Ga0395900_0152018 3300037418 Bacteria 2364
272 Ga0395898_0020955 3300037466 Bacteria 6632
273 Ga0395905_0003251 3300037471 Bacteria 17474
274 Ga0395905_0011963 3300037471 Bacteria 8366
275 Ga0436364_0062945 3300037853 Bacteria 5623
276 Ga0395901_0000008 3300038443 Bacteria 495962
277 Ga0436365_1127900 3300039437 Bacteria 5066
278 Ga0439445_0037414 3300042004 Bacteria 1280
279 Ga0439435_0007160 3300042436 Bacteria 2538
280 Ga0453684_0295664 3300044712 Bacteria 1842
281 Ga0495627_000511 3300046453 Bacteria 32184
282 Ga0495629_0022694 3300046459 Bacteria 4473
283 Ga0495638_0001235 3300046460 Bacteria 24108
284 Ga0495638_0003577 3300046460 Bacteria 12168
285 Ga0495638_0007109 3300046460 Bacteria 8072
286 Ga0495638_0009533 3300046460 Bacteria 6805
287 Ga0495638_0026395 3300046460 Bacteria 3763
288 Ga0495638_0053557 3300046460 Bacteria 2511
289 Ga0495650_0000024 3300046471 Bacteria 496674
290 Ga0495583_0000025 3300046506 Bacteria 263775
291 Ga0495606_0006495 3300046507 Bacteria 10756
292 Ga0495610_0000478 3300046512 Bacteria 41250
293 Ga0495610_0004119 3300046512 Bacteria 10879
294 Ga0495610_0009039 3300046512 Bacteria 6356
295 Ga0495616_0005214 3300046513 Bacteria 8035
296 Ga0495620_0023949 3300046515 Bacteria 2910
297 Ga0495631_0081894 3300046518 Bacteria 1392
298 Ga0495632_0004458 3300046519 Bacteria 9510
299 Ga0495637_0010312 3300046520 Bacteria 4526
300 Ga0495637_0018260 3300046520 Bacteria 3256
301 Ga0495648_0000634 3300046524 Bacteria 37553
302 Ga0495648_0041139 3300046524 Bacteria 2922
303 Ga0495648_0054033 3300046524 Bacteria 2429
304 Ga0495642_0012414 3300046528 Bacteria 3284
305 Ga0495654_0000135 3300046530 Bacteria 77516
306 Ga0495609_0005335 3300046538 Bacteria 6787
307 Ga0495597_0002511 3300046542 Bacteria 11530
308 Ga0495622_0009313 3300046557 Bacteria 4544
309 Ga0495668_0000291 3300046616 Bacteria 68802
310 Ga0495668_0005699 3300046616 Bacteria 8337
311 Ga0495668_0010898 3300046616 Bacteria 5474
312 Ga0495668_0014658 3300046616 Bacteria 4591
313 Ga0495625_0002176 3300046660 Bacteria 21762
314 Ga0495625_0042930 3300046660 Bacteria 3282
315 Ga0495625_0057973 3300046660 Bacteria 2752
316 Ga0495625_0157772 3300046660 Bacteria 1522
317 Ga0495659_0034172 3300046664 Bacteria 1787
318 Ga0495669_0000044 3300046684 Bacteria 85633
319 Ga0495669_0070251 3300046684 Bacteria 1594
320 Ga0495589_0012780 3300046794 Bacteria 4341
321 Ga0495660_0025068 3300046810 Bacteria 3390
322 Ga0495672_0001086 3300047320 Bacteria 27612
323 Ga0495683_0052985 3300047323 Bacteria 2024
324 Ga0495673_0000939 3300047469 Bacteria 26438
325 Ga0495673_0001300 3300047469 Bacteria 20332
326 Ga0495681_0020989 3300047470 Bacteria 3529
327 Ga0495686_0005596 3300047472 Bacteria 9871
328 Ga0495686_0005965 3300047472 Bacteria 9483
329 Ga0495686_0012613 3300047472 Bacteria 5906
330 Ga0495686_0029654 3300047472 Bacteria 3558
331 Ga0495686_0079000 3300047472 Bacteria 2012
332 Ga0496102_0000043 3300048905 Bacteria 189201
333 Ga0496103_0000086 3300048906 Bacteria 104765
334 Ga0496103_0009518 3300048906 Bacteria 5752
335 Ga0496106_0037873 3300048909 Bacteria 3608
336 Ga0496106_0071775 3300048909 Bacteria 2647
337 Ga0496107_0000028 3300048910 Bacteria 105641
338 Ga0496107_0148462 3300048910 Bacteria 1734
339 Ga0496112_0014185 3300048915 Bacteria 7385
340 Ga0496113_0089474 3300048916 Bacteria 2370
341 Ga0496115_0001111 3300048918 Bacteria 19439
342 Ga0496115_0001701 3300048918 Bacteria 15773
343 Ga0496115_0002063 3300048918 Bacteria 14389
344 Ga0496116_0001293 3300048919 Bacteria 28728
345 Ga0496116_0022300 3300048919 Bacteria 4749
346 Ga0496117_0000104 3300048920 Bacteria 189201
347 Ga0496117_0051396 3300048920 Bacteria 2913
348 Ga0496118_0000080 3300048921 Bacteria 189201
349 Ga0496118_0003398 3300048921 Bacteria 20114
350 Ga0496118_0007844 3300048921 Bacteria 11193
351 Ga0496118_0069596 3300048921 Bacteria 2547
352 Ga0496121_0000035 3300048924 Bacteria 374316
353 Ga0496121_0005053 3300048924 Bacteria 17236
354 Ga0496121_0098916 3300048924 Bacteria 2256
355 Ga0496124_0000093 3300048927 Bacteria 189201
356 Ga0496124_0028207 3300048927 Bacteria 5025
357 Ga0496125_0002080 3300048928 Bacteria 26979
358 Ga0496125_0025122 3300048928 Bacteria 5464
359 Ga0496125_0098450 3300048928 Bacteria 2164
360 Ga0496126_0007586 3300048929 Bacteria 11855
361 Ga0495678_000699 3300049459 Bacteria 30520
362 Ga0501037_0058462 3300049573 Bacteria 2814
363 Ga0501047_0002252 3300049581 Bacteria 18471
364 Ga0501047_0244971 3300049581 Bacteria 1642
365 Ga0501044_0013955 3300049823 Bacteria 8680
366 nmdc:mga00v17_599_c1 3300050491 Bacteria 19989
367 nmdc:mga07m45_9007_c1 3300050496 Bacteria 5156
368 nmdc:mga0sz30_21335_c1 3300050516 Bacteria 2621
369 nmdc:mga0sz30_7766_c1 3300050516 Bacteria 2815
370 Ga0500635_0000163 3300053080 Bacteria 35728
371 Ga0500578_0000159 3300053086 Bacteria 79246
372 Ga0500643_005911 3300053087 Bacteria 5190
373 Ga0500643_011594 3300053087 Bacteria 3205
374 Ga0500644_0000269 3300053088 Bacteria 29380
375 Ga0500644_0015613 3300053088 Bacteria 2170
376 Ga0500647_0003244 3300053091 Bacteria 6301
377 Ga0500647_0078600 3300053091 Bacteria 1583
378 Ga0500651_0013216 3300053093 Bacteria 5023
379 Ga0500566_0060397 3300053094 Bacteria 2147
380 Ga0500641_0003922 3300053096 Bacteria 5260
381 Ga0500641_0007126 3300053096 Bacteria 3980
382 Ga0500641_0009828 3300053096 Bacteria 3445
383 Ga0500555_006371 3300053103 Bacteria 3352
384 Ga0500556_0007069 3300053104 Bacteria 3204
385 Ga0500562_007337 3300053108 Bacteria 2783
386 Ga0500562_010707 3300053108 Bacteria 2325
387 Ga0500572_000338 3300053111 Bacteria 16833
388 Ga0500594_0000312 3300053118 Bacteria 10863
389 Ga0500595_005586 3300053119 Bacteria 5472
390 Ga0500595_011256 3300053119 Bacteria 3512
391 Ga0500607_079568 3300053121 Bacteria 1674
392 Ga0500608_000348 3300053122 Bacteria 17856
393 Ga0500614_001685 3300053123 Bacteria 5163
394 Ga0500642_0062989 3300053130 Bacteria 1670
395 Ga0500658_0000742 3300053134 Bacteria 13445
396 Ga0500559_0000098 3300053136 Bacteria 69305
397 Ga0500559_0013428 3300053136 Bacteria 3468
398 Ga0500564_005262 3300053138 Bacteria 5276
399 Ga0500577_0000456 3300053142 Bacteria 10560
400 Ga0500616_0014001 3300053153 Bacteria 4625
401 Ga0500616_0014739 3300053153 Bacteria 4485
402 Ga0500616_0050652 3300053153 Bacteria 2192
403 Ga0500616_0076476 3300053153 Bacteria 1692
404 Ga0500622_0000140 3300053156 Bacteria 76624
405 Ga0500622_0006444 3300053156 Bacteria 6803
406 Ga0500622_0007480 3300053156 Bacteria 6200
407 Ga0500627_0044443 3300053158 Bacteria 1918
408 Ga0500645_000996 3300053730 Bacteria 15975
409 Ga0500645_003519 3300053730 Bacteria 6328
410 Ga0500645_005439 3300053730 Bacteria 4687
411 Ga0500609_000273 3300053731 Bacteria 7534
412 Ga0500596_000307 3300053735 Bacteria 8725
413 2511125120 2510917020 Bacteria 5657507
414 2585148173 2582581279 Bacteria 4980720
415 2585155152 2582581280 Bacteria 5994497
416 2585194833 2582581293 Bacteria 5907401
417 2587917078 2585428106 Bacteria 5179711
418 2643747369 2643221545 Bacteria 5083237
419 2643782338 2643221552 Bacteria 5708754
420 2643823145 2643221560 Bacteria 4801179
421 2643922750 2643221583 Bacteria 5218014
422 2643929847 2643221584 Bacteria 5511711
423 2643999809 2643221598 Bacteria 4578346
424 2644001585 2643221598 Bacteria 4578346
425 2644087987 2643221614 Bacteria 4260023
426 2644088247 2643221614 Bacteria 4260023
427 2644223717 2643221640 Bacteria 5258820
428 2644236195 2643221642 Bacteria 5357871
429 2644343485 2643221661 Bacteria 4267604
430 2644344126 2643221661 Bacteria 4267604
431 2644367344 2643221666 Bacteria 4265935
432 2644369038 2643221666 Bacteria 4265935
433 2644507432 2643221691 Bacteria 5093099
434 2819538483 2818991435 Bacteria 5433759
435 2819648072 2818991454 Bacteria 5563326
436 2843745898 2843744320 Bacteria 5659202
437 2843749458 2843744320 Bacteria 5659202
438 2851156207 2851153111 Bacteria 5542585
439 2857506111 2857504554 Bacteria 5369913
440 2884963471 2884960567 Bacteria 5437054
441 2898332674 2898329390 Bacteria 5168154
442 2928534607 2928531327 Bacteria 5101314
443 2941485987 2941485952 Bacteria 3591484
444 Ga0209564_1003913
445 JGI24736J21556_1000037
446 JGI24740J21852_10012740
447 JGI24739J22299_10003077
448 JGI24737J22298_10007624
449 JGI24735J21928_10007565
450 JGI24750J21931_1000681
451 JGI24748J21848_1000015
452 JGI24738J21930_10000334
453 JGI24749J21850_1000240
454 JGI24034J26672_10000006
455 JGI24742J22300_10001113
456 JGI24751J29686_10000135
457 JGI25153J46596_10034394
458 Ga0055537_1001888
459 Ga0055524_1012190
460 Ga0055524_1017739
461 Ga0055528_1009909
462 Ga0055530_10002060
463 Ga0055531_10000930
464 Ga0055531_10001767
465 Ga0065165_1001513
466 Ga0065165_1006815
467 Ga0065707_10083538
468 Ga0070658_10000708
469 Ga0070658_10021907
470 Ga0070658_10057143
471 Ga0070658_10073661
472 Ga0070690_100000074
473 Ga0070670_100000090
474 Ga0068869_100037418
475 Ga0070666_10000014
476 Ga0068868_100138717
477 Ga0070660_100052011
478 Ga0070661_100037056
479 Ga0070668_100001179
480 Ga0070669_100000093
481 Ga0070669_100000304
482 Ga0070669_100002305
483 Ga0070671_100002815
484 Ga0070688_100010173
485 Ga0070659_100058404
486 Ga0070659_100108718
487 Ga0070667_100001444
488 Ga0070667_100022770
489 Ga0070667_100045508
490 Ga0070662_100028593
491 Ga0070681_10007565
492 Ga0070679_100014656
493 Ga0068853_100004158
494 Ga0068853_100010230
495 Ga0068853_100100521
496 Ga0068853_100186988
497 Ga0068853_100348593
498 Ga0070686_100000002
499 Ga0070665_100000025
500 Ga0070665_100002155
501 Ga0070665_100026184
502 Ga0068855_100007416
503 Ga0068855_100010626
504 Ga0068855_100011377
505 Ga0068855_100029762
506 Ga0068854_100000843
507 Ga0068856_100208743
508 Ga0068856_100382966
509 Ga0068852_100000337
510 Ga0068859_100001618
511 Ga0068859_100009705
512 Ga0068859_100013233
513 Ga0068864_100000067
514 Ga0068864_100000127
515 Ga0068864_100002381
516 Ga0068864_100011026
517 Ga0068861_100001742
518 Ga0068861_100036270
519 Ga0068863_100000237
520 Ga0068863_100000541
521 Ga0068863_100015575
522 Ga0068858_100000020
523 Ga0068858_100002657
524 Ga0068858_100023998
525 Ga0068860_100000001
526 Ga0068860_100000027
527 Ga0068860_100023882
528 Ga0068862_100000048
529 Ga0068862_100000126
530 Ga0068862_100017037
531 Ga0068862_100144412
532 Ga0070717_10076777
533 Ga0075368_10004849
534 Ga0075364_10000499
535 Ga0075369_10018205
536 Ga0075369_10074201
537 Ga0075366_10032544
538 Ga0068865_100009151
539 Ga0097620_100001618
540 Ga0097620_100009706
541 Ga0097620_100013233
542 Ga0105251_10000241
543 Ga0105250_10007725
544 Ga0105240_10000156
545 Ga0105240_10004673
546 Ga0105247_10055785
547 Ga0105242_10121033
548 Ga0105248_10000155
549 Ga0105248_10000454
550 Ga0105248_10004217
551 Ga0105248_10008368
552 Ga0105248_10010014
553 Ga0105237_10001457
554 Ga0105237_10408949
555 Ga0105238_10007800
556 Ga0105249_10000005
557 Ga0105249_10003389
558 Ga0105239_10001406
559 Ga0105239_10197671
560 Ga0105239_10202515
561 Ga0157371_10001910
562 Ga0157370_10160109
563 Ga0157369_10018155
564 Ga0157369_10040454
565 Ga0157369_10145843
566 Ga0163162_10090598
567 Ga0157372_10089995
568 Ga0163163_10004271
569 Ga0163163_10021751
570 Ga0157380_10000137
571 Ga0157380_10000223
572 Ga0157379_10001771
573 Ga0157379_10003874
574 Ga0163161_10000559
575 Ga0213876_10010428
576 Ga0207672_1001347
577 Ga0209565_1000179
578 Ga0209673_1001240
579 Ga0209675_1014925
580 Ga0209676_1000253
581 Ga0209758_1000894
582 Ga0209050_1000173
583 Ga0209050_1000649
584 Ga0209050_1001834
585 Ga0209256_1005813
586 Ga0209256_1010954
587 Ga0209256_1023109
588 Ga0209051_1002693
589 Ga0209257_1000196
590 Ga0209257_1000364
591 Ga0209257_1001017
592 Ga0209257_1002949
593 Ga0207696_1013327
594 Ga0207713_1029629
595 Ga0207680_10000004
596 Ga0207647_10000038
597 Ga0207647_10045722
598 Ga0207705_10000157
599 Ga0207705_10001784
600 Ga0207654_10024848
601 Ga0207695_10000250
602 Ga0207695_10001288
603 Ga0207695_10002305
604 Ga0207695_10003077
605 Ga0207695_10053728
606 Ga0207671_10001429
607 Ga0207671_10003755
608 Ga0207660_10000681
609 Ga0207660_10035160
610 Ga0207660_10049656
611 Ga0207657_10001673
612 Ga0207657_10110429
613 Ga0207652_10004669
614 Ga0207652_10042913
615 Ga0207681_10000005
616 Ga0207681_10000152
617 Ga0207681_10001688
618 Ga0207694_10005393
619 Ga0207694_10071428
620 Ga0207650_10000004
621 Ga0207650_10000452
622 Ga0207650_10050044
623 Ga0207650_10060470
624 Ga0207644_10000956
625 Ga0207644_10016847
626 Ga0207690_10000116
627 Ga0207706_10051090
628 Ga0207686_10230260
629 Ga0207670_10010762
630 Ga0207711_10000017
631 Ga0207711_10000464
632 Ga0207711_10001118
633 Ga0207711_10001710
634 Ga0207711_10021499
635 Ga0207667_10000006
636 Ga0207667_10000091
637 Ga0207667_10005755
638 Ga0207667_10041526
639 Ga0207667_10094032
640 Ga0207667_10101163
641 Ga0207712_10000001
642 Ga0207712_10000113
643 Ga0207640_10000766
644 Ga0207658_10000119
645 Ga0207658_10000483
646 Ga0207658_10000907
647 Ga0207658_10076185
648 Ga0207677_10066126
649 Ga0207703_10000082
650 Ga0207703_10003897
651 Ga0207639_10000185
652 Ga0207639_10026976
653 Ga0207678_10007379
654 Ga0207678_10037093
655 Ga0207702_10332321
656 Ga0207641_10000007
657 Ga0207641_10000008
658 Ga0207641_10000033
659 Ga0207641_10014295
660 Ga0207648_10168795
661 Ga0207676_10000006
662 Ga0207676_10000019
663 Ga0207676_10002060
664 Ga0207676_10005298
665 Ga0207674_10009512
666 Ga0207675_100000171
667 Ga0207675_100000385
668 Ga0207675_100033773
669 Ga0207698_10000333
670 Ga0209981_1000450
671 Ga0268266_10000003
672 Ga0268266_10000028
673 Ga0268266_10009290
674 Ga0268266_10066004
675 Ga0268266_10105644
676 Ga0268265_10000001
677 Ga0268265_10000011
678 Ga0268265_10000071
679 Ga0268265_10004520
680 Ga0268265_10031272
681 Ga0268264_10000006
682 Ga0268264_10000181
683 Ga0268264_10011436
684 Ga0307517_10003203
685 Ga0307517_10070948
686 Ga0307515_10076827
687 Ga0307515_10085750
688 Ga0307515_10097211
689 Ga0307515_10167003
690 Ga0265338_10050438
691 Ga0265327_10000287
692 Ga0265327_10002320
693 Ga0307513_10000077
694 Ga0307513_10003660
695 Ga0307513_10007104
696 Ga0307513_10018914
697 Ga0307516_10000030
698 Ga0307413_10032906
699 Ga0307410_10111005
700 Ga0307406_10138352
701 Ga0307414_10000202
702 Ga0307414_10049900
703 Ga0307510_10043919
704 Ga0307510_10069742
705 Ga0373960_0009148
706 Ga0373946_0048624
707 Ga0373961_0020618
708 Ga0373931_0001350
709 Ga0373927_0000831
710 Ga0373925_0000984
711 Ga0395899_0000486
712 Ga0395900_0000008
713 Ga0395900_0026680
714 Ga0395900_0152018
715 Ga0395898_0020955
716 Ga0395905_0003251
717 Ga0395905_0011963
718 Ga0436364_0062945
719 Ga0395901_0000008
720 Ga0436365_1127900
721 Ga0439445_0037414
722 Ga0439435_0007160
723 Ga0453684_0295664
724 Ga0495627_000511
725 Ga0495629_0022694
726 Ga0495638_0001235
727 Ga0495638_0003577
728 Ga0495638_0007109
729 Ga0495638_0009533
730 Ga0495638_0026395
731 Ga0495638_0053557
732 Ga0495650_0000024
733 Ga0495583_0000025
734 Ga0495606_0006495
735 Ga0495610_0000478
736 Ga0495610_0004119
737 Ga0495610_0009039
738 Ga0495616_0005214
739 Ga0495620_0023949
740 Ga0495631_0081894
741 Ga0495632_0004458
742 Ga0495637_0010312
743 Ga0495637_0018260
744 Ga0495648_0000634
745 Ga0495648_0041139
746 Ga0495648_0054033
747 Ga0495642_0012414
748 Ga0495654_0000135
749 Ga0495609_0005335
750 Ga0495597_0002511
751 Ga0495622_0009313
752 Ga0495668_0000291
753 Ga0495668_0005699
754 Ga0495668_0010898
755 Ga0495668_0014658
756 Ga0495625_0002176
757 Ga0495625_0042930
758 Ga0495625_0057973
759 Ga0495625_0157772
760 Ga0495659_0034172
761 Ga0495669_0000044
762 Ga0495669_0070251
763 Ga0495589_0012780
764 Ga0495660_0025068
765 Ga0495672_0001086
766 Ga0495683_0052985
767 Ga0495673_0000939
768 Ga0495673_0001300
769 Ga0495681_0020989
770 Ga0495686_0005596
771 Ga0495686_0005965
772 Ga0495686_0012613
773 Ga0495686_0029654
774 Ga0495686_0079000
775 Ga0496102_0000043
776 Ga0496103_0000086
777 Ga0496103_0009518
778 Ga0496106_0037873
779 Ga0496106_0071775
780 Ga0496107_0000028
781 Ga0496107_0148462
782 Ga0496112_0014185
783 Ga0496113_0089474
784 Ga0496115_0001111
785 Ga0496115_0001701
786 Ga0496115_0002063
787 Ga0496116_0001293
788 Ga0496116_0022300
789 Ga0496117_0000104
790 Ga0496117_0051396
791 Ga0496118_0000080
792 Ga0496118_0003398
793 Ga0496118_0007844
794 Ga0496118_0069596
795 Ga0496121_0000035
796 Ga0496121_0005053
797 Ga0496121_0098916
798 Ga0496124_0000093
799 Ga0496124_0028207
800 Ga0496125_0002080
801 Ga0496125_0025122
802 Ga0496125_0098450
803 Ga0496126_0007586
804 Ga0495678_000699
805 Ga0501037_0058462
806 Ga0501047_0002252
807 Ga0501047_0244971
808 Ga0501044_0013955
809 nmdc:mga00v17_599_c1
810 nmdc:mga07m45_9007_c1
811 nmdc:mga0sz30_21335_c1
812 nmdc:mga0sz30_7766_c1
813 Ga0500635_0000163
814 Ga0500578_0000159
815 Ga0500643_005911
816 Ga0500643_011594
817 Ga0500644_0000269
818 Ga0500644_0015613
819 Ga0500647_0003244
820 Ga0500647_0078600
821 Ga0500651_0013216
822 Ga0500566_0060397
823 Ga0500641_0003922
824 Ga0500641_0007126
825 Ga0500641_0009828
826 Ga0500555_006371
827 Ga0500556_0007069
828 Ga0500562_007337
829 Ga0500562_010707
830 Ga0500572_000338
831 Ga0500594_0000312
832 Ga0500595_005586
833 Ga0500595_011256
834 Ga0500607_079568
835 Ga0500608_000348
836 Ga0500614_001685
837 Ga0500642_0062989
838 Ga0500658_0000742
839 Ga0500559_0000098
840 Ga0500559_0013428
841 Ga0500564_005262
842 Ga0500577_0000456
843 Ga0500616_0014001
844 Ga0500616_0014739
845 Ga0500616_0050652
846 Ga0500616_0076476
847 Ga0500622_0000140
848 Ga0500622_0006444
849 Ga0500622_0007480
850 Ga0500627_0044443
851 Ga0500645_000996
852 Ga0500645_003519
853 Ga0500645_005439
854 Ga0500609_000273
855 Ga0500596_000307
856 2511125120
857 2585148173
858 2585155152
859 2585194833
860 2587917078
861 2643747369
862 2643782338
863 2643823145
864 2643922750
865 2643929847
866 2643999809
867 2644001585
868 2644087987
869 2644088247
870 2644223717
871 2644236195
872 2644343485
873 2644344126
874 2644367344
875 2644369038
876 2644507432
877 2819538483
878 2819648072
879 2843745898
880 2843749458
881 2851156207
882 2857506111
883 2884963471
884 2898332674
885 2928534607
886 2941485987

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00375

SDF

Sodium:dicarboxylate symporter family

50

448

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wyk-assembly1.cif.gz_A cryo-em structure of the gltph l152c-g321c mutant in the intermediate chloride conducting state. 0.7724 8 380
6uwl-assembly1.cif.gz_A gltph in complex with l-aspartate and sodium ions in intermediate outward-facing state 0.7254 9 380
8cua-assembly1.cif.gz_A human excitatory amino acid transporter 3 (eaat3) with bound potassium in an intermediate outward facing state 0.7195 4 381
3v8g-assembly1.cif.gz_C crystal structure of an asymmetric trimer of a glutamate transporter homologue (gltph) 0.7186 5 380
7ngh-assembly1.cif.gz_C structure of glutamate transporter homologue in complex with sybody 0.7167 5 385
ID Description Score Start End Superfamily
af_P21345_1_417_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.7119 5 385 1.10.3860.10
4p3jC00 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.7024 5 380 1.10.3860.10
af_P0A830_1_408_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.6749 5 387 1.10.3860.10
af_P21345_1_417_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.6715 5 385 1.10.3860.10
af_P71906_20_424_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.6551 3 386 1.10.3860.10
ID Description Score Start End GO Terms
AF-A0A0R3QIY3-F1-model_v4 Amino acid transporter 0.9185 5 253 GO:0005886
GO:0006835
GO:0015293
AF-A0A353HZ05-F1-model_v4 Dicarboxylate/amino acid:cation symporter 0.8988 3 262 GO:0005886
GO:0006835
GO:0015293
AF-W7DK85-F1-model_v4 C4-dicarboxylate transporter 0.889 2 382 GO:0005886
GO:0006835
GO:0015293
AF-A0A2J4Z8Y1-F1-model_v4 Dicarboxylate/amino acid:cation symporter 0.8858 5 324 GO:0005886
GO:0006835
GO:0015293
AF-B0SXJ5-F1-model_v4 Sodium:dicarboxylate symporter 0.8794 1 283 GO:0005886
GO:0006835
GO:0015293

Map