F445101

General Info

Members Datasets Scaffolds Average Seq Length
443 317 443 274

Family's Representative Sequence

Representative Sequence 3300025981|Ga0207640_10180375|Ga0207640_101803752
Length 311
Sequence VTSRSSLLDALRVEPGSAPKLAERDPDERVGAPGKKEGIERLEELVEQLAMLHNRLYAEAKRSVLLVLQGLDASGKDGTIRSVFTGVNPQGCRVVSFKVPTPNELAHDYLWRIHQACPARGEIGIFNRSHYEDIVAVRVRKLAEKKVWERRYEHIRAFEQMLGDEGTAVVKVFLHVSRDEQRKRLQERLDDPEKRWKFRAGDLDDRALWDDFTEAYEDALRETSTKHAPWYVVPADKKWFARLVVAGAIYDALARLGLRYPVVGQDKKKELAAARTELLNEGKAVKKAKRAEERAAGEPAGAEPRPERGAA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
143 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
144 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
145 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
148 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
149 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
150 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
165 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
166 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
167 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
168 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
169 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
170 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
171 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
177 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
178 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
183 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
184 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
185 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
186 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
187 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
188 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
192 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
193 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
194 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
200 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
213 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
222 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
223 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
224 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
225 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
226 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
227 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
228 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
229 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
230 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
231 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
232 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
245 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
246 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
249 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
250 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
251 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
252 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
253 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
254 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
255 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
256 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
257 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
258 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
259 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
260 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
261 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
262 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
263 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
264 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
265 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
266 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
267 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
268 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
269 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
270 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
271 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
272 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
273 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
274 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
275 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
276 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
277 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
278 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
279 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
280 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
281 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
282 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
283 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
284 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
285 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
286 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
287 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
288 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
289 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
290 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
291 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
292 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
293 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
294 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
295 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
296 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
299 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
300 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
301 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
302 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
303 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
304 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
305 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
306 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
307 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
308 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
309 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
310 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
311 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
312 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
313 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
314 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
315 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
316 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
317 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.81
Rhizosphere 98.19
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3732914 2162886007 Bacteria 1405
2 Ga0065704_10115513 3300005289 Bacteria 1871
3 Ga0065712_10013967 3300005290 Bacteria 1742
4 Ga0065715_10007207 3300005293 Bacteria 2694
5 Ga0065707_10116188 3300005295 Bacteria 2245
6 Ga0070658_10212320 3300005327 Bacteria 1635
7 Ga0070683_100105245 3300005329 Bacteria 2660
8 Ga0070683_100754600 3300005329 Bacteria 932
9 Ga0070690_100000609 3300005330 Bacteria 18087
10 Ga0070690_100052610 3300005330 Bacteria 2603
11 Ga0070670_100067076 3300005331 Bacteria 3079
12 Ga0068869_100018641 3300005334 Bacteria 4728
13 Ga0070680_100050583 3300005336 Bacteria 3389
14 Ga0070682_100021642 3300005337 Bacteria 3798
15 Ga0070682_100256885 3300005337 Bacteria 1263
16 Ga0070660_100006010 3300005339 Bacteria 8393
17 Ga0070660_100030799 3300005339 Bacteria 4026
18 Ga0070689_100028769 3300005340 Bacteria 4204
19 Ga0070691_10032795 3300005341 Bacteria 2441
20 Ga0070687_100215461 3300005343 Bacteria 1173
21 Ga0070692_10038634 3300005345 Bacteria 2434
22 Ga0070668_100024482 3300005347 Bacteria 4575
23 Ga0070669_100007933 3300005353 Bacteria 7587
24 Ga0070675_100036319 3300005354 Bacteria 4009
25 Ga0070674_100007966 3300005356 Bacteria 6276
26 Ga0070673_100005271 3300005364 Bacteria 8259
27 Ga0070659_100008586 3300005366 Bacteria 7469
28 Ga0070667_100012950 3300005367 Bacteria 6896
29 Ga0070667_100021252 3300005367 Bacteria 5392
30 Ga0070701_10065346 3300005438 Bacteria 1930
31 Ga0070711_100006865 3300005439 Bacteria 6895
32 Ga0070700_100005956 3300005441 Bacteria 6481
33 Ga0070694_100072087 3300005444 Bacteria 2382
34 Ga0070662_100013181 3300005457 Bacteria 5496
35 Ga0070681_10041439 3300005458 Bacteria 4615
36 Ga0070681_10084789 3300005458 Bacteria 3120
37 Ga0070681_10346182 3300005458 Bacteria 1396
38 Ga0068867_100001017 3300005459 Bacteria 19162
39 Ga0070707_100035234 3300005468 Bacteria 4774
40 Ga0070698_100390446 3300005471 Bacteria 1325
41 Ga0070679_100003296 3300005530 Bacteria 14780
42 Ga0070679_100073142 3300005530 Bacteria 3420
43 Ga0070684_100151770 3300005535 Bacteria 2099
44 Ga0070686_100009830 3300005544 Bacteria 5374
45 Ga0070695_100007372 3300005545 Bacteria 6523
46 Ga0070696_100037509 3300005546 Bacteria 3343
47 Ga0070696_100042874 3300005546 Bacteria 3128
48 Ga0070696_100065528 3300005546 Bacteria 2547
49 Ga0070665_100668690 3300005548 Bacteria 1051
50 Ga0070704_100050251 3300005549 Bacteria 2929
51 Ga0070664_100014327 3300005564 Bacteria 6464
52 Ga0070664_100080457 3300005564 Bacteria 2806
53 Ga0068857_100086631 3300005577 Bacteria 2801
54 Ga0068854_100052378 3300005578 Bacteria 2927
55 Ga0070702_100037880 3300005615 Bacteria 2681
56 Ga0068864_100378346 3300005618 Unclassified 1341
57 Ga0068866_10008164 3300005718 Bacteria 4400
58 Ga0068861_100025086 3300005719 Bacteria 4318
59 Ga0068870_10028128 3300005840 Bacteria 2819
60 Ga0068860_100103032 3300005843 Bacteria 2724
61 Ga0068862_100049164 3300005844 Bacteria 3601
62 Ga0081455_10001204 3300005937 Bacteria 32428
63 Ga0081538_10005239 3300005981 Bacteria 11718
64 Ga0075432_10006642 3300006058 Bacteria 3937
65 Ga0070715_10061369 3300006163 Bacteria 1650
66 Ga0070716_100046363 3300006173 Bacteria 2446
67 Ga0070712_100455549 3300006175 Bacteria 1066
68 Ga0075428_100051084 3300006844 Bacteria 4533
69 Ga0075430_100014898 3300006846 Bacteria 6622
70 Ga0075430_100038279 3300006846 Bacteria 4063
71 Ga0075431_100059596 3300006847 Bacteria 3939
72 Ga0075433_10017648 3300006852 Bacteria 5918
73 Ga0075433_10238098 3300006852 Bacteria 1616
74 Ga0075433_10333380 3300006852 Bacteria 1341
75 Ga0075434_100035012 3300006871 Bacteria 4963
76 Ga0075429_100083023 3300006880 Bacteria 2793
77 Ga0075436_100211871 3300006914 Bacteria 1373
78 Ga0075435_100110448 3300007076 Bacteria 2286
79 Ga0075435_100188210 3300007076 Bacteria 1746
80 Ga0105245_10003636 3300009098 Bacteria 13766
81 Ga0105245_10829275 3300009098 Bacteria 964
82 Ga0114129_10008800 3300009147 Bacteria 14403
83 Ga0114129_10201448 3300009147 Bacteria 2695
84 Ga0105243_10077595 3300009148 Bacteria 2702
85 Ga0105243_10454382 3300009148 Bacteria 1203
86 Ga0105241_10332447 3300009174 Bacteria 1314
87 Ga0105242_10014583 3300009176 Bacteria 6085
88 Ga0105249_10027186 3300009553 Bacteria 5161
89 Ga0105249_10127318 3300009553 Bacteria 2427
90 Ga0105239_10081339 3300010375 Bacteria 3565
91 Ga0105246_10006386 3300011119 Bacteria 7197
92 Ga0157373_10319055 3300013100 Bacteria 1105
93 Ga0157371_10139986 3300013102 Bacteria 1724
94 Ga0157374_10018504 3300013296 Bacteria 6149
95 Ga0157378_10021293 3300013297 Bacteria 5700
96 Ga0157378_10289260 3300013297 Unclassified 1582
97 Ga0157375_10126046 3300013308 Bacteria 2675
98 Ga0157375_10657733 3300013308 Bacteria 1204
99 Ga0157379_10281718 3300014968 Bacteria 1513
100 Ga0157376_10033098 3300014969 Bacteria 4157
101 Ga0207697_10024484 3300025315 Bacteria 2471
102 Ga0207642_10017616 3300025899 Bacteria 2722
103 Ga0207688_10017885 3300025901 Bacteria 3858
104 Ga0207645_10000123 3300025907 Bacteria 58779
105 Ga0207643_10024293 3300025908 Bacteria 3344
106 Ga0207707_10033503 3300025912 Bacteria 4495
107 Ga0207707_10257224 3300025912 Bacteria 1516
108 Ga0207663_10001415 3300025916 Bacteria 11130
109 Ga0207660_10019697 3300025917 Bacteria 4515
110 Ga0207662_10116084 3300025918 Bacteria 1674
111 Ga0207657_10003921 3300025919 Bacteria 15791
112 Ga0207657_10007300 3300025919 Bacteria 11333
113 Ga0207652_10029500 3300025921 Bacteria 4588
114 Ga0207652_10064703 3300025921 Bacteria 3164
115 Ga0207652_10234487 3300025921 Bacteria 1654
116 Ga0207646_10026570 3300025922 Bacteria 5282
117 Ga0207681_10222318 3300025923 Bacteria 1461
118 Ga0207659_10676002 3300025926 Bacteria 883
119 Ga0207690_10026396 3300025932 Bacteria 3658
120 Ga0207706_10000387 3300025933 Bacteria 47651
121 Ga0207686_10038986 3300025934 Bacteria 2879
122 Ga0207686_10316390 3300025934 Bacteria 1164
123 Ga0207709_10205523 3300025935 Bacteria 1410
124 Ga0207670_10031187 3300025936 Bacteria 3412
125 Ga0207669_10003289 3300025937 Bacteria 6991
126 Ga0207704_10203430 3300025938 Bacteria 1451
127 Ga0207665_10033979 3300025939 Bacteria 3383
128 Ga0207665_10134393 3300025939 Bacteria 1759
129 Ga0207691_10007080 3300025940 Bacteria 10824
130 Ga0207691_10192625 3300025940 Bacteria 1778
131 Ga0207689_10054939 3300025942 Bacteria 3278
132 Ga0207661_10091406 3300025944 Bacteria 2536
133 Ga0207679_10023500 3300025945 Bacteria 4217
134 Ga0207651_10201466 3300025960 Bacteria 1595
135 Ga0207640_10180375 3300025981 Bacteria 1583
136 Ga0207658_10013627 3300025986 Bacteria 5562
137 Ga0207678_10092192 3300026067 Bacteria 2590
138 Ga0207708_10001364 3300026075 Bacteria 18355
139 Ga0207641_10114416 3300026088 Unclassified 2397
140 Ga0207648_10000087 3300026089 Bacteria 87419
141 Ga0207676_10128226 3300026095 Bacteria 2153
142 Ga0207676_10185683 3300026095 Bacteria 1825
143 Ga0207674_10039236 3300026116 Bacteria 4910
144 Ga0207675_100321376 3300026118 Bacteria 1511
145 Ga0207683_10001528 3300026121 Bacteria 20839
146 Ga0207683_10078561 3300026121 Bacteria 2924
147 Ga0209969_1000039 3300027360 Bacteria 15040
148 Ga0209967_1000192 3300027364 Bacteria 8603
149 Ga0209967_1014791 3300027364 Bacteria 1114
150 Ga0209981_1000154 3300027378 Bacteria 8282
151 Ga0209984_1000071 3300027424 Bacteria 10875
152 Ga0210000_1000071 3300027462 Bacteria 14953
153 Ga0209995_1000005 3300027471 Bacteria 39661
154 Ga0209968_1000022 3300027526 Bacteria 29444
155 Ga0209968_1004939 3300027526 Bacteria 2001
156 Ga0209982_1000475 3300027552 Bacteria 4962
157 Ga0209970_1001324 3300027614 Bacteria 4341
158 Ga0209970_1004909 3300027614 Bacteria 2211
159 Ga0210002_1000018 3300027617 Bacteria 26033
160 Ga0210002_1001593 3300027617 Bacteria 3224
161 Ga0209983_1001591 3300027665 Bacteria 5024
162 Ga0209983_1007752 3300027665 Bacteria 2197
163 Ga0209971_1001133 3300027682 Bacteria 6754
164 Ga0209966_1000079 3300027695 Bacteria 42026
165 Ga0209998_10000111 3300027717 Bacteria 32355
166 Ga0209974_10000025 3300027876 Bacteria 34376
167 Ga0209974_10000109 3300027876 Bacteria 23784
168 Ga0207428_10000302 3300027907 Bacteria 65145
169 Ga0268266_10092554 3300028379 Bacteria 2653
170 Ga0268264_10296193 3300028381 Bacteria 1521
171 Ga0265338_10044884 3300028800 Bacteria 4072
172 Ga0265338_10050440 3300028800 Bacteria 3762
173 Ga0265338_10095567 3300028800 Bacteria 2440
174 Ga0265760_10007478 3300031090 Bacteria 3120
175 Ga0316579_10023425 3300031691 Bacteria 2771
176 Ga0307410_10121903 3300031852 Bacteria 1903
177 Ga0307412_10121438 3300031911 Bacteria 1881
178 Ga0307416_100119248 3300032002 Bacteria 2346
179 Ga0307411_10199099 3300032005 Bacteria 1536
180 Ga0307411_10204428 3300032005 Bacteria 1520
181 Ga0373926_0018834 3300035083 Bacteria 2378
182 Ga0373934_0025026 3300035086 Bacteria 2309
183 Ga0373944_0004486 3300035089 Bacteria 3640
184 Ga0373923_0000495 3300035111 Bacteria 9476
185 Ga0373936_0031385 3300035113 Bacteria 2098
186 Ga0373945_0001152 3300035116 Bacteria 8017
187 Ga0373953_0001502 3300035117 Bacteria 6766
188 Ga0373954_0036398 3300035118 Bacteria 2284
189 Ga0373954_0093050 3300035118 Bacteria 1449
190 Ga0373956_0007806 3300035119 Bacteria 4316
191 Ga0373943_0000484 3300035170 Bacteria 17010
192 Ga0373946_0054325 3300035171 Bacteria 1685
193 Ga0373955_0136994 3300035172 Bacteria 1432
194 Ga0373931_0218966 3300035691 Bacteria 1145
195 Ga0373935_0004821 3300035692 Bacteria 7929
196 Ga0373935_0038632 3300035692 Bacteria 2989
197 Ga0373927_0042945 3300035695 Bacteria 2929
198 Ga0373933_0075572 3300035724 Bacteria 2056
199 Ga0373947_0000968 3300035725 Bacteria 17536
200 Ga0373937_0074688 3300036401 Bacteria 3129
201 Ga0373925_0003980 3300037068 Bacteria 11262
202 Ga0373925_0047699 3300037068 Bacteria 3189
203 Ga0395899_0026498 3300037312 Bacteria 4374
204 Ga0395899_0374234 3300037312 Bacteria 948
205 Ga0395905_0224055 3300037471 Bacteria 1759
206 Ga0395901_0257579 3300038443 Bacteria 1816
207 Ga0439447_011258 3300041407 Bacteria 2620
208 Ga0439441_003073 3300042001 Bacteria 2420
209 Ga0439443_022999 3300042003 Bacteria 993
210 Ga0439432_008232 3300042006 Bacteria 3666
211 Ga0439452_004739 3300042010 Bacteria 4501
212 Ga0450923_003375 3300042125 Bacteria 2405
213 Ga0439446_0002338 3300042156 Bacteria 4535
214 Ga0439460_0012900 3300042461 Bacteria 2177
215 Ga0451577_0000169 3300042876 Bacteria 144088
216 Ga0453683_0000217 3300044673 Bacteria 76362
217 Ga0453684_0000536 3300044712 Bacteria 144088
218 Ga0451576_0000215 3300045051 Bacteria 144088
219 Ga0451576_0006974 3300045051 Bacteria 13672
220 Ga0451576_0250895 3300045051 Bacteria 1849
221 Ga0451576_0309172 3300045051 Bacteria 1653
222 Ga0451576_0382969 3300045051 Bacteria 1474
223 Ga0495592_0092827 3300046454 Bacteria 2162
224 Ga0495629_0001312 3300046459 Bacteria 19557
225 Ga0495629_0024258 3300046459 Bacteria 4319
226 Ga0495641_0000109 3300046461 Bacteria 57910
227 Ga0495641_0025893 3300046461 Bacteria 2872
228 Ga0495651_0092071 3300046462 Bacteria 2271
229 Ga0495653_0012752 3300046463 Bacteria 6863
230 Ga0495653_0048552 3300046463 Bacteria 3275
231 Ga0495653_0073175 3300046463 Bacteria 2558
232 Ga0495580_0178511 3300046472 Bacteria 1466
233 Ga0495582_0000708 3300046473 Bacteria 18420
234 Ga0495639_0000937 3300046475 Bacteria 13192
235 Ga0495662_0003489 3300046476 Bacteria 7960
236 Ga0495662_0025763 3300046476 Bacteria 2840
237 Ga0495664_0005145 3300046477 Bacteria 7175
238 Ga0495594_0050949 3300046499 Bacteria 2278
239 Ga0495608_0009437 3300046511 Bacteria 6821
240 Ga0495608_0142993 3300046511 Bacteria 1526
241 Ga0495608_0190660 3300046511 Bacteria 1294
242 Ga0495618_0043394 3300046514 Bacteria 2837
243 Ga0495628_0031446 3300046516 Bacteria 4293
244 Ga0495628_0043898 3300046516 Bacteria 3558
245 Ga0495630_0001309 3300046517 Bacteria 17126
246 Ga0495630_0084481 3300046517 Bacteria 2396
247 Ga0495652_0007326 3300046529 Bacteria 10175
248 Ga0495652_0166363 3300046529 Bacteria 1706
249 Ga0495665_0000595 3300046531 Bacteria 18495
250 Ga0495640_0023413 3300046533 Bacteria 4499
251 Ga0495640_0038231 3300046533 Bacteria 3376
252 Ga0495586_0012666 3300046535 Bacteria 4472
253 Ga0495645_0001560 3300046543 Bacteria 15521
254 Ga0495645_0018251 3300046543 Bacteria 5037
255 Ga0495645_0139493 3300046543 Bacteria 1693
256 Ga0495667_0065852 3300046559 Bacteria 2369
257 Ga0495667_0087494 3300046559 Bacteria 2020
258 Ga0495634_0006807 3300046642 Bacteria 8651
259 Ga0495634_0024120 3300046642 Bacteria 4271
260 Ga0495635_0038127 3300046663 Bacteria 3327
261 Ga0495635_0048299 3300046663 Bacteria 2934
262 Ga0495657_0011703 3300046675 Bacteria 6544
263 Ga0495657_0121349 3300046675 Bacteria 1646
264 Ga0495599_0003895 3300046678 Bacteria 8780
265 Ga0495599_0024405 3300046678 Bacteria 3781
266 Ga0495599_0025694 3300046678 Bacteria 3688
267 Ga0495658_0002069 3300046683 Bacteria 10168
268 Ga0495658_0083130 3300046683 Bacteria 1882
269 Ga0495613_0001195 3300046689 Bacteria 19811
270 Ga0495624_0011644 3300046690 Bacteria 6041
271 Ga0495600_0004582 3300046809 Bacteria 8289
272 Ga0495600_0014825 3300046809 Bacteria 4916
273 Ga0495581_0000833 3300047315 Bacteria 16417
274 Ga0495604_0151029 3300047317 Bacteria 1650
275 Ga0495604_0331668 3300047317 Bacteria 1015
276 Ga0495674_0007068 3300047319 Bacteria 10736
277 Ga0495674_0026636 3300047319 Bacteria 5290
278 Ga0495674_0051241 3300047319 Bacteria 3639
279 Ga0495676_0000262 3300047321 Bacteria 42485
280 Ga0495680_0002800 3300047322 Bacteria 17559
281 Ga0495680_0005330 3300047322 Bacteria 12138
282 Ga0495680_0038674 3300047322 Bacteria 3811
283 Ga0495680_0263489 3300047322 Bacteria 1218
284 Ga0495675_0024425 3300047444 Bacteria 3852
285 Ga0495684_0001745 3300047471 Bacteria 17474
286 Ga0495684_0008277 3300047471 Bacteria 8053
287 Ga0495593_0002225 3300047673 Bacteria 11636
288 Ga0495614_0008025 3300048089 Bacteria 4692
289 Ga0496102_0008664 3300048905 Bacteria 8731
290 Ga0496105_0342992 3300048908 Bacteria 1194
291 Ga0496106_0371705 3300048909 Bacteria 1149
292 Ga0496109_0160102 3300048912 Bacteria 2109
293 Ga0496112_0050760 3300048915 Bacteria 4068
294 Ga0496112_0190246 3300048915 Bacteria 2014
295 Ga0496113_0323403 3300048916 Bacteria 1236
296 Ga0496114_0016455 3300048917 Bacteria 5961
297 Ga0501290_003558 3300049513 Bacteria 1964
298 Ga0501291_000216 3300049514 Bacteria 7325
299 Ga0501292_000178 3300049515 Bacteria 10334
300 Ga0501293_000753 3300049516 Bacteria 2438
301 Ga0501294_000106 3300049517 Bacteria 9383
302 Ga0501295_000068 3300049518 Bacteria 10359
303 Ga0501296_000921 3300049519 Bacteria 2900
304 Ga0501297_000349 3300049520 Bacteria 4362
305 Ga0501298_000215 3300049521 Bacteria 7362
306 Ga0501299_000133 3300049522 Bacteria 8365
307 Ga0501303_001152 3300049526 Bacteria 1970
308 Ga0501031_0018824 3300049568 Bacteria 4495
309 Ga0501031_0038159 3300049568 Bacteria 3135
310 Ga0501031_0045303 3300049568 Bacteria 2870
311 Ga0501031_0114714 3300049568 Bacteria 1760
312 Ga0501032_0001369 3300049569 Bacteria 19340
313 Ga0501032_0129255 3300049569 Bacteria 1667
314 Ga0501032_0172828 3300049569 Bacteria 1416
315 Ga0501033_0158022 3300049570 Bacteria 1633
316 Ga0501036_0035974 3300049572 Bacteria 4190
317 Ga0501036_0067348 3300049572 Bacteria 3029
318 Ga0501036_0095321 3300049572 Bacteria 2515
319 Ga0501036_0160988 3300049572 Bacteria 1892
320 Ga0501036_0233273 3300049572 Bacteria 1544
321 Ga0501037_0036292 3300049573 Bacteria 3633
322 Ga0501037_0343432 3300049573 Bacteria 1031
323 Ga0501038_0036971 3300049574 Bacteria 4283
324 Ga0501039_0000439 3300049575 Bacteria 30113
325 Ga0501039_0044971 3300049575 Bacteria 3410
326 Ga0501039_0065110 3300049575 Bacteria 2827
327 Ga0501039_0210494 3300049575 Bacteria 1529
328 Ga0501039_0291243 3300049575 Bacteria 1283
329 Ga0501040_0227427 3300049576 Bacteria 1328
330 Ga0501040_0302027 3300049576 Bacteria 1144
331 Ga0501041_0022234 3300049577 Bacteria 3797
332 Ga0501041_0321215 3300049577 Bacteria 976
333 Ga0501042_0028113 3300049578 Bacteria 3958
334 Ga0501042_0034770 3300049578 Bacteria 3574
335 Ga0501042_0047754 3300049578 Bacteria 3052
336 Ga0501046_0012725 3300049580 Bacteria 7155
337 Ga0501046_0017901 3300049580 Bacteria 5907
338 Ga0501046_0152096 3300049580 Bacteria 1745
339 Ga0501046_0165251 3300049580 Bacteria 1663
340 Ga0501048_0048527 3300049582 Bacteria 3028
341 Ga0501048_0062340 3300049582 Bacteria 2639
342 Ga0501048_0070866 3300049582 Bacteria 2461
343 Ga0501048_0074222 3300049582 Bacteria 2400
344 Ga0501068_0016822 3300049584 Bacteria 4221
345 Ga0501068_0020878 3300049584 Bacteria 3822
346 Ga0501071_0024251 3300049587 Bacteria 4241
347 Ga0501071_0277028 3300049587 Unclassified 1269
348 Ga0501072_0093713 3300049588 Bacteria 2385
349 Ga0501072_0147655 3300049588 Bacteria 1875
350 Ga0501072_0558791 3300049588 Bacteria 903
351 Ga0501074_0062349 3300049590 Bacteria 2685
352 Ga0501075_0024164 3300049591 Bacteria 4452
353 Ga0501076_0013042 3300049592 Bacteria 6223
354 Ga0501076_0032168 3300049592 Bacteria 4094
355 Ga0501076_0249476 3300049592 Unclassified 1452
356 Ga0501198_018614 3300049649 Unclassified 1088
357 Ga0501199_000353 3300049650 Bacteria 4072
358 Ga0501201_000457 3300049651 Bacteria 3775
359 Ga0501202_006310 3300049652 Bacteria 2118
360 Ga0501207_029127 3300049654 Unclassified 921
361 Ga0501209_015373 3300049656 Bacteria 1704
362 Ga0501217_004863 3300049661 Bacteria 2784
363 Ga0501223_003398 3300049663 Bacteria 3478
364 Ga0501228_000767 3300049666 Bacteria 2154
365 Ga0501230_002330 3300049667 Bacteria 2412
366 Ga0501233_001071 3300049668 Bacteria 4644
367 Ga0501235_000316 3300049669 Bacteria 9164
368 Ga0501236_005291 3300049670 Bacteria 1556
369 Ga0501239_000326 3300049672 Bacteria 3544
370 Ga0501240_004349 3300049673 Bacteria 1639
371 Ga0501248_003617 3300049678 Unclassified 1125
372 Ga0501249_000336 3300049679 Bacteria 12764
373 Ga0501251_000681 3300049681 Bacteria 3057
374 Ga0501253_031016 3300049683 Unclassified 1019
375 Ga0501255_004736 3300049684 Unclassified 1330
376 Ga0501257_006079 3300049686 Bacteria 2674
377 Ga0501258_000134 3300049687 Bacteria 4098
378 Ga0501260_000220 3300049689 Bacteria 4410
379 Ga0501261_000758 3300049690 Bacteria 4010
380 Ga0501219_000953 3300049703 Bacteria 3492
381 Ga0501221_002570 3300049704 Bacteria 2992
382 Ga0501225_0003041 3300049705 Bacteria 5125
383 Ga0501229_000092 3300049706 Bacteria 9222
384 Ga0501234_000312 3300049707 Bacteria 7092
385 Ga0501245_000594 3300049708 Bacteria 4437
386 Ga0501079_0058313 3300049741 Bacteria 2979
387 Ga0501079_0280277 3300049741 Bacteria 1303
388 Ga0501080_0022429 3300049742 Bacteria 5849
389 Ga0501080_0175549 3300049742 Bacteria 1974
390 Ga0501081_0058894 3300049743 Bacteria 2658
391 Ga0501081_0342872 3300049743 Bacteria 1100
392 Ga0501232_000258 3300049757 Bacteria 3264
393 Ga0501262_009996 3300049759 Unclassified 1181
394 Ga0501265_000991 3300049762 Bacteria 3194
395 Ga0501266_000067 3300049763 Bacteria 14803
396 Ga0501269_003681 3300049766 Bacteria 1849
397 Ga0501270_002541 3300049767 Bacteria 1880
398 Ga0501272_000120 3300049769 Bacteria 6174
399 Ga0501274_000152 3300049771 Bacteria 4346
400 Ga0501275_001659 3300049772 Bacteria 2132
401 Ga0501279_003631 3300049775 Bacteria 2014
402 Ga0501280_010479 3300049776 Unclassified 1293
403 Ga0501282_000720 3300049778 Bacteria 3806
404 Ga0501283_000032 3300049779 Bacteria 16291
405 Ga0501035_0046697 3300049822 Bacteria 3895
406 Ga0501035_0122654 3300049822 Bacteria 2270
407 Ga0501045_0036736 3300049824 Bacteria 3558
408 Ga0501045_0115700 3300049824 Bacteria 1989
409 Ga0501045_0232607 3300049824 Bacteria 1372
410 Ga0501212_000363 3300049851 Bacteria 4266
411 Ga0501226_000251 3300049853 Bacteria 8223
412 nmdc:mga05p37_222548_c1 3300050507 Bacteria 2277
413 nmdc:mga05p37_4495_c1 3300050507 Bacteria 16304
414 nmdc:mga05p37_591253_c1 3300050507 Bacteria 1255
415 nmdc:mga09592_38496_c1 3300050508 Bacteria 4015
416 nmdc:mga09592_61523_c1 3300050508 Bacteria 3176
417 nmdc:mga0qj67_13617_c1 3300050509 Bacteria 6136
418 nmdc:mga0qj67_17052_c1 3300050509 Bacteria 5518
419 nmdc:mga06r32_70763_c1 3300050510 Bacteria 3375
420 nmdc:mga08y16_80793_c1 3300050511 Bacteria 3390
421 nmdc:mga0n895_343071_c1 3300050512 Bacteria 1513
422 nmdc:mga0n895_46247_c1 3300050512 Bacteria 4251
423 nmdc:mga0rr50_235947_c1 3300050513 Bacteria 1515
424 nmdc:mga0rr50_67437_c1 3300050513 Bacteria 2718
425 nmdc:mga08x19_174357_c1 3300050514 Bacteria 1466
426 nmdc:mga0a205_330180_c1 3300050515 Bacteria 1395
427 nmdc:mga0a205_7737_c1 3300050515 Bacteria 9756
428 Ga0495601_0037851 3300053077 Bacteria 3015
429 Ga0495601_0337089 3300053077 Bacteria 981
430 Ga0495612_0042323 3300053078 Bacteria 1859
431 Ga0495595_0001011 3300053084 Bacteria 10826
432 Ga0495595_0005771 3300053084 Bacteria 5012
433 Ga0495595_0061009 3300053084 Bacteria 1766
434 Ga0495619_0003348 3300053085 Bacteria 10363
435 Ga0495619_0016239 3300053085 Bacteria 4712
436 Ga0495619_0224753 3300053085 Bacteria 1300
437 Ga0501084_0039584 3300054114 Bacteria 3943
438 Ga0501084_0049567 3300054114 Bacteria 3515
439 Ga0501084_0389381 3300054114 Bacteria 1178
440 Ga0590075_004616 3300059424 Bacteria 3261
441 Ga0590077_039182 3300059426 Bacteria 1050
442 Ga0501082_0127296 3300060353 Bacteria 2209
443 Ga0530510_0209722 3300061734 Bacteria 1447

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_0257579 Ga0395901_0257579_787_1557 237
2 3300006175 Ga0070712_100455549 Ga0070712_1004555491 243
3 3300037312 Ga0395899_0026498 Ga0395899_0026498_1055_1879 246
4 3300037471 Ga0395905_0224055 Ga0395905_0224055_135_959 246
5 3300005439 Ga0070711_100006865 Ga0070711_1000068658 252
6 3300025916 Ga0207663_10001415 Ga0207663_1000141516 252
7 3300049588 Ga0501072_0147655 Ga0501072_0147655_248_1051 252
8 3300037312 Ga0395899_0374234 Ga0395899_0374234_151_915 253
9 3300049584 Ga0501068_0016822 Ga0501068_0016822_268_1071 254
10 3300006852 Ga0075433_10238098 Ga0075433_102380982 256
11 3300050515 nmdc:mga0a205_330180_c1 nmdc:mga0a205_330180_c1_269_1072 256
12 3300035089 Ga0373944_0004486 Ga0373944_0004486_863_1693 257
13 3300035116 Ga0373945_0001152 Ga0373945_0001152_5155_5985 257
14 3300035118 Ga0373954_0093050 Ga0373954_0093050_607_1437 257
15 3300035170 Ga0373943_0000484 Ga0373943_0000484_14151_14981 257
16 3300035171 Ga0373946_0054325 Ga0373946_0054325_20_850 257
17 3300035692 Ga0373935_0004821 Ga0373935_0004821_3491_4321 257
18 3300035725 Ga0373947_0000968 Ga0373947_0000968_13920_14750 257
19 3300037068 Ga0373925_0003980 Ga0373925_0003980_9335_10165 257
20 3300046459 Ga0495629_0001312 Ga0495629_0001312_9996_10826 257
21 3300046461 Ga0495641_0000109 Ga0495641_0000109_31146_31976 257
22 3300046463 Ga0495653_0073175 Ga0495653_0073175_337_1167 257
23 3300046473 Ga0495582_0000708 Ga0495582_0000708_3049_3879 257
24 3300046475 Ga0495639_0000937 Ga0495639_0000937_9315_10145 257
25 3300046476 Ga0495662_0003489 Ga0495662_0003489_4226_5056 257
26 3300046499 Ga0495594_0050949 Ga0495594_0050949_973_1803 257
27 3300046517 Ga0495630_0084481 Ga0495630_0084481_1167_1997 257
28 3300046531 Ga0495665_0000595 Ga0495665_0000595_5865_6695 257
29 3300046559 Ga0495667_0087494 Ga0495667_0087494_279_1109 257
30 3300046642 Ga0495634_0006807 Ga0495634_0006807_7532_8362 257
31 3300046663 Ga0495635_0048299 Ga0495635_0048299_1065_1895 257
32 3300046683 Ga0495658_0002069 Ga0495658_0002069_2670_3500 257
33 3300046689 Ga0495613_0001195 Ga0495613_0001195_12926_13756 257
34 3300046690 Ga0495624_0011644 Ga0495624_0011644_4911_5741 257
35 3300047315 Ga0495581_0000833 Ga0495581_0000833_3049_3879 257
36 3300047319 Ga0495674_0007068 Ga0495674_0007068_9877_10707 257
37 3300047321 Ga0495676_0000262 Ga0495676_0000262_31247_32077 257
38 3300047322 Ga0495680_0005330 Ga0495680_0005330_7115_7945 257
39 3300047471 Ga0495684_0008277 Ga0495684_0008277_340_1170 257
40 3300047673 Ga0495593_0002225 Ga0495593_0002225_7531_8361 257
41 3300048089 Ga0495614_0008025 Ga0495614_0008025_3311_4141 257
42 3300048915 Ga0496112_0050760 Ga0496112_0050760_2461_3282 257
43 3300050513 nmdc:mga0rr50_235947_c1 nmdc:mga0rr50_235947_c1_700_1473 257
44 3300053085 Ga0495619_0016239 Ga0495619_0016239_2921_3751 257
45 3300046463 Ga0495653_0012752 Ga0495653_0012752_5413_6243 259
46 3300046511 Ga0495608_0009437 Ga0495608_0009437_5228_6058 259
47 3300046514 Ga0495618_0043394 Ga0495618_0043394_210_1040 259
48 3300046529 Ga0495652_0166363 Ga0495652_0166363_340_1170 259
49 3300046533 Ga0495640_0023413 Ga0495640_0023413_737_1567 259
50 3300046642 Ga0495634_0024120 Ga0495634_0024120_2585_3406 259
51 3300046663 Ga0495635_0038127 Ga0495635_0038127_1047_1877 259
52 3300046675 Ga0495657_0121349 Ga0495657_0121349_668_1498 259
53 3300046809 Ga0495600_0004582 Ga0495600_0004582_3944_4774 259
54 3300047317 Ga0495604_0151029 Ga0495604_0151029_707_1537 259
55 3300047322 Ga0495680_0002800 Ga0495680_0002800_8341_9171 259
56 3300047471 Ga0495684_0001745 Ga0495684_0001745_8443_9273 259
57 3300053084 Ga0495595_0001011 Ga0495595_0001011_3836_4666 259
58 3300053085 Ga0495619_0003348 Ga0495619_0003348_1127_1957 259
59 3300005329 Ga0070683_100754600 Ga0070683_1007546001 263
60 3300049575 Ga0501039_0065110 Ga0501039_0065110_538_1329 263
61 3300049576 Ga0501040_0302027 Ga0501040_0302027_255_1046 263
62 3300049578 Ga0501042_0047754 Ga0501042_0047754_1409_2200 263
63 3300049582 Ga0501048_0062340 Ga0501048_0062340_758_1549 263
64 3300049592 Ga0501076_0013042 Ga0501076_0013042_5061_5852 263
65 3300054114 Ga0501084_0389381 Ga0501084_0389381_53_844 263
66 3300005981 Ga0081538_10005239 Ga0081538_100052397 264
67 3300005337 Ga0070682_100256885 Ga0070682_1002568852 266
68 3300005339 Ga0070660_100030799 Ga0070660_1000307992 266
69 3300005367 Ga0070667_100021252 Ga0070667_1000212523 266
70 3300005458 Ga0070681_10041439 Ga0070681_100414393 266
71 3300005530 Ga0070679_100073142 Ga0070679_1000731423 266
72 3300005548 Ga0070665_100668690 Ga0070665_1006686902 266
73 3300005618 Ga0068864_100378346 Ga0068864_1003783462 266
74 3300009098 Ga0105245_10829275 Ga0105245_108292751 266
75 3300009148 Ga0105243_10454382 Ga0105243_104543822 266
76 3300009174 Ga0105241_10332447 Ga0105241_103324471 266
77 3300009553 Ga0105249_10127318 Ga0105249_101273184 266
78 3300013100 Ga0157373_10319055 Ga0157373_103190551 266
79 3300013297 Ga0157378_10289260 Ga0157378_102892602 266
80 3300013308 Ga0157375_10657733 Ga0157375_106577331 266
81 3300025912 Ga0207707_10257224 Ga0207707_102572242 266
82 3300025919 Ga0207657_10007300 Ga0207657_1000730010 266
83 3300025921 Ga0207652_10234487 Ga0207652_102344872 266
84 3300025986 Ga0207658_10013627 Ga0207658_100136273 266
85 3300026088 Ga0207641_10114416 Ga0207641_101144164 266
86 3300026095 Ga0207676_10128226 Ga0207676_101282262 266
87 3300028800 Ga0265338_10044884 Ga0265338_100448843 266
88 3300028800 Ga0265338_10050440 Ga0265338_100504403 266
89 3300028800 Ga0265338_10095567 Ga0265338_100955672 266
90 3300031090 Ga0265760_10007478 Ga0265760_100074783 266
91 3300031852 Ga0307410_10121903 Ga0307410_101219032 266
92 3300032005 Ga0307411_10204428 Ga0307411_102044281 266
93 3300042876 Ga0451577_0000169 Ga0451577_0000169_86090_86950 266
94 3300044673 Ga0453683_0000217 Ga0453683_0000217_39058_39918 266
95 3300044712 Ga0453684_0000536 Ga0453684_0000536_86090_86950 266
96 3300045051 Ga0451576_0000215 Ga0451576_0000215_57139_57999 266
97 3300046477 Ga0495664_0005145 Ga0495664_0005145_819_1649 266
98 3300046543 Ga0495645_0018251 Ga0495645_0018251_4095_4925 266
99 3300046678 Ga0495599_0024405 Ga0495599_0024405_1996_2826 266
100 3300047317 Ga0495604_0331668 Ga0495604_0331668_59_889 266
101 3300047319 Ga0495674_0051241 Ga0495674_0051241_2617_3447 266
102 3300047322 Ga0495680_0038674 Ga0495680_0038674_628_1431 266
103 3300047322 Ga0495680_0263489 Ga0495680_0263489_89_892 266
104 3300048905 Ga0496102_0008664 Ga0496102_0008664_7162_7983 266
105 3300048908 Ga0496105_0342992 Ga0496105_0342992_348_1151 266
106 3300048912 Ga0496109_0160102 Ga0496109_0160102_995_1798 266
107 3300048915 Ga0496112_0190246 Ga0496112_0190246_992_1813 266
108 3300048916 Ga0496113_0323403 Ga0496113_0323403_161_982 266
109 3300048917 Ga0496114_0016455 Ga0496114_0016455_5008_5823 266
110 3300049568 Ga0501031_0045303 Ga0501031_0045303_618_1430 266
111 3300049572 Ga0501036_0095321 Ga0501036_0095321_851_1663 266
112 3300049575 Ga0501039_0044971 Ga0501039_0044971_1975_2787 266
113 3300049576 Ga0501040_0227427 Ga0501040_0227427_406_1209 266
114 3300049577 Ga0501041_0321215 Ga0501041_0321215_51_863 266
115 3300049580 Ga0501046_0165251 Ga0501046_0165251_78_890 266
116 3300049582 Ga0501048_0048527 Ga0501048_0048527_356_1168 266
117 3300049588 Ga0501072_0093713 Ga0501072_0093713_696_1508 266
118 3300049591 Ga0501075_0024164 Ga0501075_0024164_1781_2593 266
119 3300049592 Ga0501076_0032168 Ga0501076_0032168_2642_3454 266
120 3300049741 Ga0501079_0058313 Ga0501079_0058313_240_1052 266
121 3300049742 Ga0501080_0175549 Ga0501080_0175549_364_1176 266
122 3300049743 Ga0501081_0342872 Ga0501081_0342872_193_996 266
123 3300049824 Ga0501045_0036736 Ga0501045_0036736_1773_2585 266
124 3300049824 Ga0501045_0232607 Ga0501045_0232607_465_1268 266
125 3300053077 Ga0495601_0337089 Ga0495601_0337089_67_870 266
126 3300053078 Ga0495612_0042323 Ga0495612_0042323_680_1510 266
127 3300053084 Ga0495595_0061009 Ga0495595_0061009_291_1094 266
128 3300054114 Ga0501084_0039584 Ga0501084_0039584_2461_3264 266
129 3300005937 Ga0081455_10001204 Ga0081455_1000120428 267
130 3300049667 Ga0501230_002330 Ga0501230_002330_13_816 267
131 3300025981 Ga0207640_10180375 Ga0207640_101803752 268
132 3300036401 Ga0373937_0074688 Ga0373937_0074688_859_1743 268
133 3300046511 Ga0495608_0190660 Ga0495608_0190660_226_1110 268
134 3300046678 Ga0495599_0025694 Ga0495599_0025694_2078_2962 268
135 3300031691 Ga0316579_10023425 Ga0316579_100234253 269
136 3300035083 Ga0373926_0018834 Ga0373926_0018834_386_1291 270
137 3300035086 Ga0373934_0025026 Ga0373934_0025026_713_1618 270
138 3300035111 Ga0373923_0000495 Ga0373923_0000495_4074_4979 270
139 3300035113 Ga0373936_0031385 Ga0373936_0031385_592_1497 270
140 3300035117 Ga0373953_0001502 Ga0373953_0001502_4703_5608 270
141 3300035118 Ga0373954_0036398 Ga0373954_0036398_180_1085 270
142 3300035119 Ga0373956_0007806 Ga0373956_0007806_1597_2502 270
143 3300035172 Ga0373955_0136994 Ga0373955_0136994_274_1179 270
144 3300035692 Ga0373935_0038632 Ga0373935_0038632_1428_2333 270
145 3300035695 Ga0373927_0042945 Ga0373927_0042945_561_1466 270
146 3300035724 Ga0373933_0075572 Ga0373933_0075572_659_1564 270
147 3300037068 Ga0373925_0047699 Ga0373925_0047699_1783_2688 270
148 3300046454 Ga0495592_0092827 Ga0495592_0092827_1186_2091 270
149 3300046459 Ga0495629_0024258 Ga0495629_0024258_425_1330 270
150 3300046461 Ga0495641_0025893 Ga0495641_0025893_650_1555 270
151 3300046462 Ga0495651_0092071 Ga0495651_0092071_662_1567 270
152 3300046463 Ga0495653_0048552 Ga0495653_0048552_1953_2858 270
153 3300046472 Ga0495580_0178511 Ga0495580_0178511_179_1087 270
154 3300046476 Ga0495662_0025763 Ga0495662_0025763_1030_1935 270
155 3300046511 Ga0495608_0142993 Ga0495608_0142993_348_1253 270
156 3300046516 Ga0495628_0031446 Ga0495628_0031446_2428_3336 270
157 3300046516 Ga0495628_0043898 Ga0495628_0043898_159_1067 270
158 3300046517 Ga0495630_0001309 Ga0495630_0001309_14399_15304 270
159 3300046529 Ga0495652_0007326 Ga0495652_0007326_3688_4596 270
160 3300046533 Ga0495640_0038231 Ga0495640_0038231_2092_2997 270
161 3300046535 Ga0495586_0012666 Ga0495586_0012666_2919_3824 270
162 3300046543 Ga0495645_0001560 Ga0495645_0001560_4962_5870 270
163 3300046543 Ga0495645_0139493 Ga0495645_0139493_498_1406 270
164 3300046559 Ga0495667_0065852 Ga0495667_0065852_593_1498 270
165 3300046675 Ga0495657_0011703 Ga0495657_0011703_1634_2539 270
166 3300046678 Ga0495599_0003895 Ga0495599_0003895_4535_5443 270
167 3300046683 Ga0495658_0083130 Ga0495658_0083130_704_1609 270
168 3300046809 Ga0495600_0014825 Ga0495600_0014825_1073_1978 270
169 3300047319 Ga0495674_0026636 Ga0495674_0026636_3126_4031 270
170 3300047444 Ga0495675_0024425 Ga0495675_0024425_1619_2527 270
171 3300053077 Ga0495601_0037851 Ga0495601_0037851_1360_2268 270
172 3300053084 Ga0495595_0005771 Ga0495595_0005771_2939_3844 270
173 3300053085 Ga0495619_0224753 Ga0495619_0224753_13_921 270
174 2162886007 SwRhRL2b_contig_3732914 SwRhRL2b_0288.00002460 272
175 3300005289 Ga0065704_10115513 Ga0065704_101155132 272
176 3300005290 Ga0065712_10013967 Ga0065712_100139672 272
177 3300005293 Ga0065715_10007207 Ga0065715_100072072 272
178 3300005295 Ga0065707_10116188 Ga0065707_101161882 272
179 3300005327 Ga0070658_10212320 Ga0070658_102123202 272
180 3300005329 Ga0070683_100105245 Ga0070683_1001052452 272
181 3300005330 Ga0070690_100000609 Ga0070690_1000006099 272
182 3300005330 Ga0070690_100052610 Ga0070690_1000526103 272
183 3300005331 Ga0070670_100067076 Ga0070670_1000670762 272
184 3300005334 Ga0068869_100018641 Ga0068869_1000186416 272
185 3300005336 Ga0070680_100050583 Ga0070680_1000505832 272
186 3300005337 Ga0070682_100021642 Ga0070682_1000216423 272
187 3300005339 Ga0070660_100006010 Ga0070660_1000060107 272
188 3300005340 Ga0070689_100028769 Ga0070689_1000287692 272
189 3300005341 Ga0070691_10032795 Ga0070691_100327952 272
190 3300005343 Ga0070687_100215461 Ga0070687_1002154611 272
191 3300005345 Ga0070692_10038634 Ga0070692_100386342 272
192 3300005347 Ga0070668_100024482 Ga0070668_1000244823 272
193 3300005353 Ga0070669_100007933 Ga0070669_1000079333 272
194 3300005354 Ga0070675_100036319 Ga0070675_1000363194 272
195 3300005356 Ga0070674_100007966 Ga0070674_1000079664 272
196 3300005364 Ga0070673_100005271 Ga0070673_1000052718 272
197 3300005366 Ga0070659_100008586 Ga0070659_1000085866 272
198 3300005367 Ga0070667_100012950 Ga0070667_1000129506 272
199 3300005438 Ga0070701_10065346 Ga0070701_100653462 272
200 3300005441 Ga0070700_100005956 Ga0070700_1000059566 272
201 3300005444 Ga0070694_100072087 Ga0070694_1000720874 272
202 3300005457 Ga0070662_100013181 Ga0070662_1000131818 272
203 3300005458 Ga0070681_10084789 Ga0070681_100847894 272
204 3300005458 Ga0070681_10346182 Ga0070681_103461821 272
205 3300005459 Ga0068867_100001017 Ga0068867_10000101712 272
206 3300005468 Ga0070707_100035234 Ga0070707_1000352346 272
207 3300005471 Ga0070698_100390446 Ga0070698_1003904462 272
208 3300005530 Ga0070679_100003296 Ga0070679_1000032965 272
209 3300005535 Ga0070684_100151770 Ga0070684_1001517702 272
210 3300005544 Ga0070686_100009830 Ga0070686_1000098304 272
211 3300005545 Ga0070695_100007372 Ga0070695_1000073727 272
212 3300005546 Ga0070696_100037509 Ga0070696_1000375093 272
213 3300005546 Ga0070696_100042874 Ga0070696_1000428743 272
214 3300005546 Ga0070696_100065528 Ga0070696_1000655282 272
215 3300005549 Ga0070704_100050251 Ga0070704_1000502513 272
216 3300005564 Ga0070664_100014327 Ga0070664_1000143273 272
217 3300005564 Ga0070664_100080457 Ga0070664_1000804572 272
218 3300005577 Ga0068857_100086631 Ga0068857_1000866311 272
219 3300005578 Ga0068854_100052378 Ga0068854_1000523782 272
220 3300005615 Ga0070702_100037880 Ga0070702_1000378801 272
221 3300005718 Ga0068866_10008164 Ga0068866_100081642 272
222 3300005719 Ga0068861_100025086 Ga0068861_1000250861 272
223 3300005840 Ga0068870_10028128 Ga0068870_100281282 272
224 3300005843 Ga0068860_100103032 Ga0068860_1001030323 272
225 3300005844 Ga0068862_100049164 Ga0068862_1000491642 272
226 3300006058 Ga0075432_10006642 Ga0075432_100066422 272
227 3300006163 Ga0070715_10061369 Ga0070715_100613692 272
228 3300006173 Ga0070716_100046363 Ga0070716_1000463632 272
229 3300006844 Ga0075428_100051084 Ga0075428_1000510843 272
230 3300006846 Ga0075430_100014898 Ga0075430_1000148985 272
231 3300006846 Ga0075430_100038279 Ga0075430_1000382792 272
232 3300006847 Ga0075431_100059596 Ga0075431_1000595966 272
233 3300006852 Ga0075433_10017648 Ga0075433_100176482 272
234 3300006852 Ga0075433_10333380 Ga0075433_103333801 272
235 3300006871 Ga0075434_100035012 Ga0075434_1000350126 272
236 3300006880 Ga0075429_100083023 Ga0075429_1000830235 272
237 3300006914 Ga0075436_100211871 Ga0075436_1002118712 272
238 3300007076 Ga0075435_100110448 Ga0075435_1001104481 272
239 3300007076 Ga0075435_100188210 Ga0075435_1001882102 272
240 3300009098 Ga0105245_10003636 Ga0105245_100036367 272
241 3300009147 Ga0114129_10008800 Ga0114129_1000880012 272
242 3300009147 Ga0114129_10201448 Ga0114129_102014481 272
243 3300009148 Ga0105243_10077595 Ga0105243_100775951 272
244 3300009176 Ga0105242_10014583 Ga0105242_100145836 272
245 3300009553 Ga0105249_10027186 Ga0105249_100271863 272
246 3300010375 Ga0105239_10081339 Ga0105239_100813393 272
247 3300011119 Ga0105246_10006386 Ga0105246_100063865 272
248 3300013102 Ga0157371_10139986 Ga0157371_101399861 272
249 3300013296 Ga0157374_10018504 Ga0157374_100185045 272
250 3300013297 Ga0157378_10021293 Ga0157378_100212931 272
251 3300013308 Ga0157375_10126046 Ga0157375_101260461 272
252 3300014968 Ga0157379_10281718 Ga0157379_102817182 272
253 3300014969 Ga0157376_10033098 Ga0157376_100330982 272
254 3300025315 Ga0207697_10024484 Ga0207697_100244841 272
255 3300025899 Ga0207642_10017616 Ga0207642_100176161 272
256 3300025901 Ga0207688_10017885 Ga0207688_100178852 272
257 3300025907 Ga0207645_10000123 Ga0207645_1000012339 272
258 3300025908 Ga0207643_10024293 Ga0207643_100242934 272
259 3300025912 Ga0207707_10033503 Ga0207707_100335035 272
260 3300025917 Ga0207660_10019697 Ga0207660_100196975 272
261 3300025918 Ga0207662_10116084 Ga0207662_101160841 272
262 3300025919 Ga0207657_10003921 Ga0207657_100039217 272
263 3300025921 Ga0207652_10029500 Ga0207652_100295004 272
264 3300025921 Ga0207652_10064703 Ga0207652_100647033 272
265 3300025922 Ga0207646_10026570 Ga0207646_100265703 272
266 3300025923 Ga0207681_10222318 Ga0207681_102223181 272
267 3300025926 Ga0207659_10676002 Ga0207659_106760021 272
268 3300025932 Ga0207690_10026396 Ga0207690_100263965 272
269 3300025933 Ga0207706_10000387 Ga0207706_100003878 272
270 3300025934 Ga0207686_10038986 Ga0207686_100389863 272
271 3300025934 Ga0207686_10316390 Ga0207686_103163901 272
272 3300025935 Ga0207709_10205523 Ga0207709_102055232 272
273 3300025936 Ga0207670_10031187 Ga0207670_100311873 272
274 3300025937 Ga0207669_10003289 Ga0207669_100032893 272
275 3300025938 Ga0207704_10203430 Ga0207704_102034301 272
276 3300025939 Ga0207665_10033979 Ga0207665_100339791 272
277 3300025939 Ga0207665_10134393 Ga0207665_101343932 272
278 3300025940 Ga0207691_10007080 Ga0207691_100070806 272
279 3300025940 Ga0207691_10192625 Ga0207691_101926251 272
280 3300025942 Ga0207689_10054939 Ga0207689_100549391 272
281 3300025944 Ga0207661_10091406 Ga0207661_100914063 272
282 3300025945 Ga0207679_10023500 Ga0207679_100235002 272
283 3300025960 Ga0207651_10201466 Ga0207651_102014662 272
284 3300026067 Ga0207678_10092192 Ga0207678_100921923 272
285 3300026075 Ga0207708_10001364 Ga0207708_100013644 272
286 3300026089 Ga0207648_10000087 Ga0207648_100000877 272
287 3300026095 Ga0207676_10185683 Ga0207676_101856832 272
288 3300026116 Ga0207674_10039236 Ga0207674_100392361 272
289 3300026118 Ga0207675_100321376 Ga0207675_1003213761 272
290 3300026121 Ga0207683_10001528 Ga0207683_1000152819 272
291 3300026121 Ga0207683_10078561 Ga0207683_100785611 272
292 3300027360 Ga0209969_1000039 Ga0209969_10000392 272
293 3300027364 Ga0209967_1000192 Ga0209967_10001928 272
294 3300027364 Ga0209967_1014791 Ga0209967_10147911 272
295 3300027378 Ga0209981_1000154 Ga0209981_10001549 272
296 3300027424 Ga0209984_1000071 Ga0209984_100007111 272
297 3300027462 Ga0210000_1000071 Ga0210000_10000711 272
298 3300027471 Ga0209995_1000005 Ga0209995_10000052 272
299 3300027526 Ga0209968_1000022 Ga0209968_10000227 272
300 3300027526 Ga0209968_1004939 Ga0209968_10049392 272
301 3300027552 Ga0209982_1000475 Ga0209982_10004752 272
302 3300027614 Ga0209970_1001324 Ga0209970_10013245 272
303 3300027614 Ga0209970_1004909 Ga0209970_10049092 272
304 3300027617 Ga0210002_1000018 Ga0210002_10000185 272
305 3300027617 Ga0210002_1001593 Ga0210002_10015932 272
306 3300027665 Ga0209983_1001591 Ga0209983_10015916 272
307 3300027665 Ga0209983_1007752 Ga0209983_10077521 272
308 3300027682 Ga0209971_1001133 Ga0209971_10011337 272
309 3300027695 Ga0209966_1000079 Ga0209966_10000791 272
310 3300027717 Ga0209998_10000111 Ga0209998_1000011129 272
311 3300027876 Ga0209974_10000025 Ga0209974_100000251 272
312 3300027876 Ga0209974_10000109 Ga0209974_1000010919 272
313 3300027907 Ga0207428_10000302 Ga0207428_1000030256 272
314 3300028379 Ga0268266_10092554 Ga0268266_100925541 272
315 3300028381 Ga0268264_10296193 Ga0268264_102961931 272
316 3300031911 Ga0307412_10121438 Ga0307412_101214382 272
317 3300032002 Ga0307416_100119248 Ga0307416_1001192483 272
318 3300032005 Ga0307411_10199099 Ga0307411_101990991 272
319 3300035691 Ga0373931_0218966 Ga0373931_0218966_268_1086 272
320 3300041407 Ga0439447_011258 Ga0439447_011258_832_1650 272
321 3300042001 Ga0439441_003073 Ga0439441_003073_989_1807 272
322 3300042003 Ga0439443_022999 Ga0439443_022999_92_910 272
323 3300042006 Ga0439432_008232 Ga0439432_008232_2532_3350 272
324 3300042010 Ga0439452_004739 Ga0439452_004739_733_1551 272
325 3300042125 Ga0450923_003375 Ga0450923_003375_886_1704 272
326 3300042156 Ga0439446_0002338 Ga0439446_0002338_3698_4516 272
327 3300042461 Ga0439460_0012900 Ga0439460_0012900_266_1084 272
328 3300045051 Ga0451576_0006974 Ga0451576_0006974_1482_2300 272
329 3300045051 Ga0451576_0250895 Ga0451576_0250895_637_1455 272
330 3300045051 Ga0451576_0309172 Ga0451576_0309172_767_1585 272
331 3300045051 Ga0451576_0382969 Ga0451576_0382969_405_1223 272
332 3300048909 Ga0496106_0371705 Ga0496106_0371705_267_1085 272
333 3300049513 Ga0501290_003558 Ga0501290_003558_1106_1924 272
334 3300049514 Ga0501291_000216 Ga0501291_000216_4552_5370 272
335 3300049515 Ga0501292_000178 Ga0501292_000178_8805_9623 272
336 3300049516 Ga0501293_000753 Ga0501293_000753_928_1746 272
337 3300049517 Ga0501294_000106 Ga0501294_000106_1831_2649 272
338 3300049518 Ga0501295_000068 Ga0501295_000068_4011_4829 272
339 3300049519 Ga0501296_000921 Ga0501296_000921_2030_2848 272
340 3300049520 Ga0501297_000349 Ga0501297_000349_655_1473 272
341 3300049521 Ga0501298_000215 Ga0501298_000215_6521_7339 272
342 3300049522 Ga0501299_000133 Ga0501299_000133_7496_8314 272
343 3300049526 Ga0501303_001152 Ga0501303_001152_1080_1898 272
344 3300049568 Ga0501031_0018824 Ga0501031_0018824_3034_3852 272
345 3300049568 Ga0501031_0038159 Ga0501031_0038159_1056_1874 272
346 3300049568 Ga0501031_0114714 Ga0501031_0114714_770_1588 272
347 3300049569 Ga0501032_0001369 Ga0501032_0001369_4589_5407 272
348 3300049569 Ga0501032_0129255 Ga0501032_0129255_356_1174 272
349 3300049569 Ga0501032_0172828 Ga0501032_0172828_29_847 272
350 3300049570 Ga0501033_0158022 Ga0501033_0158022_525_1343 272
351 3300049572 Ga0501036_0035974 Ga0501036_0035974_3196_4014 272
352 3300049572 Ga0501036_0067348 Ga0501036_0067348_985_1803 272
353 3300049572 Ga0501036_0160988 Ga0501036_0160988_374_1192 272
354 3300049572 Ga0501036_0233273 Ga0501036_0233273_258_1076 272
355 3300049573 Ga0501037_0036292 Ga0501037_0036292_949_1767 272
356 3300049573 Ga0501037_0343432 Ga0501037_0343432_135_953 272
357 3300049574 Ga0501038_0036971 Ga0501038_0036971_3387_4205 272
358 3300049575 Ga0501039_0000439 Ga0501039_0000439_5771_6589 272
359 3300049575 Ga0501039_0210494 Ga0501039_0210494_197_1015 272
360 3300049575 Ga0501039_0291243 Ga0501039_0291243_254_1072 272
361 3300049577 Ga0501041_0022234 Ga0501041_0022234_2031_2849 272
362 3300049578 Ga0501042_0028113 Ga0501042_0028113_2332_3150 272
363 3300049578 Ga0501042_0034770 Ga0501042_0034770_2310_3128 272
364 3300049580 Ga0501046_0012725 Ga0501046_0012725_2642_3460 272
365 3300049580 Ga0501046_0017901 Ga0501046_0017901_2310_3128 272
366 3300049580 Ga0501046_0152096 Ga0501046_0152096_309_1127 272
367 3300049582 Ga0501048_0070866 Ga0501048_0070866_1436_2254 272
368 3300049582 Ga0501048_0074222 Ga0501048_0074222_1102_1920 272
369 3300049584 Ga0501068_0020878 Ga0501068_0020878_632_1450 272
370 3300049587 Ga0501071_0024251 Ga0501071_0024251_689_1507 272
371 3300049587 Ga0501071_0277028 Ga0501071_0277028_31_849 272
372 3300049588 Ga0501072_0558791 Ga0501072_0558791_64_882 272
373 3300049590 Ga0501074_0062349 Ga0501074_0062349_724_1542 272
374 3300049592 Ga0501076_0249476 Ga0501076_0249476_427_1245 272
375 3300049649 Ga0501198_018614 Ga0501198_018614_53_871 272
376 3300049650 Ga0501199_000353 Ga0501199_000353_191_1009 272
377 3300049651 Ga0501201_000457 Ga0501201_000457_800_1618 272
378 3300049652 Ga0501202_006310 Ga0501202_006310_842_1660 272
379 3300049654 Ga0501207_029127 Ga0501207_029127_21_839 272
380 3300049656 Ga0501209_015373 Ga0501209_015373_203_1021 272
381 3300049661 Ga0501217_004863 Ga0501217_004863_1278_2096 272
382 3300049663 Ga0501223_003398 Ga0501223_003398_1726_2544 272
383 3300049666 Ga0501228_000767 Ga0501228_000767_651_1469 272
384 3300049668 Ga0501233_001071 Ga0501233_001071_2602_3420 272
385 3300049669 Ga0501235_000316 Ga0501235_000316_5484_6302 272
386 3300049670 Ga0501236_005291 Ga0501236_005291_66_884 272
387 3300049672 Ga0501239_000326 Ga0501239_000326_75_893 272
388 3300049673 Ga0501240_004349 Ga0501240_004349_348_1166 272
389 3300049678 Ga0501248_003617 Ga0501248_003617_173_991 272
390 3300049679 Ga0501249_000336 Ga0501249_000336_6876_7694 272
391 3300049681 Ga0501251_000681 Ga0501251_000681_2061_2879 272
392 3300049683 Ga0501253_031016 Ga0501253_031016_179_997 272
393 3300049684 Ga0501255_004736 Ga0501255_004736_94_912 272
394 3300049686 Ga0501257_006079 Ga0501257_006079_354_1172 272
395 3300049687 Ga0501258_000134 Ga0501258_000134_2408_3226 272
396 3300049689 Ga0501260_000220 Ga0501260_000220_21_839 272
397 3300049690 Ga0501261_000758 Ga0501261_000758_2875_3693 272
398 3300049703 Ga0501219_000953 Ga0501219_000953_442_1260 272
399 3300049704 Ga0501221_002570 Ga0501221_002570_1375_2193 272
400 3300049705 Ga0501225_0003041 Ga0501225_0003041_709_1527 272
401 3300049706 Ga0501229_000092 Ga0501229_000092_1491_2309 272
402 3300049707 Ga0501234_000312 Ga0501234_000312_3274_4092 272
403 3300049708 Ga0501245_000594 Ga0501245_000594_3236_4054 272
404 3300049741 Ga0501079_0280277 Ga0501079_0280277_292_1110 272
405 3300049742 Ga0501080_0022429 Ga0501080_0022429_1239_2057 272
406 3300049743 Ga0501081_0058894 Ga0501081_0058894_838_1656 272
407 3300049757 Ga0501232_000258 Ga0501232_000258_2382_3200 272
408 3300049759 Ga0501262_009996 Ga0501262_009996_263_1081 272
409 3300049762 Ga0501265_000991 Ga0501265_000991_2342_3160 272
410 3300049763 Ga0501266_000067 Ga0501266_000067_7770_8588 272
411 3300049766 Ga0501269_003681 Ga0501269_003681_71_889 272
412 3300049767 Ga0501270_002541 Ga0501270_002541_539_1357 272
413 3300049769 Ga0501272_000120 Ga0501272_000120_4361_5179 272
414 3300049771 Ga0501274_000152 Ga0501274_000152_3406_4224 272
415 3300049772 Ga0501275_001659 Ga0501275_001659_115_933 272
416 3300049775 Ga0501279_003631 Ga0501279_003631_228_1046 272
417 3300049776 Ga0501280_010479 Ga0501280_010479_418_1236 272
418 3300049778 Ga0501282_000720 Ga0501282_000720_555_1373 272
419 3300049779 Ga0501283_000032 Ga0501283_000032_10922_11740 272
420 3300049822 Ga0501035_0046697 Ga0501035_0046697_108_926 272
421 3300049822 Ga0501035_0122654 Ga0501035_0122654_988_1806 272
422 3300049824 Ga0501045_0115700 Ga0501045_0115700_1107_1925 272
423 3300049851 Ga0501212_000363 Ga0501212_000363_2873_3691 272
424 3300049853 Ga0501226_000251 Ga0501226_000251_1932_2750 272
425 3300050507 nmdc:mga05p37_222548_c1 nmdc:mga05p37_222548_c1_1305_2123 272
426 3300050507 nmdc:mga05p37_4495_c1 nmdc:mga05p37_4495_c1_2787_3605 272
427 3300050507 nmdc:mga05p37_591253_c1 nmdc:mga05p37_591253_c1_150_968 272
428 3300050508 nmdc:mga09592_38496_c1 nmdc:mga09592_38496_c1_1497_2315 272
429 3300050508 nmdc:mga09592_61523_c1 nmdc:mga09592_61523_c1_940_1758 272
430 3300050509 nmdc:mga0qj67_13617_c1 nmdc:mga0qj67_13617_c1_4219_5037 272
431 3300050509 nmdc:mga0qj67_17052_c1 nmdc:mga0qj67_17052_c1_2692_3510 272
432 3300050510 nmdc:mga06r32_70763_c1 nmdc:mga06r32_70763_c1_677_1495 272
433 3300050511 nmdc:mga08y16_80793_c1 nmdc:mga08y16_80793_c1_1997_2815 272
434 3300050512 nmdc:mga0n895_343071_c1 nmdc:mga0n895_343071_c1_509_1327 272
435 3300050512 nmdc:mga0n895_46247_c1 nmdc:mga0n895_46247_c1_1243_2061 272
436 3300050513 nmdc:mga0rr50_67437_c1 nmdc:mga0rr50_67437_c1_268_1086 272
437 3300050514 nmdc:mga08x19_174357_c1 nmdc:mga08x19_174357_c1_392_1210 272
438 3300050515 nmdc:mga0a205_7737_c1 nmdc:mga0a205_7737_c1_8286_9104 272
439 3300054114 Ga0501084_0049567 Ga0501084_0049567_1688_2506 272
440 3300059424 Ga0590075_004616 Ga0590075_004616_348_1166 272
441 3300059426 Ga0590077_039182 Ga0590077_039182_94_912 272
442 3300060353 Ga0501082_0127296 Ga0501082_0127296_409_1227 272
443 3300061734 Ga0530510_0209722 Ga0530510_0209722_402_1220 272

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03976

PPK2

Polyphosphate kinase 2 (PPK2)

33

258

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o6m-assembly1.cif.gz_A structure of polyphosphate kinase from meiothermus ruber n121d bound to atp 0.9744 1 259
5lcd-assembly1.cif.gz_A structure of polyphosphate kinase from meiothermus ruber bound to amp 0.9734 1 259
5o6m-assembly1.cif.gz_A structure of polyphosphate kinase from meiothermus ruber n121d bound to atp 0.9707 1 259
5lcd-assembly1.cif.gz_A structure of polyphosphate kinase from meiothermus ruber bound to amp 0.9697 1 259
5o6m-assembly1.cif.gz_C structure of polyphosphate kinase from meiothermus ruber n121d bound to atp 0.9634 1 265
ID Description Score Start End Superfamily
6aqeA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.969 2 272 3.40.50.300
5ldbC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9623 1 265 3.40.50.300
5ldbC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9587 1 265 3.40.50.300
6aqeA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9583 2 272 3.40.50.300
6angA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9437 2 259 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1F6QJM5-F1-model_v4 Polyphosphate kinase-2-related domain-containing protein 0.9827 2 264 GO:0006797
GO:0016776
AF-A0A3L7WI53-F1-model_v4 Polyphosphate kinase 2 family protein 0.982 32 252 GO:0006797
GO:0016301
GO:0016776
AF-A0A7V8YVV4-F1-model_v4 Polyphosphate kinase 2 family protein 0.9815 1 256 GO:0006797
GO:0008976
AF-A0A7V1RBX5-F1-model_v4 Polyphosphate kinase 2 family protein 0.9799 5 254 GO:0006797
GO:0016301
GO:0016776
AF-Q09C39-F1-model_v4 PvdS 0.9783 63 254 GO:0006797
GO:0008976

Feature Viewer

pLDDT pTM Quality
92.77 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map