F445101
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 443 | 317 | 443 | 274 |
Family's Representative Sequence
| Representative Sequence | 3300025981|Ga0207640_10180375|Ga0207640_101803752 |
| Length | 311 |
| Sequence | VTSRSSLLDALRVEPGSAPKLAERDPDERVGAPGKKEGIERLEELVEQLAMLHNRLYAEAKRSVLLVLQGLDASGKDGTIRSVFTGVNPQGCRVVSFKVPTPNELAHDYLWRIHQACPARGEIGIFNRSHYEDIVAVRVRKLAEKKVWERRYEHIRAFEQMLGDEGTAVVKVFLHVSRDEQRKRLQERLDDPEKRWKFRAGDLDDRALWDDFTEAYEDALRETSTKHAPWYVVPADKKWFARLVVAGAIYDALARLGLRYPVVGQDKKKELAAARTELLNEGKAVKKAKRAEERAAGEPAGAEPRPERGAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 53 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 54 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 58 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 59 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 60 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 63 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 64 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 133 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 136 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 137 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 138 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 139 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 140 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 141 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 142 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 143 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 144 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 145 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 146 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 147 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 148 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 149 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 150 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 151 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 152 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 153 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 154 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 155 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 156 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 157 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 158 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 159 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 160 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 161 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 162 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 163 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 164 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 165 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 166 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 167 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 168 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 169 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 170 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 171 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 172 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 173 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 174 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 175 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 176 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 215 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 216 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 217 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 219 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 220 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 221 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 222 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 223 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 224 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 225 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 226 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 227 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 228 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 229 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 230 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 231 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 232 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 251 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 252 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 253 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 254 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 255 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 256 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 257 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 258 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 259 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 260 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 261 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 262 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 263 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 264 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 265 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 266 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 267 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 268 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 269 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 270 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 271 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 272 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 273 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 274 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 275 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 276 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 277 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 278 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 279 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 280 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 284 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 285 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 286 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 287 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 288 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 289 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 290 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 291 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 292 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 293 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 294 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 295 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 296 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 299 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 300 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 315 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 316 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.77 |
| Metatranscriptomes | 0.23 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.81 |
| Rhizosphere | 98.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3732914 | 2162886007 | Bacteria | 1405 |
| 2 | Ga0065704_10115513 | 3300005289 | Bacteria | 1871 |
| 3 | Ga0065712_10013967 | 3300005290 | Bacteria | 1742 |
| 4 | Ga0065715_10007207 | 3300005293 | Bacteria | 2694 |
| 5 | Ga0065707_10116188 | 3300005295 | Bacteria | 2245 |
| 6 | Ga0070658_10212320 | 3300005327 | Bacteria | 1635 |
| 7 | Ga0070683_100105245 | 3300005329 | Bacteria | 2660 |
| 8 | Ga0070683_100754600 | 3300005329 | Bacteria | 932 |
| 9 | Ga0070690_100000609 | 3300005330 | Bacteria | 18087 |
| 10 | Ga0070690_100052610 | 3300005330 | Bacteria | 2603 |
| 11 | Ga0070670_100067076 | 3300005331 | Bacteria | 3079 |
| 12 | Ga0068869_100018641 | 3300005334 | Bacteria | 4728 |
| 13 | Ga0070680_100050583 | 3300005336 | Bacteria | 3389 |
| 14 | Ga0070682_100021642 | 3300005337 | Bacteria | 3798 |
| 15 | Ga0070682_100256885 | 3300005337 | Bacteria | 1263 |
| 16 | Ga0070660_100006010 | 3300005339 | Bacteria | 8393 |
| 17 | Ga0070660_100030799 | 3300005339 | Bacteria | 4026 |
| 18 | Ga0070689_100028769 | 3300005340 | Bacteria | 4204 |
| 19 | Ga0070691_10032795 | 3300005341 | Bacteria | 2441 |
| 20 | Ga0070687_100215461 | 3300005343 | Bacteria | 1173 |
| 21 | Ga0070692_10038634 | 3300005345 | Bacteria | 2434 |
| 22 | Ga0070668_100024482 | 3300005347 | Bacteria | 4575 |
| 23 | Ga0070669_100007933 | 3300005353 | Bacteria | 7587 |
| 24 | Ga0070675_100036319 | 3300005354 | Bacteria | 4009 |
| 25 | Ga0070674_100007966 | 3300005356 | Bacteria | 6276 |
| 26 | Ga0070673_100005271 | 3300005364 | Bacteria | 8259 |
| 27 | Ga0070659_100008586 | 3300005366 | Bacteria | 7469 |
| 28 | Ga0070667_100012950 | 3300005367 | Bacteria | 6896 |
| 29 | Ga0070667_100021252 | 3300005367 | Bacteria | 5392 |
| 30 | Ga0070701_10065346 | 3300005438 | Bacteria | 1930 |
| 31 | Ga0070711_100006865 | 3300005439 | Bacteria | 6895 |
| 32 | Ga0070700_100005956 | 3300005441 | Bacteria | 6481 |
| 33 | Ga0070694_100072087 | 3300005444 | Bacteria | 2382 |
| 34 | Ga0070662_100013181 | 3300005457 | Bacteria | 5496 |
| 35 | Ga0070681_10041439 | 3300005458 | Bacteria | 4615 |
| 36 | Ga0070681_10084789 | 3300005458 | Bacteria | 3120 |
| 37 | Ga0070681_10346182 | 3300005458 | Bacteria | 1396 |
| 38 | Ga0068867_100001017 | 3300005459 | Bacteria | 19162 |
| 39 | Ga0070707_100035234 | 3300005468 | Bacteria | 4774 |
| 40 | Ga0070698_100390446 | 3300005471 | Bacteria | 1325 |
| 41 | Ga0070679_100003296 | 3300005530 | Bacteria | 14780 |
| 42 | Ga0070679_100073142 | 3300005530 | Bacteria | 3420 |
| 43 | Ga0070684_100151770 | 3300005535 | Bacteria | 2099 |
| 44 | Ga0070686_100009830 | 3300005544 | Bacteria | 5374 |
| 45 | Ga0070695_100007372 | 3300005545 | Bacteria | 6523 |
| 46 | Ga0070696_100037509 | 3300005546 | Bacteria | 3343 |
| 47 | Ga0070696_100042874 | 3300005546 | Bacteria | 3128 |
| 48 | Ga0070696_100065528 | 3300005546 | Bacteria | 2547 |
| 49 | Ga0070665_100668690 | 3300005548 | Bacteria | 1051 |
| 50 | Ga0070704_100050251 | 3300005549 | Bacteria | 2929 |
| 51 | Ga0070664_100014327 | 3300005564 | Bacteria | 6464 |
| 52 | Ga0070664_100080457 | 3300005564 | Bacteria | 2806 |
| 53 | Ga0068857_100086631 | 3300005577 | Bacteria | 2801 |
| 54 | Ga0068854_100052378 | 3300005578 | Bacteria | 2927 |
| 55 | Ga0070702_100037880 | 3300005615 | Bacteria | 2681 |
| 56 | Ga0068864_100378346 | 3300005618 | Unclassified | 1341 |
| 57 | Ga0068866_10008164 | 3300005718 | Bacteria | 4400 |
| 58 | Ga0068861_100025086 | 3300005719 | Bacteria | 4318 |
| 59 | Ga0068870_10028128 | 3300005840 | Bacteria | 2819 |
| 60 | Ga0068860_100103032 | 3300005843 | Bacteria | 2724 |
| 61 | Ga0068862_100049164 | 3300005844 | Bacteria | 3601 |
| 62 | Ga0081455_10001204 | 3300005937 | Bacteria | 32428 |
| 63 | Ga0081538_10005239 | 3300005981 | Bacteria | 11718 |
| 64 | Ga0075432_10006642 | 3300006058 | Bacteria | 3937 |
| 65 | Ga0070715_10061369 | 3300006163 | Bacteria | 1650 |
| 66 | Ga0070716_100046363 | 3300006173 | Bacteria | 2446 |
| 67 | Ga0070712_100455549 | 3300006175 | Bacteria | 1066 |
| 68 | Ga0075428_100051084 | 3300006844 | Bacteria | 4533 |
| 69 | Ga0075430_100014898 | 3300006846 | Bacteria | 6622 |
| 70 | Ga0075430_100038279 | 3300006846 | Bacteria | 4063 |
| 71 | Ga0075431_100059596 | 3300006847 | Bacteria | 3939 |
| 72 | Ga0075433_10017648 | 3300006852 | Bacteria | 5918 |
| 73 | Ga0075433_10238098 | 3300006852 | Bacteria | 1616 |
| 74 | Ga0075433_10333380 | 3300006852 | Bacteria | 1341 |
| 75 | Ga0075434_100035012 | 3300006871 | Bacteria | 4963 |
| 76 | Ga0075429_100083023 | 3300006880 | Bacteria | 2793 |
| 77 | Ga0075436_100211871 | 3300006914 | Bacteria | 1373 |
| 78 | Ga0075435_100110448 | 3300007076 | Bacteria | 2286 |
| 79 | Ga0075435_100188210 | 3300007076 | Bacteria | 1746 |
| 80 | Ga0105245_10003636 | 3300009098 | Bacteria | 13766 |
| 81 | Ga0105245_10829275 | 3300009098 | Bacteria | 964 |
| 82 | Ga0114129_10008800 | 3300009147 | Bacteria | 14403 |
| 83 | Ga0114129_10201448 | 3300009147 | Bacteria | 2695 |
| 84 | Ga0105243_10077595 | 3300009148 | Bacteria | 2702 |
| 85 | Ga0105243_10454382 | 3300009148 | Bacteria | 1203 |
| 86 | Ga0105241_10332447 | 3300009174 | Bacteria | 1314 |
| 87 | Ga0105242_10014583 | 3300009176 | Bacteria | 6085 |
| 88 | Ga0105249_10027186 | 3300009553 | Bacteria | 5161 |
| 89 | Ga0105249_10127318 | 3300009553 | Bacteria | 2427 |
| 90 | Ga0105239_10081339 | 3300010375 | Bacteria | 3565 |
| 91 | Ga0105246_10006386 | 3300011119 | Bacteria | 7197 |
| 92 | Ga0157373_10319055 | 3300013100 | Bacteria | 1105 |
| 93 | Ga0157371_10139986 | 3300013102 | Bacteria | 1724 |
| 94 | Ga0157374_10018504 | 3300013296 | Bacteria | 6149 |
| 95 | Ga0157378_10021293 | 3300013297 | Bacteria | 5700 |
| 96 | Ga0157378_10289260 | 3300013297 | Unclassified | 1582 |
| 97 | Ga0157375_10126046 | 3300013308 | Bacteria | 2675 |
| 98 | Ga0157375_10657733 | 3300013308 | Bacteria | 1204 |
| 99 | Ga0157379_10281718 | 3300014968 | Bacteria | 1513 |
| 100 | Ga0157376_10033098 | 3300014969 | Bacteria | 4157 |
| 101 | Ga0207697_10024484 | 3300025315 | Bacteria | 2471 |
| 102 | Ga0207642_10017616 | 3300025899 | Bacteria | 2722 |
| 103 | Ga0207688_10017885 | 3300025901 | Bacteria | 3858 |
| 104 | Ga0207645_10000123 | 3300025907 | Bacteria | 58779 |
| 105 | Ga0207643_10024293 | 3300025908 | Bacteria | 3344 |
| 106 | Ga0207707_10033503 | 3300025912 | Bacteria | 4495 |
| 107 | Ga0207707_10257224 | 3300025912 | Bacteria | 1516 |
| 108 | Ga0207663_10001415 | 3300025916 | Bacteria | 11130 |
| 109 | Ga0207660_10019697 | 3300025917 | Bacteria | 4515 |
| 110 | Ga0207662_10116084 | 3300025918 | Bacteria | 1674 |
| 111 | Ga0207657_10003921 | 3300025919 | Bacteria | 15791 |
| 112 | Ga0207657_10007300 | 3300025919 | Bacteria | 11333 |
| 113 | Ga0207652_10029500 | 3300025921 | Bacteria | 4588 |
| 114 | Ga0207652_10064703 | 3300025921 | Bacteria | 3164 |
| 115 | Ga0207652_10234487 | 3300025921 | Bacteria | 1654 |
| 116 | Ga0207646_10026570 | 3300025922 | Bacteria | 5282 |
| 117 | Ga0207681_10222318 | 3300025923 | Bacteria | 1461 |
| 118 | Ga0207659_10676002 | 3300025926 | Bacteria | 883 |
| 119 | Ga0207690_10026396 | 3300025932 | Bacteria | 3658 |
| 120 | Ga0207706_10000387 | 3300025933 | Bacteria | 47651 |
| 121 | Ga0207686_10038986 | 3300025934 | Bacteria | 2879 |
| 122 | Ga0207686_10316390 | 3300025934 | Bacteria | 1164 |
| 123 | Ga0207709_10205523 | 3300025935 | Bacteria | 1410 |
| 124 | Ga0207670_10031187 | 3300025936 | Bacteria | 3412 |
| 125 | Ga0207669_10003289 | 3300025937 | Bacteria | 6991 |
| 126 | Ga0207704_10203430 | 3300025938 | Bacteria | 1451 |
| 127 | Ga0207665_10033979 | 3300025939 | Bacteria | 3383 |
| 128 | Ga0207665_10134393 | 3300025939 | Bacteria | 1759 |
| 129 | Ga0207691_10007080 | 3300025940 | Bacteria | 10824 |
| 130 | Ga0207691_10192625 | 3300025940 | Bacteria | 1778 |
| 131 | Ga0207689_10054939 | 3300025942 | Bacteria | 3278 |
| 132 | Ga0207661_10091406 | 3300025944 | Bacteria | 2536 |
| 133 | Ga0207679_10023500 | 3300025945 | Bacteria | 4217 |
| 134 | Ga0207651_10201466 | 3300025960 | Bacteria | 1595 |
| 135 | Ga0207640_10180375 | 3300025981 | Bacteria | 1583 |
| 136 | Ga0207658_10013627 | 3300025986 | Bacteria | 5562 |
| 137 | Ga0207678_10092192 | 3300026067 | Bacteria | 2590 |
| 138 | Ga0207708_10001364 | 3300026075 | Bacteria | 18355 |
| 139 | Ga0207641_10114416 | 3300026088 | Unclassified | 2397 |
| 140 | Ga0207648_10000087 | 3300026089 | Bacteria | 87419 |
| 141 | Ga0207676_10128226 | 3300026095 | Bacteria | 2153 |
| 142 | Ga0207676_10185683 | 3300026095 | Bacteria | 1825 |
| 143 | Ga0207674_10039236 | 3300026116 | Bacteria | 4910 |
| 144 | Ga0207675_100321376 | 3300026118 | Bacteria | 1511 |
| 145 | Ga0207683_10001528 | 3300026121 | Bacteria | 20839 |
| 146 | Ga0207683_10078561 | 3300026121 | Bacteria | 2924 |
| 147 | Ga0209969_1000039 | 3300027360 | Bacteria | 15040 |
| 148 | Ga0209967_1000192 | 3300027364 | Bacteria | 8603 |
| 149 | Ga0209967_1014791 | 3300027364 | Bacteria | 1114 |
| 150 | Ga0209981_1000154 | 3300027378 | Bacteria | 8282 |
| 151 | Ga0209984_1000071 | 3300027424 | Bacteria | 10875 |
| 152 | Ga0210000_1000071 | 3300027462 | Bacteria | 14953 |
| 153 | Ga0209995_1000005 | 3300027471 | Bacteria | 39661 |
| 154 | Ga0209968_1000022 | 3300027526 | Bacteria | 29444 |
| 155 | Ga0209968_1004939 | 3300027526 | Bacteria | 2001 |
| 156 | Ga0209982_1000475 | 3300027552 | Bacteria | 4962 |
| 157 | Ga0209970_1001324 | 3300027614 | Bacteria | 4341 |
| 158 | Ga0209970_1004909 | 3300027614 | Bacteria | 2211 |
| 159 | Ga0210002_1000018 | 3300027617 | Bacteria | 26033 |
| 160 | Ga0210002_1001593 | 3300027617 | Bacteria | 3224 |
| 161 | Ga0209983_1001591 | 3300027665 | Bacteria | 5024 |
| 162 | Ga0209983_1007752 | 3300027665 | Bacteria | 2197 |
| 163 | Ga0209971_1001133 | 3300027682 | Bacteria | 6754 |
| 164 | Ga0209966_1000079 | 3300027695 | Bacteria | 42026 |
| 165 | Ga0209998_10000111 | 3300027717 | Bacteria | 32355 |
| 166 | Ga0209974_10000025 | 3300027876 | Bacteria | 34376 |
| 167 | Ga0209974_10000109 | 3300027876 | Bacteria | 23784 |
| 168 | Ga0207428_10000302 | 3300027907 | Bacteria | 65145 |
| 169 | Ga0268266_10092554 | 3300028379 | Bacteria | 2653 |
| 170 | Ga0268264_10296193 | 3300028381 | Bacteria | 1521 |
| 171 | Ga0265338_10044884 | 3300028800 | Bacteria | 4072 |
| 172 | Ga0265338_10050440 | 3300028800 | Bacteria | 3762 |
| 173 | Ga0265338_10095567 | 3300028800 | Bacteria | 2440 |
| 174 | Ga0265760_10007478 | 3300031090 | Bacteria | 3120 |
| 175 | Ga0316579_10023425 | 3300031691 | Bacteria | 2771 |
| 176 | Ga0307410_10121903 | 3300031852 | Bacteria | 1903 |
| 177 | Ga0307412_10121438 | 3300031911 | Bacteria | 1881 |
| 178 | Ga0307416_100119248 | 3300032002 | Bacteria | 2346 |
| 179 | Ga0307411_10199099 | 3300032005 | Bacteria | 1536 |
| 180 | Ga0307411_10204428 | 3300032005 | Bacteria | 1520 |
| 181 | Ga0373926_0018834 | 3300035083 | Bacteria | 2378 |
| 182 | Ga0373934_0025026 | 3300035086 | Bacteria | 2309 |
| 183 | Ga0373944_0004486 | 3300035089 | Bacteria | 3640 |
| 184 | Ga0373923_0000495 | 3300035111 | Bacteria | 9476 |
| 185 | Ga0373936_0031385 | 3300035113 | Bacteria | 2098 |
| 186 | Ga0373945_0001152 | 3300035116 | Bacteria | 8017 |
| 187 | Ga0373953_0001502 | 3300035117 | Bacteria | 6766 |
| 188 | Ga0373954_0036398 | 3300035118 | Bacteria | 2284 |
| 189 | Ga0373954_0093050 | 3300035118 | Bacteria | 1449 |
| 190 | Ga0373956_0007806 | 3300035119 | Bacteria | 4316 |
| 191 | Ga0373943_0000484 | 3300035170 | Bacteria | 17010 |
| 192 | Ga0373946_0054325 | 3300035171 | Bacteria | 1685 |
| 193 | Ga0373955_0136994 | 3300035172 | Bacteria | 1432 |
| 194 | Ga0373931_0218966 | 3300035691 | Bacteria | 1145 |
| 195 | Ga0373935_0004821 | 3300035692 | Bacteria | 7929 |
| 196 | Ga0373935_0038632 | 3300035692 | Bacteria | 2989 |
| 197 | Ga0373927_0042945 | 3300035695 | Bacteria | 2929 |
| 198 | Ga0373933_0075572 | 3300035724 | Bacteria | 2056 |
| 199 | Ga0373947_0000968 | 3300035725 | Bacteria | 17536 |
| 200 | Ga0373937_0074688 | 3300036401 | Bacteria | 3129 |
| 201 | Ga0373925_0003980 | 3300037068 | Bacteria | 11262 |
| 202 | Ga0373925_0047699 | 3300037068 | Bacteria | 3189 |
| 203 | Ga0395899_0026498 | 3300037312 | Bacteria | 4374 |
| 204 | Ga0395899_0374234 | 3300037312 | Bacteria | 948 |
| 205 | Ga0395905_0224055 | 3300037471 | Bacteria | 1759 |
| 206 | Ga0395901_0257579 | 3300038443 | Bacteria | 1816 |
| 207 | Ga0439447_011258 | 3300041407 | Bacteria | 2620 |
| 208 | Ga0439441_003073 | 3300042001 | Bacteria | 2420 |
| 209 | Ga0439443_022999 | 3300042003 | Bacteria | 993 |
| 210 | Ga0439432_008232 | 3300042006 | Bacteria | 3666 |
| 211 | Ga0439452_004739 | 3300042010 | Bacteria | 4501 |
| 212 | Ga0450923_003375 | 3300042125 | Bacteria | 2405 |
| 213 | Ga0439446_0002338 | 3300042156 | Bacteria | 4535 |
| 214 | Ga0439460_0012900 | 3300042461 | Bacteria | 2177 |
| 215 | Ga0451577_0000169 | 3300042876 | Bacteria | 144088 |
| 216 | Ga0453683_0000217 | 3300044673 | Bacteria | 76362 |
| 217 | Ga0453684_0000536 | 3300044712 | Bacteria | 144088 |
| 218 | Ga0451576_0000215 | 3300045051 | Bacteria | 144088 |
| 219 | Ga0451576_0006974 | 3300045051 | Bacteria | 13672 |
| 220 | Ga0451576_0250895 | 3300045051 | Bacteria | 1849 |
| 221 | Ga0451576_0309172 | 3300045051 | Bacteria | 1653 |
| 222 | Ga0451576_0382969 | 3300045051 | Bacteria | 1474 |
| 223 | Ga0495592_0092827 | 3300046454 | Bacteria | 2162 |
| 224 | Ga0495629_0001312 | 3300046459 | Bacteria | 19557 |
| 225 | Ga0495629_0024258 | 3300046459 | Bacteria | 4319 |
| 226 | Ga0495641_0000109 | 3300046461 | Bacteria | 57910 |
| 227 | Ga0495641_0025893 | 3300046461 | Bacteria | 2872 |
| 228 | Ga0495651_0092071 | 3300046462 | Bacteria | 2271 |
| 229 | Ga0495653_0012752 | 3300046463 | Bacteria | 6863 |
| 230 | Ga0495653_0048552 | 3300046463 | Bacteria | 3275 |
| 231 | Ga0495653_0073175 | 3300046463 | Bacteria | 2558 |
| 232 | Ga0495580_0178511 | 3300046472 | Bacteria | 1466 |
| 233 | Ga0495582_0000708 | 3300046473 | Bacteria | 18420 |
| 234 | Ga0495639_0000937 | 3300046475 | Bacteria | 13192 |
| 235 | Ga0495662_0003489 | 3300046476 | Bacteria | 7960 |
| 236 | Ga0495662_0025763 | 3300046476 | Bacteria | 2840 |
| 237 | Ga0495664_0005145 | 3300046477 | Bacteria | 7175 |
| 238 | Ga0495594_0050949 | 3300046499 | Bacteria | 2278 |
| 239 | Ga0495608_0009437 | 3300046511 | Bacteria | 6821 |
| 240 | Ga0495608_0142993 | 3300046511 | Bacteria | 1526 |
| 241 | Ga0495608_0190660 | 3300046511 | Bacteria | 1294 |
| 242 | Ga0495618_0043394 | 3300046514 | Bacteria | 2837 |
| 243 | Ga0495628_0031446 | 3300046516 | Bacteria | 4293 |
| 244 | Ga0495628_0043898 | 3300046516 | Bacteria | 3558 |
| 245 | Ga0495630_0001309 | 3300046517 | Bacteria | 17126 |
| 246 | Ga0495630_0084481 | 3300046517 | Bacteria | 2396 |
| 247 | Ga0495652_0007326 | 3300046529 | Bacteria | 10175 |
| 248 | Ga0495652_0166363 | 3300046529 | Bacteria | 1706 |
| 249 | Ga0495665_0000595 | 3300046531 | Bacteria | 18495 |
| 250 | Ga0495640_0023413 | 3300046533 | Bacteria | 4499 |
| 251 | Ga0495640_0038231 | 3300046533 | Bacteria | 3376 |
| 252 | Ga0495586_0012666 | 3300046535 | Bacteria | 4472 |
| 253 | Ga0495645_0001560 | 3300046543 | Bacteria | 15521 |
| 254 | Ga0495645_0018251 | 3300046543 | Bacteria | 5037 |
| 255 | Ga0495645_0139493 | 3300046543 | Bacteria | 1693 |
| 256 | Ga0495667_0065852 | 3300046559 | Bacteria | 2369 |
| 257 | Ga0495667_0087494 | 3300046559 | Bacteria | 2020 |
| 258 | Ga0495634_0006807 | 3300046642 | Bacteria | 8651 |
| 259 | Ga0495634_0024120 | 3300046642 | Bacteria | 4271 |
| 260 | Ga0495635_0038127 | 3300046663 | Bacteria | 3327 |
| 261 | Ga0495635_0048299 | 3300046663 | Bacteria | 2934 |
| 262 | Ga0495657_0011703 | 3300046675 | Bacteria | 6544 |
| 263 | Ga0495657_0121349 | 3300046675 | Bacteria | 1646 |
| 264 | Ga0495599_0003895 | 3300046678 | Bacteria | 8780 |
| 265 | Ga0495599_0024405 | 3300046678 | Bacteria | 3781 |
| 266 | Ga0495599_0025694 | 3300046678 | Bacteria | 3688 |
| 267 | Ga0495658_0002069 | 3300046683 | Bacteria | 10168 |
| 268 | Ga0495658_0083130 | 3300046683 | Bacteria | 1882 |
| 269 | Ga0495613_0001195 | 3300046689 | Bacteria | 19811 |
| 270 | Ga0495624_0011644 | 3300046690 | Bacteria | 6041 |
| 271 | Ga0495600_0004582 | 3300046809 | Bacteria | 8289 |
| 272 | Ga0495600_0014825 | 3300046809 | Bacteria | 4916 |
| 273 | Ga0495581_0000833 | 3300047315 | Bacteria | 16417 |
| 274 | Ga0495604_0151029 | 3300047317 | Bacteria | 1650 |
| 275 | Ga0495604_0331668 | 3300047317 | Bacteria | 1015 |
| 276 | Ga0495674_0007068 | 3300047319 | Bacteria | 10736 |
| 277 | Ga0495674_0026636 | 3300047319 | Bacteria | 5290 |
| 278 | Ga0495674_0051241 | 3300047319 | Bacteria | 3639 |
| 279 | Ga0495676_0000262 | 3300047321 | Bacteria | 42485 |
| 280 | Ga0495680_0002800 | 3300047322 | Bacteria | 17559 |
| 281 | Ga0495680_0005330 | 3300047322 | Bacteria | 12138 |
| 282 | Ga0495680_0038674 | 3300047322 | Bacteria | 3811 |
| 283 | Ga0495680_0263489 | 3300047322 | Bacteria | 1218 |
| 284 | Ga0495675_0024425 | 3300047444 | Bacteria | 3852 |
| 285 | Ga0495684_0001745 | 3300047471 | Bacteria | 17474 |
| 286 | Ga0495684_0008277 | 3300047471 | Bacteria | 8053 |
| 287 | Ga0495593_0002225 | 3300047673 | Bacteria | 11636 |
| 288 | Ga0495614_0008025 | 3300048089 | Bacteria | 4692 |
| 289 | Ga0496102_0008664 | 3300048905 | Bacteria | 8731 |
| 290 | Ga0496105_0342992 | 3300048908 | Bacteria | 1194 |
| 291 | Ga0496106_0371705 | 3300048909 | Bacteria | 1149 |
| 292 | Ga0496109_0160102 | 3300048912 | Bacteria | 2109 |
| 293 | Ga0496112_0050760 | 3300048915 | Bacteria | 4068 |
| 294 | Ga0496112_0190246 | 3300048915 | Bacteria | 2014 |
| 295 | Ga0496113_0323403 | 3300048916 | Bacteria | 1236 |
| 296 | Ga0496114_0016455 | 3300048917 | Bacteria | 5961 |
| 297 | Ga0501290_003558 | 3300049513 | Bacteria | 1964 |
| 298 | Ga0501291_000216 | 3300049514 | Bacteria | 7325 |
| 299 | Ga0501292_000178 | 3300049515 | Bacteria | 10334 |
| 300 | Ga0501293_000753 | 3300049516 | Bacteria | 2438 |
| 301 | Ga0501294_000106 | 3300049517 | Bacteria | 9383 |
| 302 | Ga0501295_000068 | 3300049518 | Bacteria | 10359 |
| 303 | Ga0501296_000921 | 3300049519 | Bacteria | 2900 |
| 304 | Ga0501297_000349 | 3300049520 | Bacteria | 4362 |
| 305 | Ga0501298_000215 | 3300049521 | Bacteria | 7362 |
| 306 | Ga0501299_000133 | 3300049522 | Bacteria | 8365 |
| 307 | Ga0501303_001152 | 3300049526 | Bacteria | 1970 |
| 308 | Ga0501031_0018824 | 3300049568 | Bacteria | 4495 |
| 309 | Ga0501031_0038159 | 3300049568 | Bacteria | 3135 |
| 310 | Ga0501031_0045303 | 3300049568 | Bacteria | 2870 |
| 311 | Ga0501031_0114714 | 3300049568 | Bacteria | 1760 |
| 312 | Ga0501032_0001369 | 3300049569 | Bacteria | 19340 |
| 313 | Ga0501032_0129255 | 3300049569 | Bacteria | 1667 |
| 314 | Ga0501032_0172828 | 3300049569 | Bacteria | 1416 |
| 315 | Ga0501033_0158022 | 3300049570 | Bacteria | 1633 |
| 316 | Ga0501036_0035974 | 3300049572 | Bacteria | 4190 |
| 317 | Ga0501036_0067348 | 3300049572 | Bacteria | 3029 |
| 318 | Ga0501036_0095321 | 3300049572 | Bacteria | 2515 |
| 319 | Ga0501036_0160988 | 3300049572 | Bacteria | 1892 |
| 320 | Ga0501036_0233273 | 3300049572 | Bacteria | 1544 |
| 321 | Ga0501037_0036292 | 3300049573 | Bacteria | 3633 |
| 322 | Ga0501037_0343432 | 3300049573 | Bacteria | 1031 |
| 323 | Ga0501038_0036971 | 3300049574 | Bacteria | 4283 |
| 324 | Ga0501039_0000439 | 3300049575 | Bacteria | 30113 |
| 325 | Ga0501039_0044971 | 3300049575 | Bacteria | 3410 |
| 326 | Ga0501039_0065110 | 3300049575 | Bacteria | 2827 |
| 327 | Ga0501039_0210494 | 3300049575 | Bacteria | 1529 |
| 328 | Ga0501039_0291243 | 3300049575 | Bacteria | 1283 |
| 329 | Ga0501040_0227427 | 3300049576 | Bacteria | 1328 |
| 330 | Ga0501040_0302027 | 3300049576 | Bacteria | 1144 |
| 331 | Ga0501041_0022234 | 3300049577 | Bacteria | 3797 |
| 332 | Ga0501041_0321215 | 3300049577 | Bacteria | 976 |
| 333 | Ga0501042_0028113 | 3300049578 | Bacteria | 3958 |
| 334 | Ga0501042_0034770 | 3300049578 | Bacteria | 3574 |
| 335 | Ga0501042_0047754 | 3300049578 | Bacteria | 3052 |
| 336 | Ga0501046_0012725 | 3300049580 | Bacteria | 7155 |
| 337 | Ga0501046_0017901 | 3300049580 | Bacteria | 5907 |
| 338 | Ga0501046_0152096 | 3300049580 | Bacteria | 1745 |
| 339 | Ga0501046_0165251 | 3300049580 | Bacteria | 1663 |
| 340 | Ga0501048_0048527 | 3300049582 | Bacteria | 3028 |
| 341 | Ga0501048_0062340 | 3300049582 | Bacteria | 2639 |
| 342 | Ga0501048_0070866 | 3300049582 | Bacteria | 2461 |
| 343 | Ga0501048_0074222 | 3300049582 | Bacteria | 2400 |
| 344 | Ga0501068_0016822 | 3300049584 | Bacteria | 4221 |
| 345 | Ga0501068_0020878 | 3300049584 | Bacteria | 3822 |
| 346 | Ga0501071_0024251 | 3300049587 | Bacteria | 4241 |
| 347 | Ga0501071_0277028 | 3300049587 | Unclassified | 1269 |
| 348 | Ga0501072_0093713 | 3300049588 | Bacteria | 2385 |
| 349 | Ga0501072_0147655 | 3300049588 | Bacteria | 1875 |
| 350 | Ga0501072_0558791 | 3300049588 | Bacteria | 903 |
| 351 | Ga0501074_0062349 | 3300049590 | Bacteria | 2685 |
| 352 | Ga0501075_0024164 | 3300049591 | Bacteria | 4452 |
| 353 | Ga0501076_0013042 | 3300049592 | Bacteria | 6223 |
| 354 | Ga0501076_0032168 | 3300049592 | Bacteria | 4094 |
| 355 | Ga0501076_0249476 | 3300049592 | Unclassified | 1452 |
| 356 | Ga0501198_018614 | 3300049649 | Unclassified | 1088 |
| 357 | Ga0501199_000353 | 3300049650 | Bacteria | 4072 |
| 358 | Ga0501201_000457 | 3300049651 | Bacteria | 3775 |
| 359 | Ga0501202_006310 | 3300049652 | Bacteria | 2118 |
| 360 | Ga0501207_029127 | 3300049654 | Unclassified | 921 |
| 361 | Ga0501209_015373 | 3300049656 | Bacteria | 1704 |
| 362 | Ga0501217_004863 | 3300049661 | Bacteria | 2784 |
| 363 | Ga0501223_003398 | 3300049663 | Bacteria | 3478 |
| 364 | Ga0501228_000767 | 3300049666 | Bacteria | 2154 |
| 365 | Ga0501230_002330 | 3300049667 | Bacteria | 2412 |
| 366 | Ga0501233_001071 | 3300049668 | Bacteria | 4644 |
| 367 | Ga0501235_000316 | 3300049669 | Bacteria | 9164 |
| 368 | Ga0501236_005291 | 3300049670 | Bacteria | 1556 |
| 369 | Ga0501239_000326 | 3300049672 | Bacteria | 3544 |
| 370 | Ga0501240_004349 | 3300049673 | Bacteria | 1639 |
| 371 | Ga0501248_003617 | 3300049678 | Unclassified | 1125 |
| 372 | Ga0501249_000336 | 3300049679 | Bacteria | 12764 |
| 373 | Ga0501251_000681 | 3300049681 | Bacteria | 3057 |
| 374 | Ga0501253_031016 | 3300049683 | Unclassified | 1019 |
| 375 | Ga0501255_004736 | 3300049684 | Unclassified | 1330 |
| 376 | Ga0501257_006079 | 3300049686 | Bacteria | 2674 |
| 377 | Ga0501258_000134 | 3300049687 | Bacteria | 4098 |
| 378 | Ga0501260_000220 | 3300049689 | Bacteria | 4410 |
| 379 | Ga0501261_000758 | 3300049690 | Bacteria | 4010 |
| 380 | Ga0501219_000953 | 3300049703 | Bacteria | 3492 |
| 381 | Ga0501221_002570 | 3300049704 | Bacteria | 2992 |
| 382 | Ga0501225_0003041 | 3300049705 | Bacteria | 5125 |
| 383 | Ga0501229_000092 | 3300049706 | Bacteria | 9222 |
| 384 | Ga0501234_000312 | 3300049707 | Bacteria | 7092 |
| 385 | Ga0501245_000594 | 3300049708 | Bacteria | 4437 |
| 386 | Ga0501079_0058313 | 3300049741 | Bacteria | 2979 |
| 387 | Ga0501079_0280277 | 3300049741 | Bacteria | 1303 |
| 388 | Ga0501080_0022429 | 3300049742 | Bacteria | 5849 |
| 389 | Ga0501080_0175549 | 3300049742 | Bacteria | 1974 |
| 390 | Ga0501081_0058894 | 3300049743 | Bacteria | 2658 |
| 391 | Ga0501081_0342872 | 3300049743 | Bacteria | 1100 |
| 392 | Ga0501232_000258 | 3300049757 | Bacteria | 3264 |
| 393 | Ga0501262_009996 | 3300049759 | Unclassified | 1181 |
| 394 | Ga0501265_000991 | 3300049762 | Bacteria | 3194 |
| 395 | Ga0501266_000067 | 3300049763 | Bacteria | 14803 |
| 396 | Ga0501269_003681 | 3300049766 | Bacteria | 1849 |
| 397 | Ga0501270_002541 | 3300049767 | Bacteria | 1880 |
| 398 | Ga0501272_000120 | 3300049769 | Bacteria | 6174 |
| 399 | Ga0501274_000152 | 3300049771 | Bacteria | 4346 |
| 400 | Ga0501275_001659 | 3300049772 | Bacteria | 2132 |
| 401 | Ga0501279_003631 | 3300049775 | Bacteria | 2014 |
| 402 | Ga0501280_010479 | 3300049776 | Unclassified | 1293 |
| 403 | Ga0501282_000720 | 3300049778 | Bacteria | 3806 |
| 404 | Ga0501283_000032 | 3300049779 | Bacteria | 16291 |
| 405 | Ga0501035_0046697 | 3300049822 | Bacteria | 3895 |
| 406 | Ga0501035_0122654 | 3300049822 | Bacteria | 2270 |
| 407 | Ga0501045_0036736 | 3300049824 | Bacteria | 3558 |
| 408 | Ga0501045_0115700 | 3300049824 | Bacteria | 1989 |
| 409 | Ga0501045_0232607 | 3300049824 | Bacteria | 1372 |
| 410 | Ga0501212_000363 | 3300049851 | Bacteria | 4266 |
| 411 | Ga0501226_000251 | 3300049853 | Bacteria | 8223 |
| 412 | nmdc:mga05p37_222548_c1 | 3300050507 | Bacteria | 2277 |
| 413 | nmdc:mga05p37_4495_c1 | 3300050507 | Bacteria | 16304 |
| 414 | nmdc:mga05p37_591253_c1 | 3300050507 | Bacteria | 1255 |
| 415 | nmdc:mga09592_38496_c1 | 3300050508 | Bacteria | 4015 |
| 416 | nmdc:mga09592_61523_c1 | 3300050508 | Bacteria | 3176 |
| 417 | nmdc:mga0qj67_13617_c1 | 3300050509 | Bacteria | 6136 |
| 418 | nmdc:mga0qj67_17052_c1 | 3300050509 | Bacteria | 5518 |
| 419 | nmdc:mga06r32_70763_c1 | 3300050510 | Bacteria | 3375 |
| 420 | nmdc:mga08y16_80793_c1 | 3300050511 | Bacteria | 3390 |
| 421 | nmdc:mga0n895_343071_c1 | 3300050512 | Bacteria | 1513 |
| 422 | nmdc:mga0n895_46247_c1 | 3300050512 | Bacteria | 4251 |
| 423 | nmdc:mga0rr50_235947_c1 | 3300050513 | Bacteria | 1515 |
| 424 | nmdc:mga0rr50_67437_c1 | 3300050513 | Bacteria | 2718 |
| 425 | nmdc:mga08x19_174357_c1 | 3300050514 | Bacteria | 1466 |
| 426 | nmdc:mga0a205_330180_c1 | 3300050515 | Bacteria | 1395 |
| 427 | nmdc:mga0a205_7737_c1 | 3300050515 | Bacteria | 9756 |
| 428 | Ga0495601_0037851 | 3300053077 | Bacteria | 3015 |
| 429 | Ga0495601_0337089 | 3300053077 | Bacteria | 981 |
| 430 | Ga0495612_0042323 | 3300053078 | Bacteria | 1859 |
| 431 | Ga0495595_0001011 | 3300053084 | Bacteria | 10826 |
| 432 | Ga0495595_0005771 | 3300053084 | Bacteria | 5012 |
| 433 | Ga0495595_0061009 | 3300053084 | Bacteria | 1766 |
| 434 | Ga0495619_0003348 | 3300053085 | Bacteria | 10363 |
| 435 | Ga0495619_0016239 | 3300053085 | Bacteria | 4712 |
| 436 | Ga0495619_0224753 | 3300053085 | Bacteria | 1300 |
| 437 | Ga0501084_0039584 | 3300054114 | Bacteria | 3943 |
| 438 | Ga0501084_0049567 | 3300054114 | Bacteria | 3515 |
| 439 | Ga0501084_0389381 | 3300054114 | Bacteria | 1178 |
| 440 | Ga0590075_004616 | 3300059424 | Bacteria | 3261 |
| 441 | Ga0590077_039182 | 3300059426 | Bacteria | 1050 |
| 442 | Ga0501082_0127296 | 3300060353 | Bacteria | 2209 |
| 443 | Ga0530510_0209722 | 3300061734 | Bacteria | 1447 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300038443 | Ga0395901_0257579 | Ga0395901_0257579_787_1557 | 237 |
| 2 | 3300006175 | Ga0070712_100455549 | Ga0070712_1004555491 | 243 |
| 3 | 3300037312 | Ga0395899_0026498 | Ga0395899_0026498_1055_1879 | 246 |
| 4 | 3300037471 | Ga0395905_0224055 | Ga0395905_0224055_135_959 | 246 |
| 5 | 3300005439 | Ga0070711_100006865 | Ga0070711_1000068658 | 252 |
| 6 | 3300025916 | Ga0207663_10001415 | Ga0207663_1000141516 | 252 |
| 7 | 3300049588 | Ga0501072_0147655 | Ga0501072_0147655_248_1051 | 252 |
| 8 | 3300037312 | Ga0395899_0374234 | Ga0395899_0374234_151_915 | 253 |
| 9 | 3300049584 | Ga0501068_0016822 | Ga0501068_0016822_268_1071 | 254 |
| 10 | 3300006852 | Ga0075433_10238098 | Ga0075433_102380982 | 256 |
| 11 | 3300050515 | nmdc:mga0a205_330180_c1 | nmdc:mga0a205_330180_c1_269_1072 | 256 |
| 12 | 3300035089 | Ga0373944_0004486 | Ga0373944_0004486_863_1693 | 257 |
| 13 | 3300035116 | Ga0373945_0001152 | Ga0373945_0001152_5155_5985 | 257 |
| 14 | 3300035118 | Ga0373954_0093050 | Ga0373954_0093050_607_1437 | 257 |
| 15 | 3300035170 | Ga0373943_0000484 | Ga0373943_0000484_14151_14981 | 257 |
| 16 | 3300035171 | Ga0373946_0054325 | Ga0373946_0054325_20_850 | 257 |
| 17 | 3300035692 | Ga0373935_0004821 | Ga0373935_0004821_3491_4321 | 257 |
| 18 | 3300035725 | Ga0373947_0000968 | Ga0373947_0000968_13920_14750 | 257 |
| 19 | 3300037068 | Ga0373925_0003980 | Ga0373925_0003980_9335_10165 | 257 |
| 20 | 3300046459 | Ga0495629_0001312 | Ga0495629_0001312_9996_10826 | 257 |
| 21 | 3300046461 | Ga0495641_0000109 | Ga0495641_0000109_31146_31976 | 257 |
| 22 | 3300046463 | Ga0495653_0073175 | Ga0495653_0073175_337_1167 | 257 |
| 23 | 3300046473 | Ga0495582_0000708 | Ga0495582_0000708_3049_3879 | 257 |
| 24 | 3300046475 | Ga0495639_0000937 | Ga0495639_0000937_9315_10145 | 257 |
| 25 | 3300046476 | Ga0495662_0003489 | Ga0495662_0003489_4226_5056 | 257 |
| 26 | 3300046499 | Ga0495594_0050949 | Ga0495594_0050949_973_1803 | 257 |
| 27 | 3300046517 | Ga0495630_0084481 | Ga0495630_0084481_1167_1997 | 257 |
| 28 | 3300046531 | Ga0495665_0000595 | Ga0495665_0000595_5865_6695 | 257 |
| 29 | 3300046559 | Ga0495667_0087494 | Ga0495667_0087494_279_1109 | 257 |
| 30 | 3300046642 | Ga0495634_0006807 | Ga0495634_0006807_7532_8362 | 257 |
| 31 | 3300046663 | Ga0495635_0048299 | Ga0495635_0048299_1065_1895 | 257 |
| 32 | 3300046683 | Ga0495658_0002069 | Ga0495658_0002069_2670_3500 | 257 |
| 33 | 3300046689 | Ga0495613_0001195 | Ga0495613_0001195_12926_13756 | 257 |
| 34 | 3300046690 | Ga0495624_0011644 | Ga0495624_0011644_4911_5741 | 257 |
| 35 | 3300047315 | Ga0495581_0000833 | Ga0495581_0000833_3049_3879 | 257 |
| 36 | 3300047319 | Ga0495674_0007068 | Ga0495674_0007068_9877_10707 | 257 |
| 37 | 3300047321 | Ga0495676_0000262 | Ga0495676_0000262_31247_32077 | 257 |
| 38 | 3300047322 | Ga0495680_0005330 | Ga0495680_0005330_7115_7945 | 257 |
| 39 | 3300047471 | Ga0495684_0008277 | Ga0495684_0008277_340_1170 | 257 |
| 40 | 3300047673 | Ga0495593_0002225 | Ga0495593_0002225_7531_8361 | 257 |
| 41 | 3300048089 | Ga0495614_0008025 | Ga0495614_0008025_3311_4141 | 257 |
| 42 | 3300048915 | Ga0496112_0050760 | Ga0496112_0050760_2461_3282 | 257 |
| 43 | 3300050513 | nmdc:mga0rr50_235947_c1 | nmdc:mga0rr50_235947_c1_700_1473 | 257 |
| 44 | 3300053085 | Ga0495619_0016239 | Ga0495619_0016239_2921_3751 | 257 |
| 45 | 3300046463 | Ga0495653_0012752 | Ga0495653_0012752_5413_6243 | 259 |
| 46 | 3300046511 | Ga0495608_0009437 | Ga0495608_0009437_5228_6058 | 259 |
| 47 | 3300046514 | Ga0495618_0043394 | Ga0495618_0043394_210_1040 | 259 |
| 48 | 3300046529 | Ga0495652_0166363 | Ga0495652_0166363_340_1170 | 259 |
| 49 | 3300046533 | Ga0495640_0023413 | Ga0495640_0023413_737_1567 | 259 |
| 50 | 3300046642 | Ga0495634_0024120 | Ga0495634_0024120_2585_3406 | 259 |
| 51 | 3300046663 | Ga0495635_0038127 | Ga0495635_0038127_1047_1877 | 259 |
| 52 | 3300046675 | Ga0495657_0121349 | Ga0495657_0121349_668_1498 | 259 |
| 53 | 3300046809 | Ga0495600_0004582 | Ga0495600_0004582_3944_4774 | 259 |
| 54 | 3300047317 | Ga0495604_0151029 | Ga0495604_0151029_707_1537 | 259 |
| 55 | 3300047322 | Ga0495680_0002800 | Ga0495680_0002800_8341_9171 | 259 |
| 56 | 3300047471 | Ga0495684_0001745 | Ga0495684_0001745_8443_9273 | 259 |
| 57 | 3300053084 | Ga0495595_0001011 | Ga0495595_0001011_3836_4666 | 259 |
| 58 | 3300053085 | Ga0495619_0003348 | Ga0495619_0003348_1127_1957 | 259 |
| 59 | 3300005329 | Ga0070683_100754600 | Ga0070683_1007546001 | 263 |
| 60 | 3300049575 | Ga0501039_0065110 | Ga0501039_0065110_538_1329 | 263 |
| 61 | 3300049576 | Ga0501040_0302027 | Ga0501040_0302027_255_1046 | 263 |
| 62 | 3300049578 | Ga0501042_0047754 | Ga0501042_0047754_1409_2200 | 263 |
| 63 | 3300049582 | Ga0501048_0062340 | Ga0501048_0062340_758_1549 | 263 |
| 64 | 3300049592 | Ga0501076_0013042 | Ga0501076_0013042_5061_5852 | 263 |
| 65 | 3300054114 | Ga0501084_0389381 | Ga0501084_0389381_53_844 | 263 |
| 66 | 3300005981 | Ga0081538_10005239 | Ga0081538_100052397 | 264 |
| 67 | 3300005337 | Ga0070682_100256885 | Ga0070682_1002568852 | 266 |
| 68 | 3300005339 | Ga0070660_100030799 | Ga0070660_1000307992 | 266 |
| 69 | 3300005367 | Ga0070667_100021252 | Ga0070667_1000212523 | 266 |
| 70 | 3300005458 | Ga0070681_10041439 | Ga0070681_100414393 | 266 |
| 71 | 3300005530 | Ga0070679_100073142 | Ga0070679_1000731423 | 266 |
| 72 | 3300005548 | Ga0070665_100668690 | Ga0070665_1006686902 | 266 |
| 73 | 3300005618 | Ga0068864_100378346 | Ga0068864_1003783462 | 266 |
| 74 | 3300009098 | Ga0105245_10829275 | Ga0105245_108292751 | 266 |
| 75 | 3300009148 | Ga0105243_10454382 | Ga0105243_104543822 | 266 |
| 76 | 3300009174 | Ga0105241_10332447 | Ga0105241_103324471 | 266 |
| 77 | 3300009553 | Ga0105249_10127318 | Ga0105249_101273184 | 266 |
| 78 | 3300013100 | Ga0157373_10319055 | Ga0157373_103190551 | 266 |
| 79 | 3300013297 | Ga0157378_10289260 | Ga0157378_102892602 | 266 |
| 80 | 3300013308 | Ga0157375_10657733 | Ga0157375_106577331 | 266 |
| 81 | 3300025912 | Ga0207707_10257224 | Ga0207707_102572242 | 266 |
| 82 | 3300025919 | Ga0207657_10007300 | Ga0207657_1000730010 | 266 |
| 83 | 3300025921 | Ga0207652_10234487 | Ga0207652_102344872 | 266 |
| 84 | 3300025986 | Ga0207658_10013627 | Ga0207658_100136273 | 266 |
| 85 | 3300026088 | Ga0207641_10114416 | Ga0207641_101144164 | 266 |
| 86 | 3300026095 | Ga0207676_10128226 | Ga0207676_101282262 | 266 |
| 87 | 3300028800 | Ga0265338_10044884 | Ga0265338_100448843 | 266 |
| 88 | 3300028800 | Ga0265338_10050440 | Ga0265338_100504403 | 266 |
| 89 | 3300028800 | Ga0265338_10095567 | Ga0265338_100955672 | 266 |
| 90 | 3300031090 | Ga0265760_10007478 | Ga0265760_100074783 | 266 |
| 91 | 3300031852 | Ga0307410_10121903 | Ga0307410_101219032 | 266 |
| 92 | 3300032005 | Ga0307411_10204428 | Ga0307411_102044281 | 266 |
| 93 | 3300042876 | Ga0451577_0000169 | Ga0451577_0000169_86090_86950 | 266 |
| 94 | 3300044673 | Ga0453683_0000217 | Ga0453683_0000217_39058_39918 | 266 |
| 95 | 3300044712 | Ga0453684_0000536 | Ga0453684_0000536_86090_86950 | 266 |
| 96 | 3300045051 | Ga0451576_0000215 | Ga0451576_0000215_57139_57999 | 266 |
| 97 | 3300046477 | Ga0495664_0005145 | Ga0495664_0005145_819_1649 | 266 |
| 98 | 3300046543 | Ga0495645_0018251 | Ga0495645_0018251_4095_4925 | 266 |
| 99 | 3300046678 | Ga0495599_0024405 | Ga0495599_0024405_1996_2826 | 266 |
| 100 | 3300047317 | Ga0495604_0331668 | Ga0495604_0331668_59_889 | 266 |
| 101 | 3300047319 | Ga0495674_0051241 | Ga0495674_0051241_2617_3447 | 266 |
| 102 | 3300047322 | Ga0495680_0038674 | Ga0495680_0038674_628_1431 | 266 |
| 103 | 3300047322 | Ga0495680_0263489 | Ga0495680_0263489_89_892 | 266 |
| 104 | 3300048905 | Ga0496102_0008664 | Ga0496102_0008664_7162_7983 | 266 |
| 105 | 3300048908 | Ga0496105_0342992 | Ga0496105_0342992_348_1151 | 266 |
| 106 | 3300048912 | Ga0496109_0160102 | Ga0496109_0160102_995_1798 | 266 |
| 107 | 3300048915 | Ga0496112_0190246 | Ga0496112_0190246_992_1813 | 266 |
| 108 | 3300048916 | Ga0496113_0323403 | Ga0496113_0323403_161_982 | 266 |
| 109 | 3300048917 | Ga0496114_0016455 | Ga0496114_0016455_5008_5823 | 266 |
| 110 | 3300049568 | Ga0501031_0045303 | Ga0501031_0045303_618_1430 | 266 |
| 111 | 3300049572 | Ga0501036_0095321 | Ga0501036_0095321_851_1663 | 266 |
| 112 | 3300049575 | Ga0501039_0044971 | Ga0501039_0044971_1975_2787 | 266 |
| 113 | 3300049576 | Ga0501040_0227427 | Ga0501040_0227427_406_1209 | 266 |
| 114 | 3300049577 | Ga0501041_0321215 | Ga0501041_0321215_51_863 | 266 |
| 115 | 3300049580 | Ga0501046_0165251 | Ga0501046_0165251_78_890 | 266 |
| 116 | 3300049582 | Ga0501048_0048527 | Ga0501048_0048527_356_1168 | 266 |
| 117 | 3300049588 | Ga0501072_0093713 | Ga0501072_0093713_696_1508 | 266 |
| 118 | 3300049591 | Ga0501075_0024164 | Ga0501075_0024164_1781_2593 | 266 |
| 119 | 3300049592 | Ga0501076_0032168 | Ga0501076_0032168_2642_3454 | 266 |
| 120 | 3300049741 | Ga0501079_0058313 | Ga0501079_0058313_240_1052 | 266 |
| 121 | 3300049742 | Ga0501080_0175549 | Ga0501080_0175549_364_1176 | 266 |
| 122 | 3300049743 | Ga0501081_0342872 | Ga0501081_0342872_193_996 | 266 |
| 123 | 3300049824 | Ga0501045_0036736 | Ga0501045_0036736_1773_2585 | 266 |
| 124 | 3300049824 | Ga0501045_0232607 | Ga0501045_0232607_465_1268 | 266 |
| 125 | 3300053077 | Ga0495601_0337089 | Ga0495601_0337089_67_870 | 266 |
| 126 | 3300053078 | Ga0495612_0042323 | Ga0495612_0042323_680_1510 | 266 |
| 127 | 3300053084 | Ga0495595_0061009 | Ga0495595_0061009_291_1094 | 266 |
| 128 | 3300054114 | Ga0501084_0039584 | Ga0501084_0039584_2461_3264 | 266 |
| 129 | 3300005937 | Ga0081455_10001204 | Ga0081455_1000120428 | 267 |
| 130 | 3300049667 | Ga0501230_002330 | Ga0501230_002330_13_816 | 267 |
| 131 | 3300025981 | Ga0207640_10180375 | Ga0207640_101803752 | 268 |
| 132 | 3300036401 | Ga0373937_0074688 | Ga0373937_0074688_859_1743 | 268 |
| 133 | 3300046511 | Ga0495608_0190660 | Ga0495608_0190660_226_1110 | 268 |
| 134 | 3300046678 | Ga0495599_0025694 | Ga0495599_0025694_2078_2962 | 268 |
| 135 | 3300031691 | Ga0316579_10023425 | Ga0316579_100234253 | 269 |
| 136 | 3300035083 | Ga0373926_0018834 | Ga0373926_0018834_386_1291 | 270 |
| 137 | 3300035086 | Ga0373934_0025026 | Ga0373934_0025026_713_1618 | 270 |
| 138 | 3300035111 | Ga0373923_0000495 | Ga0373923_0000495_4074_4979 | 270 |
| 139 | 3300035113 | Ga0373936_0031385 | Ga0373936_0031385_592_1497 | 270 |
| 140 | 3300035117 | Ga0373953_0001502 | Ga0373953_0001502_4703_5608 | 270 |
| 141 | 3300035118 | Ga0373954_0036398 | Ga0373954_0036398_180_1085 | 270 |
| 142 | 3300035119 | Ga0373956_0007806 | Ga0373956_0007806_1597_2502 | 270 |
| 143 | 3300035172 | Ga0373955_0136994 | Ga0373955_0136994_274_1179 | 270 |
| 144 | 3300035692 | Ga0373935_0038632 | Ga0373935_0038632_1428_2333 | 270 |
| 145 | 3300035695 | Ga0373927_0042945 | Ga0373927_0042945_561_1466 | 270 |
| 146 | 3300035724 | Ga0373933_0075572 | Ga0373933_0075572_659_1564 | 270 |
| 147 | 3300037068 | Ga0373925_0047699 | Ga0373925_0047699_1783_2688 | 270 |
| 148 | 3300046454 | Ga0495592_0092827 | Ga0495592_0092827_1186_2091 | 270 |
| 149 | 3300046459 | Ga0495629_0024258 | Ga0495629_0024258_425_1330 | 270 |
| 150 | 3300046461 | Ga0495641_0025893 | Ga0495641_0025893_650_1555 | 270 |
| 151 | 3300046462 | Ga0495651_0092071 | Ga0495651_0092071_662_1567 | 270 |
| 152 | 3300046463 | Ga0495653_0048552 | Ga0495653_0048552_1953_2858 | 270 |
| 153 | 3300046472 | Ga0495580_0178511 | Ga0495580_0178511_179_1087 | 270 |
| 154 | 3300046476 | Ga0495662_0025763 | Ga0495662_0025763_1030_1935 | 270 |
| 155 | 3300046511 | Ga0495608_0142993 | Ga0495608_0142993_348_1253 | 270 |
| 156 | 3300046516 | Ga0495628_0031446 | Ga0495628_0031446_2428_3336 | 270 |
| 157 | 3300046516 | Ga0495628_0043898 | Ga0495628_0043898_159_1067 | 270 |
| 158 | 3300046517 | Ga0495630_0001309 | Ga0495630_0001309_14399_15304 | 270 |
| 159 | 3300046529 | Ga0495652_0007326 | Ga0495652_0007326_3688_4596 | 270 |
| 160 | 3300046533 | Ga0495640_0038231 | Ga0495640_0038231_2092_2997 | 270 |
| 161 | 3300046535 | Ga0495586_0012666 | Ga0495586_0012666_2919_3824 | 270 |
| 162 | 3300046543 | Ga0495645_0001560 | Ga0495645_0001560_4962_5870 | 270 |
| 163 | 3300046543 | Ga0495645_0139493 | Ga0495645_0139493_498_1406 | 270 |
| 164 | 3300046559 | Ga0495667_0065852 | Ga0495667_0065852_593_1498 | 270 |
| 165 | 3300046675 | Ga0495657_0011703 | Ga0495657_0011703_1634_2539 | 270 |
| 166 | 3300046678 | Ga0495599_0003895 | Ga0495599_0003895_4535_5443 | 270 |
| 167 | 3300046683 | Ga0495658_0083130 | Ga0495658_0083130_704_1609 | 270 |
| 168 | 3300046809 | Ga0495600_0014825 | Ga0495600_0014825_1073_1978 | 270 |
| 169 | 3300047319 | Ga0495674_0026636 | Ga0495674_0026636_3126_4031 | 270 |
| 170 | 3300047444 | Ga0495675_0024425 | Ga0495675_0024425_1619_2527 | 270 |
| 171 | 3300053077 | Ga0495601_0037851 | Ga0495601_0037851_1360_2268 | 270 |
| 172 | 3300053084 | Ga0495595_0005771 | Ga0495595_0005771_2939_3844 | 270 |
| 173 | 3300053085 | Ga0495619_0224753 | Ga0495619_0224753_13_921 | 270 |
| 174 | 2162886007 | SwRhRL2b_contig_3732914 | SwRhRL2b_0288.00002460 | 272 |
| 175 | 3300005289 | Ga0065704_10115513 | Ga0065704_101155132 | 272 |
| 176 | 3300005290 | Ga0065712_10013967 | Ga0065712_100139672 | 272 |
| 177 | 3300005293 | Ga0065715_10007207 | Ga0065715_100072072 | 272 |
| 178 | 3300005295 | Ga0065707_10116188 | Ga0065707_101161882 | 272 |
| 179 | 3300005327 | Ga0070658_10212320 | Ga0070658_102123202 | 272 |
| 180 | 3300005329 | Ga0070683_100105245 | Ga0070683_1001052452 | 272 |
| 181 | 3300005330 | Ga0070690_100000609 | Ga0070690_1000006099 | 272 |
| 182 | 3300005330 | Ga0070690_100052610 | Ga0070690_1000526103 | 272 |
| 183 | 3300005331 | Ga0070670_100067076 | Ga0070670_1000670762 | 272 |
| 184 | 3300005334 | Ga0068869_100018641 | Ga0068869_1000186416 | 272 |
| 185 | 3300005336 | Ga0070680_100050583 | Ga0070680_1000505832 | 272 |
| 186 | 3300005337 | Ga0070682_100021642 | Ga0070682_1000216423 | 272 |
| 187 | 3300005339 | Ga0070660_100006010 | Ga0070660_1000060107 | 272 |
| 188 | 3300005340 | Ga0070689_100028769 | Ga0070689_1000287692 | 272 |
| 189 | 3300005341 | Ga0070691_10032795 | Ga0070691_100327952 | 272 |
| 190 | 3300005343 | Ga0070687_100215461 | Ga0070687_1002154611 | 272 |
| 191 | 3300005345 | Ga0070692_10038634 | Ga0070692_100386342 | 272 |
| 192 | 3300005347 | Ga0070668_100024482 | Ga0070668_1000244823 | 272 |
| 193 | 3300005353 | Ga0070669_100007933 | Ga0070669_1000079333 | 272 |
| 194 | 3300005354 | Ga0070675_100036319 | Ga0070675_1000363194 | 272 |
| 195 | 3300005356 | Ga0070674_100007966 | Ga0070674_1000079664 | 272 |
| 196 | 3300005364 | Ga0070673_100005271 | Ga0070673_1000052718 | 272 |
| 197 | 3300005366 | Ga0070659_100008586 | Ga0070659_1000085866 | 272 |
| 198 | 3300005367 | Ga0070667_100012950 | Ga0070667_1000129506 | 272 |
| 199 | 3300005438 | Ga0070701_10065346 | Ga0070701_100653462 | 272 |
| 200 | 3300005441 | Ga0070700_100005956 | Ga0070700_1000059566 | 272 |
| 201 | 3300005444 | Ga0070694_100072087 | Ga0070694_1000720874 | 272 |
| 202 | 3300005457 | Ga0070662_100013181 | Ga0070662_1000131818 | 272 |
| 203 | 3300005458 | Ga0070681_10084789 | Ga0070681_100847894 | 272 |
| 204 | 3300005458 | Ga0070681_10346182 | Ga0070681_103461821 | 272 |
| 205 | 3300005459 | Ga0068867_100001017 | Ga0068867_10000101712 | 272 |
| 206 | 3300005468 | Ga0070707_100035234 | Ga0070707_1000352346 | 272 |
| 207 | 3300005471 | Ga0070698_100390446 | Ga0070698_1003904462 | 272 |
| 208 | 3300005530 | Ga0070679_100003296 | Ga0070679_1000032965 | 272 |
| 209 | 3300005535 | Ga0070684_100151770 | Ga0070684_1001517702 | 272 |
| 210 | 3300005544 | Ga0070686_100009830 | Ga0070686_1000098304 | 272 |
| 211 | 3300005545 | Ga0070695_100007372 | Ga0070695_1000073727 | 272 |
| 212 | 3300005546 | Ga0070696_100037509 | Ga0070696_1000375093 | 272 |
| 213 | 3300005546 | Ga0070696_100042874 | Ga0070696_1000428743 | 272 |
| 214 | 3300005546 | Ga0070696_100065528 | Ga0070696_1000655282 | 272 |
| 215 | 3300005549 | Ga0070704_100050251 | Ga0070704_1000502513 | 272 |
| 216 | 3300005564 | Ga0070664_100014327 | Ga0070664_1000143273 | 272 |
| 217 | 3300005564 | Ga0070664_100080457 | Ga0070664_1000804572 | 272 |
| 218 | 3300005577 | Ga0068857_100086631 | Ga0068857_1000866311 | 272 |
| 219 | 3300005578 | Ga0068854_100052378 | Ga0068854_1000523782 | 272 |
| 220 | 3300005615 | Ga0070702_100037880 | Ga0070702_1000378801 | 272 |
| 221 | 3300005718 | Ga0068866_10008164 | Ga0068866_100081642 | 272 |
| 222 | 3300005719 | Ga0068861_100025086 | Ga0068861_1000250861 | 272 |
| 223 | 3300005840 | Ga0068870_10028128 | Ga0068870_100281282 | 272 |
| 224 | 3300005843 | Ga0068860_100103032 | Ga0068860_1001030323 | 272 |
| 225 | 3300005844 | Ga0068862_100049164 | Ga0068862_1000491642 | 272 |
| 226 | 3300006058 | Ga0075432_10006642 | Ga0075432_100066422 | 272 |
| 227 | 3300006163 | Ga0070715_10061369 | Ga0070715_100613692 | 272 |
| 228 | 3300006173 | Ga0070716_100046363 | Ga0070716_1000463632 | 272 |
| 229 | 3300006844 | Ga0075428_100051084 | Ga0075428_1000510843 | 272 |
| 230 | 3300006846 | Ga0075430_100014898 | Ga0075430_1000148985 | 272 |
| 231 | 3300006846 | Ga0075430_100038279 | Ga0075430_1000382792 | 272 |
| 232 | 3300006847 | Ga0075431_100059596 | Ga0075431_1000595966 | 272 |
| 233 | 3300006852 | Ga0075433_10017648 | Ga0075433_100176482 | 272 |
| 234 | 3300006852 | Ga0075433_10333380 | Ga0075433_103333801 | 272 |
| 235 | 3300006871 | Ga0075434_100035012 | Ga0075434_1000350126 | 272 |
| 236 | 3300006880 | Ga0075429_100083023 | Ga0075429_1000830235 | 272 |
| 237 | 3300006914 | Ga0075436_100211871 | Ga0075436_1002118712 | 272 |
| 238 | 3300007076 | Ga0075435_100110448 | Ga0075435_1001104481 | 272 |
| 239 | 3300007076 | Ga0075435_100188210 | Ga0075435_1001882102 | 272 |
| 240 | 3300009098 | Ga0105245_10003636 | Ga0105245_100036367 | 272 |
| 241 | 3300009147 | Ga0114129_10008800 | Ga0114129_1000880012 | 272 |
| 242 | 3300009147 | Ga0114129_10201448 | Ga0114129_102014481 | 272 |
| 243 | 3300009148 | Ga0105243_10077595 | Ga0105243_100775951 | 272 |
| 244 | 3300009176 | Ga0105242_10014583 | Ga0105242_100145836 | 272 |
| 245 | 3300009553 | Ga0105249_10027186 | Ga0105249_100271863 | 272 |
| 246 | 3300010375 | Ga0105239_10081339 | Ga0105239_100813393 | 272 |
| 247 | 3300011119 | Ga0105246_10006386 | Ga0105246_100063865 | 272 |
| 248 | 3300013102 | Ga0157371_10139986 | Ga0157371_101399861 | 272 |
| 249 | 3300013296 | Ga0157374_10018504 | Ga0157374_100185045 | 272 |
| 250 | 3300013297 | Ga0157378_10021293 | Ga0157378_100212931 | 272 |
| 251 | 3300013308 | Ga0157375_10126046 | Ga0157375_101260461 | 272 |
| 252 | 3300014968 | Ga0157379_10281718 | Ga0157379_102817182 | 272 |
| 253 | 3300014969 | Ga0157376_10033098 | Ga0157376_100330982 | 272 |
| 254 | 3300025315 | Ga0207697_10024484 | Ga0207697_100244841 | 272 |
| 255 | 3300025899 | Ga0207642_10017616 | Ga0207642_100176161 | 272 |
| 256 | 3300025901 | Ga0207688_10017885 | Ga0207688_100178852 | 272 |
| 257 | 3300025907 | Ga0207645_10000123 | Ga0207645_1000012339 | 272 |
| 258 | 3300025908 | Ga0207643_10024293 | Ga0207643_100242934 | 272 |
| 259 | 3300025912 | Ga0207707_10033503 | Ga0207707_100335035 | 272 |
| 260 | 3300025917 | Ga0207660_10019697 | Ga0207660_100196975 | 272 |
| 261 | 3300025918 | Ga0207662_10116084 | Ga0207662_101160841 | 272 |
| 262 | 3300025919 | Ga0207657_10003921 | Ga0207657_100039217 | 272 |
| 263 | 3300025921 | Ga0207652_10029500 | Ga0207652_100295004 | 272 |
| 264 | 3300025921 | Ga0207652_10064703 | Ga0207652_100647033 | 272 |
| 265 | 3300025922 | Ga0207646_10026570 | Ga0207646_100265703 | 272 |
| 266 | 3300025923 | Ga0207681_10222318 | Ga0207681_102223181 | 272 |
| 267 | 3300025926 | Ga0207659_10676002 | Ga0207659_106760021 | 272 |
| 268 | 3300025932 | Ga0207690_10026396 | Ga0207690_100263965 | 272 |
| 269 | 3300025933 | Ga0207706_10000387 | Ga0207706_100003878 | 272 |
| 270 | 3300025934 | Ga0207686_10038986 | Ga0207686_100389863 | 272 |
| 271 | 3300025934 | Ga0207686_10316390 | Ga0207686_103163901 | 272 |
| 272 | 3300025935 | Ga0207709_10205523 | Ga0207709_102055232 | 272 |
| 273 | 3300025936 | Ga0207670_10031187 | Ga0207670_100311873 | 272 |
| 274 | 3300025937 | Ga0207669_10003289 | Ga0207669_100032893 | 272 |
| 275 | 3300025938 | Ga0207704_10203430 | Ga0207704_102034301 | 272 |
| 276 | 3300025939 | Ga0207665_10033979 | Ga0207665_100339791 | 272 |
| 277 | 3300025939 | Ga0207665_10134393 | Ga0207665_101343932 | 272 |
| 278 | 3300025940 | Ga0207691_10007080 | Ga0207691_100070806 | 272 |
| 279 | 3300025940 | Ga0207691_10192625 | Ga0207691_101926251 | 272 |
| 280 | 3300025942 | Ga0207689_10054939 | Ga0207689_100549391 | 272 |
| 281 | 3300025944 | Ga0207661_10091406 | Ga0207661_100914063 | 272 |
| 282 | 3300025945 | Ga0207679_10023500 | Ga0207679_100235002 | 272 |
| 283 | 3300025960 | Ga0207651_10201466 | Ga0207651_102014662 | 272 |
| 284 | 3300026067 | Ga0207678_10092192 | Ga0207678_100921923 | 272 |
| 285 | 3300026075 | Ga0207708_10001364 | Ga0207708_100013644 | 272 |
| 286 | 3300026089 | Ga0207648_10000087 | Ga0207648_100000877 | 272 |
| 287 | 3300026095 | Ga0207676_10185683 | Ga0207676_101856832 | 272 |
| 288 | 3300026116 | Ga0207674_10039236 | Ga0207674_100392361 | 272 |
| 289 | 3300026118 | Ga0207675_100321376 | Ga0207675_1003213761 | 272 |
| 290 | 3300026121 | Ga0207683_10001528 | Ga0207683_1000152819 | 272 |
| 291 | 3300026121 | Ga0207683_10078561 | Ga0207683_100785611 | 272 |
| 292 | 3300027360 | Ga0209969_1000039 | Ga0209969_10000392 | 272 |
| 293 | 3300027364 | Ga0209967_1000192 | Ga0209967_10001928 | 272 |
| 294 | 3300027364 | Ga0209967_1014791 | Ga0209967_10147911 | 272 |
| 295 | 3300027378 | Ga0209981_1000154 | Ga0209981_10001549 | 272 |
| 296 | 3300027424 | Ga0209984_1000071 | Ga0209984_100007111 | 272 |
| 297 | 3300027462 | Ga0210000_1000071 | Ga0210000_10000711 | 272 |
| 298 | 3300027471 | Ga0209995_1000005 | Ga0209995_10000052 | 272 |
| 299 | 3300027526 | Ga0209968_1000022 | Ga0209968_10000227 | 272 |
| 300 | 3300027526 | Ga0209968_1004939 | Ga0209968_10049392 | 272 |
| 301 | 3300027552 | Ga0209982_1000475 | Ga0209982_10004752 | 272 |
| 302 | 3300027614 | Ga0209970_1001324 | Ga0209970_10013245 | 272 |
| 303 | 3300027614 | Ga0209970_1004909 | Ga0209970_10049092 | 272 |
| 304 | 3300027617 | Ga0210002_1000018 | Ga0210002_10000185 | 272 |
| 305 | 3300027617 | Ga0210002_1001593 | Ga0210002_10015932 | 272 |
| 306 | 3300027665 | Ga0209983_1001591 | Ga0209983_10015916 | 272 |
| 307 | 3300027665 | Ga0209983_1007752 | Ga0209983_10077521 | 272 |
| 308 | 3300027682 | Ga0209971_1001133 | Ga0209971_10011337 | 272 |
| 309 | 3300027695 | Ga0209966_1000079 | Ga0209966_10000791 | 272 |
| 310 | 3300027717 | Ga0209998_10000111 | Ga0209998_1000011129 | 272 |
| 311 | 3300027876 | Ga0209974_10000025 | Ga0209974_100000251 | 272 |
| 312 | 3300027876 | Ga0209974_10000109 | Ga0209974_1000010919 | 272 |
| 313 | 3300027907 | Ga0207428_10000302 | Ga0207428_1000030256 | 272 |
| 314 | 3300028379 | Ga0268266_10092554 | Ga0268266_100925541 | 272 |
| 315 | 3300028381 | Ga0268264_10296193 | Ga0268264_102961931 | 272 |
| 316 | 3300031911 | Ga0307412_10121438 | Ga0307412_101214382 | 272 |
| 317 | 3300032002 | Ga0307416_100119248 | Ga0307416_1001192483 | 272 |
| 318 | 3300032005 | Ga0307411_10199099 | Ga0307411_101990991 | 272 |
| 319 | 3300035691 | Ga0373931_0218966 | Ga0373931_0218966_268_1086 | 272 |
| 320 | 3300041407 | Ga0439447_011258 | Ga0439447_011258_832_1650 | 272 |
| 321 | 3300042001 | Ga0439441_003073 | Ga0439441_003073_989_1807 | 272 |
| 322 | 3300042003 | Ga0439443_022999 | Ga0439443_022999_92_910 | 272 |
| 323 | 3300042006 | Ga0439432_008232 | Ga0439432_008232_2532_3350 | 272 |
| 324 | 3300042010 | Ga0439452_004739 | Ga0439452_004739_733_1551 | 272 |
| 325 | 3300042125 | Ga0450923_003375 | Ga0450923_003375_886_1704 | 272 |
| 326 | 3300042156 | Ga0439446_0002338 | Ga0439446_0002338_3698_4516 | 272 |
| 327 | 3300042461 | Ga0439460_0012900 | Ga0439460_0012900_266_1084 | 272 |
| 328 | 3300045051 | Ga0451576_0006974 | Ga0451576_0006974_1482_2300 | 272 |
| 329 | 3300045051 | Ga0451576_0250895 | Ga0451576_0250895_637_1455 | 272 |
| 330 | 3300045051 | Ga0451576_0309172 | Ga0451576_0309172_767_1585 | 272 |
| 331 | 3300045051 | Ga0451576_0382969 | Ga0451576_0382969_405_1223 | 272 |
| 332 | 3300048909 | Ga0496106_0371705 | Ga0496106_0371705_267_1085 | 272 |
| 333 | 3300049513 | Ga0501290_003558 | Ga0501290_003558_1106_1924 | 272 |
| 334 | 3300049514 | Ga0501291_000216 | Ga0501291_000216_4552_5370 | 272 |
| 335 | 3300049515 | Ga0501292_000178 | Ga0501292_000178_8805_9623 | 272 |
| 336 | 3300049516 | Ga0501293_000753 | Ga0501293_000753_928_1746 | 272 |
| 337 | 3300049517 | Ga0501294_000106 | Ga0501294_000106_1831_2649 | 272 |
| 338 | 3300049518 | Ga0501295_000068 | Ga0501295_000068_4011_4829 | 272 |
| 339 | 3300049519 | Ga0501296_000921 | Ga0501296_000921_2030_2848 | 272 |
| 340 | 3300049520 | Ga0501297_000349 | Ga0501297_000349_655_1473 | 272 |
| 341 | 3300049521 | Ga0501298_000215 | Ga0501298_000215_6521_7339 | 272 |
| 342 | 3300049522 | Ga0501299_000133 | Ga0501299_000133_7496_8314 | 272 |
| 343 | 3300049526 | Ga0501303_001152 | Ga0501303_001152_1080_1898 | 272 |
| 344 | 3300049568 | Ga0501031_0018824 | Ga0501031_0018824_3034_3852 | 272 |
| 345 | 3300049568 | Ga0501031_0038159 | Ga0501031_0038159_1056_1874 | 272 |
| 346 | 3300049568 | Ga0501031_0114714 | Ga0501031_0114714_770_1588 | 272 |
| 347 | 3300049569 | Ga0501032_0001369 | Ga0501032_0001369_4589_5407 | 272 |
| 348 | 3300049569 | Ga0501032_0129255 | Ga0501032_0129255_356_1174 | 272 |
| 349 | 3300049569 | Ga0501032_0172828 | Ga0501032_0172828_29_847 | 272 |
| 350 | 3300049570 | Ga0501033_0158022 | Ga0501033_0158022_525_1343 | 272 |
| 351 | 3300049572 | Ga0501036_0035974 | Ga0501036_0035974_3196_4014 | 272 |
| 352 | 3300049572 | Ga0501036_0067348 | Ga0501036_0067348_985_1803 | 272 |
| 353 | 3300049572 | Ga0501036_0160988 | Ga0501036_0160988_374_1192 | 272 |
| 354 | 3300049572 | Ga0501036_0233273 | Ga0501036_0233273_258_1076 | 272 |
| 355 | 3300049573 | Ga0501037_0036292 | Ga0501037_0036292_949_1767 | 272 |
| 356 | 3300049573 | Ga0501037_0343432 | Ga0501037_0343432_135_953 | 272 |
| 357 | 3300049574 | Ga0501038_0036971 | Ga0501038_0036971_3387_4205 | 272 |
| 358 | 3300049575 | Ga0501039_0000439 | Ga0501039_0000439_5771_6589 | 272 |
| 359 | 3300049575 | Ga0501039_0210494 | Ga0501039_0210494_197_1015 | 272 |
| 360 | 3300049575 | Ga0501039_0291243 | Ga0501039_0291243_254_1072 | 272 |
| 361 | 3300049577 | Ga0501041_0022234 | Ga0501041_0022234_2031_2849 | 272 |
| 362 | 3300049578 | Ga0501042_0028113 | Ga0501042_0028113_2332_3150 | 272 |
| 363 | 3300049578 | Ga0501042_0034770 | Ga0501042_0034770_2310_3128 | 272 |
| 364 | 3300049580 | Ga0501046_0012725 | Ga0501046_0012725_2642_3460 | 272 |
| 365 | 3300049580 | Ga0501046_0017901 | Ga0501046_0017901_2310_3128 | 272 |
| 366 | 3300049580 | Ga0501046_0152096 | Ga0501046_0152096_309_1127 | 272 |
| 367 | 3300049582 | Ga0501048_0070866 | Ga0501048_0070866_1436_2254 | 272 |
| 368 | 3300049582 | Ga0501048_0074222 | Ga0501048_0074222_1102_1920 | 272 |
| 369 | 3300049584 | Ga0501068_0020878 | Ga0501068_0020878_632_1450 | 272 |
| 370 | 3300049587 | Ga0501071_0024251 | Ga0501071_0024251_689_1507 | 272 |
| 371 | 3300049587 | Ga0501071_0277028 | Ga0501071_0277028_31_849 | 272 |
| 372 | 3300049588 | Ga0501072_0558791 | Ga0501072_0558791_64_882 | 272 |
| 373 | 3300049590 | Ga0501074_0062349 | Ga0501074_0062349_724_1542 | 272 |
| 374 | 3300049592 | Ga0501076_0249476 | Ga0501076_0249476_427_1245 | 272 |
| 375 | 3300049649 | Ga0501198_018614 | Ga0501198_018614_53_871 | 272 |
| 376 | 3300049650 | Ga0501199_000353 | Ga0501199_000353_191_1009 | 272 |
| 377 | 3300049651 | Ga0501201_000457 | Ga0501201_000457_800_1618 | 272 |
| 378 | 3300049652 | Ga0501202_006310 | Ga0501202_006310_842_1660 | 272 |
| 379 | 3300049654 | Ga0501207_029127 | Ga0501207_029127_21_839 | 272 |
| 380 | 3300049656 | Ga0501209_015373 | Ga0501209_015373_203_1021 | 272 |
| 381 | 3300049661 | Ga0501217_004863 | Ga0501217_004863_1278_2096 | 272 |
| 382 | 3300049663 | Ga0501223_003398 | Ga0501223_003398_1726_2544 | 272 |
| 383 | 3300049666 | Ga0501228_000767 | Ga0501228_000767_651_1469 | 272 |
| 384 | 3300049668 | Ga0501233_001071 | Ga0501233_001071_2602_3420 | 272 |
| 385 | 3300049669 | Ga0501235_000316 | Ga0501235_000316_5484_6302 | 272 |
| 386 | 3300049670 | Ga0501236_005291 | Ga0501236_005291_66_884 | 272 |
| 387 | 3300049672 | Ga0501239_000326 | Ga0501239_000326_75_893 | 272 |
| 388 | 3300049673 | Ga0501240_004349 | Ga0501240_004349_348_1166 | 272 |
| 389 | 3300049678 | Ga0501248_003617 | Ga0501248_003617_173_991 | 272 |
| 390 | 3300049679 | Ga0501249_000336 | Ga0501249_000336_6876_7694 | 272 |
| 391 | 3300049681 | Ga0501251_000681 | Ga0501251_000681_2061_2879 | 272 |
| 392 | 3300049683 | Ga0501253_031016 | Ga0501253_031016_179_997 | 272 |
| 393 | 3300049684 | Ga0501255_004736 | Ga0501255_004736_94_912 | 272 |
| 394 | 3300049686 | Ga0501257_006079 | Ga0501257_006079_354_1172 | 272 |
| 395 | 3300049687 | Ga0501258_000134 | Ga0501258_000134_2408_3226 | 272 |
| 396 | 3300049689 | Ga0501260_000220 | Ga0501260_000220_21_839 | 272 |
| 397 | 3300049690 | Ga0501261_000758 | Ga0501261_000758_2875_3693 | 272 |
| 398 | 3300049703 | Ga0501219_000953 | Ga0501219_000953_442_1260 | 272 |
| 399 | 3300049704 | Ga0501221_002570 | Ga0501221_002570_1375_2193 | 272 |
| 400 | 3300049705 | Ga0501225_0003041 | Ga0501225_0003041_709_1527 | 272 |
| 401 | 3300049706 | Ga0501229_000092 | Ga0501229_000092_1491_2309 | 272 |
| 402 | 3300049707 | Ga0501234_000312 | Ga0501234_000312_3274_4092 | 272 |
| 403 | 3300049708 | Ga0501245_000594 | Ga0501245_000594_3236_4054 | 272 |
| 404 | 3300049741 | Ga0501079_0280277 | Ga0501079_0280277_292_1110 | 272 |
| 405 | 3300049742 | Ga0501080_0022429 | Ga0501080_0022429_1239_2057 | 272 |
| 406 | 3300049743 | Ga0501081_0058894 | Ga0501081_0058894_838_1656 | 272 |
| 407 | 3300049757 | Ga0501232_000258 | Ga0501232_000258_2382_3200 | 272 |
| 408 | 3300049759 | Ga0501262_009996 | Ga0501262_009996_263_1081 | 272 |
| 409 | 3300049762 | Ga0501265_000991 | Ga0501265_000991_2342_3160 | 272 |
| 410 | 3300049763 | Ga0501266_000067 | Ga0501266_000067_7770_8588 | 272 |
| 411 | 3300049766 | Ga0501269_003681 | Ga0501269_003681_71_889 | 272 |
| 412 | 3300049767 | Ga0501270_002541 | Ga0501270_002541_539_1357 | 272 |
| 413 | 3300049769 | Ga0501272_000120 | Ga0501272_000120_4361_5179 | 272 |
| 414 | 3300049771 | Ga0501274_000152 | Ga0501274_000152_3406_4224 | 272 |
| 415 | 3300049772 | Ga0501275_001659 | Ga0501275_001659_115_933 | 272 |
| 416 | 3300049775 | Ga0501279_003631 | Ga0501279_003631_228_1046 | 272 |
| 417 | 3300049776 | Ga0501280_010479 | Ga0501280_010479_418_1236 | 272 |
| 418 | 3300049778 | Ga0501282_000720 | Ga0501282_000720_555_1373 | 272 |
| 419 | 3300049779 | Ga0501283_000032 | Ga0501283_000032_10922_11740 | 272 |
| 420 | 3300049822 | Ga0501035_0046697 | Ga0501035_0046697_108_926 | 272 |
| 421 | 3300049822 | Ga0501035_0122654 | Ga0501035_0122654_988_1806 | 272 |
| 422 | 3300049824 | Ga0501045_0115700 | Ga0501045_0115700_1107_1925 | 272 |
| 423 | 3300049851 | Ga0501212_000363 | Ga0501212_000363_2873_3691 | 272 |
| 424 | 3300049853 | Ga0501226_000251 | Ga0501226_000251_1932_2750 | 272 |
| 425 | 3300050507 | nmdc:mga05p37_222548_c1 | nmdc:mga05p37_222548_c1_1305_2123 | 272 |
| 426 | 3300050507 | nmdc:mga05p37_4495_c1 | nmdc:mga05p37_4495_c1_2787_3605 | 272 |
| 427 | 3300050507 | nmdc:mga05p37_591253_c1 | nmdc:mga05p37_591253_c1_150_968 | 272 |
| 428 | 3300050508 | nmdc:mga09592_38496_c1 | nmdc:mga09592_38496_c1_1497_2315 | 272 |
| 429 | 3300050508 | nmdc:mga09592_61523_c1 | nmdc:mga09592_61523_c1_940_1758 | 272 |
| 430 | 3300050509 | nmdc:mga0qj67_13617_c1 | nmdc:mga0qj67_13617_c1_4219_5037 | 272 |
| 431 | 3300050509 | nmdc:mga0qj67_17052_c1 | nmdc:mga0qj67_17052_c1_2692_3510 | 272 |
| 432 | 3300050510 | nmdc:mga06r32_70763_c1 | nmdc:mga06r32_70763_c1_677_1495 | 272 |
| 433 | 3300050511 | nmdc:mga08y16_80793_c1 | nmdc:mga08y16_80793_c1_1997_2815 | 272 |
| 434 | 3300050512 | nmdc:mga0n895_343071_c1 | nmdc:mga0n895_343071_c1_509_1327 | 272 |
| 435 | 3300050512 | nmdc:mga0n895_46247_c1 | nmdc:mga0n895_46247_c1_1243_2061 | 272 |
| 436 | 3300050513 | nmdc:mga0rr50_67437_c1 | nmdc:mga0rr50_67437_c1_268_1086 | 272 |
| 437 | 3300050514 | nmdc:mga08x19_174357_c1 | nmdc:mga08x19_174357_c1_392_1210 | 272 |
| 438 | 3300050515 | nmdc:mga0a205_7737_c1 | nmdc:mga0a205_7737_c1_8286_9104 | 272 |
| 439 | 3300054114 | Ga0501084_0049567 | Ga0501084_0049567_1688_2506 | 272 |
| 440 | 3300059424 | Ga0590075_004616 | Ga0590075_004616_348_1166 | 272 |
| 441 | 3300059426 | Ga0590077_039182 | Ga0590077_039182_94_912 | 272 |
| 442 | 3300060353 | Ga0501082_0127296 | Ga0501082_0127296_409_1227 | 272 |
| 443 | 3300061734 | Ga0530510_0209722 | Ga0530510_0209722_402_1220 | 272 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5o6m-assembly1.cif.gz_A | structure of polyphosphate kinase from meiothermus ruber n121d bound to atp | 0.9744 | 1 | 259 |
| 5lcd-assembly1.cif.gz_A | structure of polyphosphate kinase from meiothermus ruber bound to amp | 0.9734 | 1 | 259 |
| 5o6m-assembly1.cif.gz_A | structure of polyphosphate kinase from meiothermus ruber n121d bound to atp | 0.9707 | 1 | 259 |
| 5lcd-assembly1.cif.gz_A | structure of polyphosphate kinase from meiothermus ruber bound to amp | 0.9697 | 1 | 259 |
| 5o6m-assembly1.cif.gz_C | structure of polyphosphate kinase from meiothermus ruber n121d bound to atp | 0.9634 | 1 | 265 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6aqeA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.969 | 2 | 272 | 3.40.50.300 |
| 5ldbC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9623 | 1 | 265 | 3.40.50.300 |
| 5ldbC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9587 | 1 | 265 | 3.40.50.300 |
| 6aqeA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9583 | 2 | 272 | 3.40.50.300 |
| 6angA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9437 | 2 | 259 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F6QJM5-F1-model_v4 | Polyphosphate kinase-2-related domain-containing protein | 0.9827 | 2 | 264 |
GO:0006797
GO:0016776 |
| AF-A0A3L7WI53-F1-model_v4 | Polyphosphate kinase 2 family protein | 0.982 | 32 | 252 |
GO:0006797
GO:0016301 GO:0016776 |
| AF-A0A7V8YVV4-F1-model_v4 | Polyphosphate kinase 2 family protein | 0.9815 | 1 | 256 |
GO:0006797
GO:0008976 |
| AF-A0A7V1RBX5-F1-model_v4 | Polyphosphate kinase 2 family protein | 0.9799 | 5 | 254 |
GO:0006797
GO:0016301 GO:0016776 |
| AF-Q09C39-F1-model_v4 | PvdS | 0.9783 | 63 | 254 |
GO:0006797
GO:0008976 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar