F445102

General Info

Members Datasets Scaffolds Average Seq Length
443 243 443 372

Family's Representative Sequence

Representative Sequence 3300028380|Ga0268265_10133410|Ga0268265_101334102
Length 399
Sequence MSDDRARILVVDDVPENVRLLEAVLDAHGYDVVSATDGRAALDLALSAKPDLVLLDVMMPPPDGLAVCKRLREMEETAVLPVIMLTASEGSEKTTAIEAGADDFLPKPFNREELLTRIRSLLRIKRYHDTIKAQAAELLSLNRTLEDRVQTQLEELGRLQRLRRFLSPQLADAIVSSGDESILRSHRRQVSMFFADLRGWTNFVDTVEPEELMRVLGEFHGTIGGLVDRFDATVGFIEGDGVQLFFNDPIEVPDPALRAVRLGCALREEMAELTALWQKRGYSLDFGAGIALGYATCGEVGFESRSDYAAIGAVTNLASRLADEAAAGQILISQRLYAEIEDEVDAEPVGEFTLKGFQRPVAAFNVIAIREPATELPSGSDSGHGDGAEPAQPLRTAEP

Samples

Sample ID Description Type Environment
1 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
133 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
134 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
135 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
149 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
160 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
161 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
164 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
165 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
166 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
176 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
180 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
181 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
192 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
218 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
222 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
225 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
228 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.32
Rhizosphere 93.68
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24033J26618_1001669 3300002155 Bacteria 2207
2 JGI24751J29686_10000223 3300002459 Bacteria 23798
3 JGI24751J29686_10007378 3300002459 Bacteria 2246
4 Ga0070683_100001131 3300005329 Bacteria 20182
5 Ga0070683_100011873 3300005329 Bacteria 7550
6 Ga0070683_100013383 3300005329 Bacteria 7154
7 Ga0070683_100087096 3300005329 Bacteria 2929
8 Ga0070683_100117836 3300005329 Bacteria 2507
9 Ga0070683_100138825 3300005329 Bacteria 2302
10 Ga0070670_100011290 3300005331 Bacteria 7635
11 Ga0070670_100127803 3300005331 Bacteria 2193
12 Ga0068869_100199092 3300005334 Bacteria 1578
13 Ga0070680_100023700 3300005336 Bacteria 4898
14 Ga0070680_100032404 3300005336 Bacteria 4207
15 Ga0070682_100131238 3300005337 Bacteria 1696
16 Ga0068868_100029932 3300005338 Bacteria 4173
17 Ga0070660_100126703 3300005339 Bacteria 2041
18 Ga0070687_100065373 3300005343 Bacteria 1935
19 Ga0070692_10042393 3300005345 Bacteria 2337
20 Ga0070668_100122997 3300005347 Bacteria 2076
21 Ga0070668_100177352 3300005347 Bacteria 1738
22 Ga0070675_100073619 3300005354 Bacteria 2836
23 Ga0070675_100187551 3300005354 Bacteria 1791
24 Ga0070674_100006099 3300005356 Bacteria 7009
25 Ga0070674_100009469 3300005356 Bacteria 5831
26 Ga0070673_100036857 3300005364 Bacteria 3722
27 Ga0070673_100100796 3300005364 Bacteria 2378
28 Ga0070688_100009091 3300005365 Bacteria 5419
29 Ga0070703_10003075 3300005406 Bacteria 4772
30 Ga0070703_10020978 3300005406 Bacteria 1906
31 Ga0070713_100160823 3300005436 Bacteria 2004
32 Ga0070700_100019689 3300005441 Bacteria 3899
33 Ga0070700_100110277 3300005441 Bacteria 1828
34 Ga0070708_100246732 3300005445 Bacteria 1677
35 Ga0070663_100085589 3300005455 Bacteria 2326
36 Ga0070678_100080894 3300005456 Bacteria 2461
37 Ga0070678_100107550 3300005456 Bacteria 2175
38 Ga0070681_10004315 3300005458 Bacteria 13511
39 Ga0070681_10014813 3300005458 Bacteria 7755
40 Ga0068867_100066769 3300005459 Bacteria 2680
41 Ga0068867_100114305 3300005459 Bacteria 2078
42 Ga0070698_100023227 3300005471 Bacteria 6482
43 Ga0070698_100038037 3300005471 Bacteria 4959
44 Ga0070698_100204161 3300005471 Bacteria 1911
45 Ga0070679_100009379 3300005530 Bacteria 9253
46 Ga0070679_100085037 3300005530 Bacteria 3150
47 Ga0070684_100000718 3300005535 Bacteria 22923
48 Ga0070684_100008288 3300005535 Bacteria 8118
49 Ga0070684_100110415 3300005535 Bacteria 2465
50 Ga0070684_100128526 3300005535 Bacteria 2284
51 Ga0070684_100135774 3300005535 Bacteria 2222
52 Ga0070684_100138515 3300005535 Bacteria 2199
53 Ga0070684_100193799 3300005535 Bacteria 1850
54 Ga0070697_100021631 3300005536 Bacteria 5098
55 Ga0070697_100140243 3300005536 Unclassified 2033
56 Ga0070672_100011868 3300005543 Bacteria 6088
57 Ga0070686_100084381 3300005544 Bacteria 2110
58 Ga0070695_100077719 3300005545 Bacteria 2187
59 Ga0070696_100097058 3300005546 Bacteria 2107
60 Ga0070665_100026962 3300005548 Bacteria 5785
61 Ga0070704_100001582 3300005549 Bacteria 12291
62 Ga0070704_100236631 3300005549 Bacteria 1493
63 Ga0068855_100019062 3300005563 Bacteria 8249
64 Ga0070664_100019961 3300005564 Bacteria 5517
65 Ga0070664_100098038 3300005564 Bacteria 2546
66 Ga0068857_100027256 3300005577 Bacteria 5039
67 Ga0068857_100048240 3300005577 Bacteria 3781
68 Ga0068857_100174190 3300005577 Bacteria 1956
69 Ga0068854_100169841 3300005578 Bacteria 1696
70 Ga0068856_100246521 3300005614 Bacteria 1802
71 Ga0068856_100271507 3300005614 Unclassified 1712
72 Ga0070702_100159756 3300005615 Unclassified 1455
73 Ga0068852_100091564 3300005616 Bacteria 2721
74 Ga0068859_100042738 3300005617 Bacteria 4553
75 Ga0068864_100080192 3300005618 Bacteria 2859
76 Ga0068864_100150585 3300005618 Bacteria 2107
77 Ga0068866_10062500 3300005718 Unclassified 1937
78 Ga0068866_10165344 3300005718 Bacteria 1294
79 Ga0068861_100004620 3300005719 Bacteria 9242
80 Ga0068851_10145605 3300005834 Bacteria 1291
81 Ga0068870_10004753 3300005840 Bacteria 5871
82 Ga0068870_10007440 3300005840 Bacteria 4881
83 Ga0068870_10063658 3300005840 Bacteria 1990
84 Ga0068870_10087930 3300005840 Bacteria 1731
85 Ga0068863_100028952 3300005841 Bacteria 5290
86 Ga0068858_100154774 3300005842 Bacteria 2157
87 Ga0068860_100136828 3300005843 Bacteria 2353
88 Ga0068860_100325648 3300005843 Bacteria 1508
89 Ga0068862_100076290 3300005844 Bacteria 2901
90 Ga0081455_10015172 3300005937 Bacteria 7498
91 Ga0081455_10023102 3300005937 Bacteria 5793
92 Ga0081455_10051279 3300005937 Bacteria 3540
93 Ga0081455_10169928 3300005937 Bacteria 1662
94 Ga0081538_10084753 3300005981 Bacteria 1668
95 Ga0081540_1000879 3300005983 Bacteria 27145
96 Ga0081539_10002754 3300005985 Bacteria 23660
97 Ga0070717_10020221 3300006028 Bacteria 5232
98 Ga0070717_10046917 3300006028 Bacteria 3537
99 Ga0075432_10001799 3300006058 Bacteria 7065
100 Ga0070712_100039241 3300006175 Bacteria 3240
101 Ga0097621_100120527 3300006237 Bacteria 2224
102 Ga0068871_100303981 3300006358 Bacteria 1401
103 Ga0075428_100007325 3300006844 Bacteria 12225
104 Ga0075428_100024429 3300006844 Bacteria 6687
105 Ga0075428_100033997 3300006844 Bacteria 5624
106 Ga0075428_100039421 3300006844 Bacteria 5199
107 Ga0075428_100068594 3300006844 Bacteria 3879
108 Ga0075430_100010189 3300006846 Bacteria 7960
109 Ga0075430_100082386 3300006846 Bacteria 2696
110 Ga0075431_100010011 3300006847 Bacteria 9525
111 Ga0075431_100055559 3300006847 Bacteria 4084
112 Ga0075433_10000149 3300006852 Bacteria 37279
113 Ga0075433_10011686 3300006852 Bacteria 7070
114 Ga0075433_10021142 3300006852 Bacteria 5454
115 Ga0075433_10088345 3300006852 Bacteria 2739
116 Ga0075434_100005828 3300006871 Bacteria 11253
117 Ga0075434_100007538 3300006871 Bacteria 10078
118 Ga0075434_100073068 3300006871 Bacteria 3422
119 Ga0075429_100214842 3300006880 Bacteria 1685
120 Ga0068865_100098550 3300006881 Bacteria 2136
121 Ga0068865_100206360 3300006881 Unclassified 1528
122 Ga0097620_100042737 3300006931 Bacteria 4553
123 Ga0075435_100032344 3300007076 Bacteria 4130
124 Ga0075435_100066195 3300007076 Bacteria 2939
125 Ga0105240_10038750 3300009093 Bacteria 6111
126 Ga0111539_10010042 3300009094 Bacteria 11933
127 Ga0111539_10277101 3300009094 Bacteria 1952
128 Ga0111539_10284180 3300009094 Bacteria 1925
129 Ga0105245_10146555 3300009098 Bacteria 2228
130 Ga0105245_10247230 3300009098 Unclassified 1731
131 Ga0105245_10347320 3300009098 Bacteria 1469
132 Ga0105245_10411143 3300009098 Bacteria 1354
133 Ga0105247_10023979 3300009101 Bacteria 3676
134 Ga0114129_10000667 3300009147 Bacteria 43086
135 Ga0114129_10004092 3300009147 Bacteria 20601
136 Ga0114129_10089440 3300009147 Bacteria 4268
137 Ga0105243_10006839 3300009148 Bacteria 8790
138 Ga0105243_10009871 3300009148 Bacteria 7261
139 Ga0105243_10032066 3300009148 Bacteria 4056
140 Ga0105243_10079721 3300009148 Bacteria 2669
141 Ga0105242_10009376 3300009176 Bacteria 7511
142 Ga0105242_10092488 3300009176 Bacteria 2548
143 Ga0105242_10301250 3300009176 Bacteria 1463
144 Ga0105248_10011530 3300009177 Bacteria 9743
145 Ga0105248_10031295 3300009177 Bacteria 5947
146 Ga0105238_10015628 3300009551 Bacteria 7682
147 Ga0105238_10035931 3300009551 Bacteria 5037
148 Ga0105249_10123526 3300009553 Bacteria 2463
149 Ga0105249_10343266 3300009553 Bacteria 1510
150 Ga0105239_10113594 3300010375 Bacteria 3003
151 Ga0105246_10022863 3300011119 Bacteria 4040
152 Ga0157370_10245694 3300013104 Bacteria 1656
153 Ga0157374_10175068 3300013296 Bacteria 2094
154 Ga0163162_10201780 3300013306 Bacteria 2117
155 Ga0157372_10394827 3300013307 Bacteria 1612
156 Ga0163163_10263831 3300014325 Bacteria 1773
157 Ga0163163_10355333 3300014325 Bacteria 1522
158 Ga0157380_10004114 3300014326 Bacteria 10043
159 Ga0157380_10025600 3300014326 Bacteria 4476
160 Ga0157380_10267225 3300014326 Unclassified 1557
161 Ga0157377_10037023 3300014745 Bacteria 2687
162 Ga0157379_10101297 3300014968 Bacteria 2585
163 Ga0207656_10011064 3300025321 Bacteria 3399
164 Ga0207653_10001669 3300025885 Bacteria 7115
165 Ga0207642_10148628 3300025899 Bacteria 1244
166 Ga0207710_10005058 3300025900 Bacteria 5714
167 Ga0207688_10005746 3300025901 Bacteria 6748
168 Ga0207688_10010940 3300025901 Bacteria 4937
169 Ga0207688_10017894 3300025901 Bacteria 3856
170 Ga0207645_10087416 3300025907 Bacteria 2003
171 Ga0207643_10005135 3300025908 Bacteria 7003
172 Ga0207643_10114293 3300025908 Bacteria 1593
173 Ga0207707_10032030 3300025912 Bacteria 4603
174 Ga0207707_10141291 3300025912 Bacteria 2105
175 Ga0207693_10052205 3300025915 Bacteria 3206
176 Ga0207693_10092683 3300025915 Bacteria 2367
177 Ga0207662_10043290 3300025918 Bacteria 2656
178 Ga0207657_10025802 3300025919 Bacteria 5412
179 Ga0207659_10358582 3300025926 Bacteria 1211
180 Ga0207687_10072029 3300025927 Bacteria 2471
181 Ga0207687_10083177 3300025927 Bacteria 2317
182 Ga0207687_10181771 3300025927 Bacteria 1630
183 Ga0207700_10216674 3300025928 Bacteria 1621
184 Ga0207706_10037083 3300025933 Bacteria 4329
185 Ga0207706_10100779 3300025933 Unclassified 2541
186 Ga0207686_10190860 3300025934 Bacteria 1460
187 Ga0207686_10195907 3300025934 Bacteria 1444
188 Ga0207709_10128340 3300025935 Bacteria 1724
189 Ga0207670_10017826 3300025936 Bacteria 4300
190 Ga0207670_10115103 3300025936 Bacteria 1945
191 Ga0207669_10020000 3300025937 Bacteria 3499
192 Ga0207691_10012079 3300025940 Bacteria 8282
193 Ga0207711_10030829 3300025941 Bacteria 4524
194 Ga0207689_10024119 3300025942 Bacteria 5104
195 Ga0207661_10003786 3300025944 Bacteria 10550
196 Ga0207661_10011462 3300025944 Bacteria 6425
197 Ga0207661_10043525 3300025944 Bacteria 3543
198 Ga0207667_10314505 3300025949 Bacteria 1599
199 Ga0207712_10037324 3300025961 Bacteria 3314
200 Ga0207640_10119660 3300025981 Bacteria 1884
201 Ga0207677_10091353 3300026023 Bacteria 2214
202 Ga0207703_10059681 3300026035 Bacteria 3116
203 Ga0207678_10043858 3300026067 Bacteria 3869
204 Ga0207708_10011411 3300026075 Bacteria 6616
205 Ga0207708_10019504 3300026075 Bacteria 5113
206 Ga0207702_10214253 3300026078 Bacteria 1792
207 Ga0207648_10012528 3300026089 Bacteria 7936
208 Ga0207648_10137370 3300026089 Bacteria 2153
209 Ga0207676_10001154 3300026095 Bacteria 19868
210 Ga0207674_10000474 3300026116 Bacteria 52766
211 Ga0207674_10002131 3300026116 Bacteria 25008
212 Ga0207674_10022430 3300026116 Bacteria 6778
213 Ga0207674_10180838 3300026116 Bacteria 2060
214 Ga0207675_100094356 3300026118 Bacteria 2815
215 Ga0207675_100133465 3300026118 Unclassified 2354
216 Ga0207683_10021066 3300026121 Bacteria 5579
217 Ga0207428_10000597 3300027907 Bacteria 42692
218 Ga0207428_10000612 3300027907 Bacteria 42181
219 Ga0207428_10036615 3300027907 Bacteria 4001
220 Ga0207428_10066471 3300027907 Bacteria 2841
221 Ga0268265_10041936 3300028380 Bacteria 3392
222 Ga0268265_10133410 3300028380 Unclassified 2068
223 Ga0268264_10267588 3300028381 Bacteria 1595
224 Ga0265327_10004847 3300031251 Bacteria 11661
225 Ga0307405_10089568 3300031731 Bacteria 2033
226 Ga0307416_100028459 3300032002 Bacteria 4156
227 Ga0373958_0016516 3300034819 Bacteria 1317
228 Ga0373949_0028378 3300035090 Bacteria 1320
229 Ga0373957_0043644 3300035120 Bacteria 1695
230 Ga0373924_0036460 3300035410 Bacteria 1999
231 Ga0373931_0123775 3300035691 Bacteria 1481
232 Ga0373935_0073386 3300035692 Bacteria 2211
233 Ga0373927_0063614 3300035695 Bacteria 2386
234 Ga0373933_0086191 3300035724 Bacteria 1932
235 Ga0373947_0068045 3300035725 Bacteria 2177
236 Ga0373947_0068108 3300035725 Bacteria 2176
237 Ga0373937_0030316 3300036401 Bacteria 4899
238 Ga0373925_0076798 3300037068 Bacteria 2534
239 Ga0395899_0003576 3300037312 Bacteria 12306
240 Ga0395899_0003704 3300037312 Bacteria 12092
241 Ga0395899_0005616 3300037312 Bacteria 9733
242 Ga0395899_0020638 3300037312 Bacteria 4994
243 Ga0395899_0024678 3300037312 Bacteria 4544
244 Ga0395899_0079865 3300037312 Unclassified 2382
245 Ga0395900_0002509 3300037418 Bacteria 20165
246 Ga0395900_0003775 3300037418 Bacteria 16230
247 Ga0395900_0006012 3300037418 Bacteria 12662
248 Ga0395900_0011358 3300037418 Bacteria 9111
249 Ga0395900_0020004 3300037418 Bacteria 6824
250 Ga0395900_0025384 3300037418 Bacteria 6067
251 Ga0395900_0032470 3300037418 Bacteria 5369
252 Ga0395900_0035599 3300037418 Bacteria 5128
253 Ga0395900_0044769 3300037418 Bacteria 4559
254 Ga0395900_0095862 3300037418 Bacteria 3048
255 Ga0395900_0114443 3300037418 Bacteria 2768
256 Ga0395900_0182108 3300037418 Bacteria 2134
257 Ga0395900_0266194 3300037418 Bacteria 1710
258 Ga0395898_0008185 3300037466 Bacteria 11064
259 Ga0395898_0010957 3300037466 Bacteria 9454
260 Ga0395898_0027496 3300037466 Bacteria 5709
261 Ga0395898_0031515 3300037466 Bacteria 5296
262 Ga0395898_0039142 3300037466 Bacteria 4694
263 Ga0395898_0214444 3300037466 Bacteria 1836
264 Ga0395898_0223399 3300037466 Bacteria 1796
265 Ga0395898_0268485 3300037466 Bacteria 1627
266 Ga0395905_0014012 3300037471 Bacteria 7667
267 Ga0395905_0017698 3300037471 Bacteria 6766
268 Ga0395905_0020103 3300037471 Bacteria 6326
269 Ga0395905_0021749 3300037471 Bacteria 6067
270 Ga0395905_0024628 3300037471 Bacteria 5678
271 Ga0395905_0100693 3300037471 Bacteria 2713
272 Ga0395905_0238415 3300037471 Bacteria 1700
273 Ga0395905_0260712 3300037471 Bacteria 1618
274 Ga0395901_0004795 3300038443 Bacteria 13643
275 Ga0395901_0014998 3300038443 Bacteria 7876
276 Ga0395901_0019865 3300038443 Bacteria 6872
277 Ga0395901_0031459 3300038443 Bacteria 5472
278 Ga0395901_0054431 3300038443 Bacteria 4159
279 Ga0395901_0087819 3300038443 Bacteria 3251
280 Ga0395901_0100214 3300038443 Bacteria 3038
281 Ga0395901_0244301 3300038443 Bacteria 1871
282 Ga0395901_0251348 3300038443 Bacteria 1841
283 Ga0395901_0305862 3300038443 Bacteria 1648
284 Ga0395901_0329392 3300038443 Bacteria 1579
285 Ga0436360_0422562 3300039438 Bacteria 2478
286 Ga0436360_0560791 3300039438 Bacteria 1839
287 Ga0439460_0017901 3300042461 Bacteria 1903
288 Ga0466963_0005521 3300044694 Bacteria 7402
289 Ga0466964_0002782 3300044706 Bacteria 6287
290 Ga0466964_0055804 3300044706 Bacteria 1632
291 Ga0466957_0009060 3300044842 Bacteria 5674
292 Ga0451576_0098706 3300045051 Unclassified 3038
293 Ga0466967_0005143 3300045976 Bacteria 8998
294 Ga0466967_0082101 3300045976 Bacteria 2912
295 Ga0466967_0155314 3300045976 Bacteria 2142
296 Ga0466967_0182474 3300045976 Bacteria 1980
297 Ga0466967_0201087 3300045976 Bacteria 1887
298 Ga0466967_0418870 3300045976 Bacteria 1305
299 Ga0495592_0019579 3300046454 Bacteria 5148
300 Ga0495629_0021760 3300046459 Bacteria 4575
301 Ga0495651_0144538 3300046462 Bacteria 1721
302 Ga0495653_0027976 3300046463 Bacteria 4512
303 Ga0495585_0074859 3300046492 Bacteria 1842
304 Ga0495608_0003819 3300046511 Bacteria 10827
305 Ga0495618_0070772 3300046514 Bacteria 2219
306 Ga0495630_0049785 3300046517 Bacteria 3135
307 Ga0495637_0029404 3300046520 Bacteria 2446
308 Ga0495644_0065961 3300046523 Unclassified 1360
309 Ga0495663_0044208 3300046525 Viruses 1363
310 Ga0495642_0098470 3300046528 Unclassified 1243
311 Ga0495640_0052554 3300046533 Bacteria 2797
312 Ga0495587_0045090 3300046536 Bacteria 2622
313 Ga0495609_0054158 3300046538 Unclassified 1782
314 Ga0495609_0111969 3300046538 Bacteria 1178
315 Ga0495667_0012022 3300046559 Bacteria 5863
316 Ga0495634_0055350 3300046642 Bacteria 2652
317 Ga0495635_0106627 3300046663 Bacteria 1914
318 Ga0495657_0020035 3300046675 Bacteria 4814
319 Ga0495657_0100762 3300046675 Bacteria 1841
320 Ga0495599_0004930 3300046678 Bacteria 7930
321 Ga0495623_0047549 3300046679 Bacteria 2723
322 Ga0495646_0028999 3300046680 Bacteria 3462
323 Ga0495658_0036304 3300046683 Bacteria 2718
324 Ga0495613_0012660 3300046689 Bacteria 6271
325 Ga0495613_0025165 3300046689 Bacteria 4436
326 Ga0495624_0029664 3300046690 Bacteria 3567
327 Ga0495624_0096050 3300046690 Bacteria 1826
328 Ga0495671_0039722 3300046692 Bacteria 2375
329 Ga0495589_0025551 3300046794 Bacteria 2997
330 Ga0495600_0007954 3300046809 Bacteria 6497
331 Ga0495600_0098998 3300046809 Bacteria 1901
332 Ga0495581_0133934 3300047315 Bacteria 1444
333 Ga0495604_0008367 3300047317 Bacteria 8180
334 Ga0495674_0117234 3300047319 Bacteria 2252
335 Ga0495676_0155735 3300047321 Bacteria 1621
336 Ga0495680_0007687 3300047322 Bacteria 9840
337 Ga0495680_0023256 3300047322 Bacteria 5155
338 Ga0495675_0005148 3300047444 Bacteria 7957
339 Ga0495677_0086599 3300047445 Unclassified 1178
340 Ga0495684_0032603 3300047471 Bacteria 4000
341 Ga0495684_0066809 3300047471 Bacteria 2734
342 Ga0495602_0013823 3300048088 Bacteria 8229
343 Ga0495602_0056568 3300048088 Bacteria 3448
344 Ga0495602_0069823 3300048088 Bacteria 3010
345 Ga0495626_0134369 3300048091 Unclassified 1054
346 Ga0496101_0031048 3300048904 Bacteria 3752
347 Ga0496101_0056633 3300048904 Bacteria 2834
348 Ga0496102_0220402 3300048905 Bacteria 1788
349 Ga0496103_0150855 3300048906 Unclassified 1489
350 Ga0496104_0007884 3300048907 Bacteria 9444
351 Ga0496104_0049875 3300048907 Bacteria 3948
352 Ga0496104_0387987 3300048907 Bacteria 1309
353 Ga0496105_0009769 3300048908 Bacteria 7515
354 Ga0496105_0198469 3300048908 Bacteria 1638
355 Ga0496106_0020958 3300048909 Bacteria 4850
356 Ga0496107_0040804 3300048910 Bacteria 3332
357 Ga0496108_0041709 3300048911 Bacteria 3832
358 Ga0496108_0061648 3300048911 Bacteria 3156
359 Ga0496108_0080591 3300048911 Bacteria 2758
360 Ga0496108_0113713 3300048911 Bacteria 2317
361 Ga0496108_0117937 3300048911 Bacteria 2275
362 Ga0496109_0020397 3300048912 Bacteria 5854
363 Ga0496109_0021245 3300048912 Bacteria 5739
364 Ga0496109_0043225 3300048912 Bacteria 4084
365 Ga0496109_0076056 3300048912 Bacteria 3088
366 Ga0496109_0360097 3300048912 Bacteria 1374
367 Ga0496110_0015243 3300048913 Bacteria 6392
368 Ga0496110_0036616 3300048913 Bacteria 4261
369 Ga0496110_0049636 3300048913 Bacteria 3682
370 Ga0496111_0065900 3300048914 Bacteria 2629
371 Ga0496114_0014274 3300048917 Bacteria 6373
372 Ga0496114_0126572 3300048917 Bacteria 2203
373 Ga0496115_0010598 3300048918 Bacteria 6894
374 Ga0501031_0017160 3300049568 Bacteria 4704
375 Ga0501032_0009499 3300049569 Bacteria 7048
376 Ga0501036_0002911 3300049572 Bacteria 13584
377 Ga0501036_0023454 3300049572 Bacteria 5199
378 Ga0501037_0136568 3300049573 Bacteria 1756
379 Ga0501037_0230025 3300049573 Bacteria 1302
380 Ga0501039_0005424 3300049575 Bacteria 9641
381 Ga0501039_0031596 3300049575 Bacteria 4082
382 Ga0501039_0141218 3300049575 Bacteria 1892
383 Ga0501040_0189141 3300049576 Bacteria 1460
384 Ga0501041_0008515 3300049577 Bacteria 6037
385 Ga0501041_0030363 3300049577 Bacteria 3261
386 Ga0501042_0003550 3300049578 Bacteria 9815
387 Ga0501043_0027956 3300049579 Bacteria 4427
388 Ga0501046_0006355 3300049580 Bacteria 10477
389 Ga0501048_0061804 3300049582 Bacteria 2651
390 Ga0501068_0012067 3300049584 Bacteria 4890
391 Ga0501069_0054532 3300049585 Bacteria 2226
392 Ga0501071_0002637 3300049587 Bacteria 10978
393 Ga0501071_0011103 3300049587 Bacteria 6054
394 Ga0501072_0022731 3300049588 Bacteria 4865
395 Ga0501074_0013222 3300049590 Bacteria 6001
396 Ga0501074_0029295 3300049590 Bacteria 3988
397 Ga0501075_0030898 3300049591 Bacteria 3971
398 Ga0501075_0047023 3300049591 Bacteria 3242
399 Ga0501076_0002533 3300049592 Bacteria 12573
400 Ga0501076_0024282 3300049592 Bacteria 4683
401 Ga0501077_0002613 3300049593 Bacteria 10786
402 Ga0501077_0020436 3300049593 Bacteria 4191
403 Ga0501079_0003011 3300049741 Bacteria 12323
404 Ga0501079_0037053 3300049741 Bacteria 3757
405 Ga0501080_0006559 3300049742 Bacteria 10460
406 Ga0501080_0055563 3300049742 Bacteria 3688
407 Ga0501081_0008667 3300049743 Bacteria 6607
408 Ga0501083_0006107 3300049744 Bacteria 8538
409 Ga0501083_0017440 3300049744 Bacteria 5004
410 Ga0501044_0157716 3300049823 Bacteria 2248
411 Ga0501045_0004481 3300049824 Bacteria 9648
412 Ga0501045_0013202 3300049824 Bacteria 5826
413 Ga0501045_0094963 3300049824 Bacteria 2206
414 nmdc:mga05p37_134912_c1 3300050507 Bacteria 3028
415 nmdc:mga05p37_200162_c1 3300050507 Bacteria 2420
416 nmdc:mga05p37_223309_c1 3300050507 Bacteria 2273
417 nmdc:mga05p37_4582_c1 3300050507 Bacteria 16162
418 nmdc:mga09592_298439_c1 3300050508 Bacteria 1397
419 nmdc:mga09592_48952_c1 3300050508 Bacteria 3563
420 nmdc:mga0qj67_2994_c1 3300050509 Bacteria 12123
421 nmdc:mga0qj67_4158_c1 3300050509 Bacteria 10490
422 nmdc:mga06r32_195905_c1 3300050510 Bacteria 2008
423 nmdc:mga06r32_30480_c1 3300050510 Bacteria 5061
424 nmdc:mga08y16_126060_c1 3300050511 Bacteria 2664
425 nmdc:mga08y16_138664_c1 3300050511 Bacteria 2529
426 nmdc:mga08y16_17248_c1 3300050511 Bacteria 7601
427 nmdc:mga08y16_60836_c1 3300050511 Bacteria 3944
428 nmdc:mga08y16_7663_c1 3300050511 Bacteria 11299
429 nmdc:mga0n895_14265_c1 3300050512 Bacteria 7210
430 nmdc:mga0n895_156849_c1 3300050512 Bacteria 2307
431 nmdc:mga0n895_387574_c1 3300050512 Bacteria 1414
432 nmdc:mga0rr50_59331_c1 3300050513 Bacteria 2872
433 nmdc:mga0a205_24400_c1 3300050515 Bacteria 5750
434 nmdc:mga0a205_398206_c1 3300050515 Bacteria 1241
435 nmdc:mga0a205_51265_c1 3300050515 Bacteria 3984
436 Ga0495601_0117903 3300053077 Bacteria 1722
437 Ga0495601_0177239 3300053077 Bacteria 1394
438 Ga0495619_0005547 3300053085 Bacteria 8005
439 Ga0501084_0064556 3300054114 Bacteria 3063
440 Ga0501084_0099502 3300054114 Bacteria 2442
441 Ga0501084_0413579 3300054114 Bacteria 1140
442 Ga0501082_0006790 3300060353 Bacteria 9890
443 Ga0530510_0003120 3300061734 Bacteria 11372

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005471 Ga0070698_100023227 Ga0070698_1000232272 309
2 3300048091 Ga0495626_0134369 Ga0495626_0134369_11_982 312
3 3300047445 Ga0495677_0086599 Ga0495677_0086599_116_1144 314
4 3300013307 Ga0157372_10394827 Ga0157372_103948272 315
5 3300037471 Ga0395905_0100693 Ga0395905_0100693_1384_2376 319
6 3300044706 Ga0466964_0055804 Ga0466964_0055804_275_1291 319
7 3300013104 Ga0157370_10245694 Ga0157370_102456941 334
8 3300005563 Ga0068855_100019062 Ga0068855_1000190629 335
9 3300006871 Ga0075434_100073068 Ga0075434_1000730683 335
10 3300007076 Ga0075435_100066195 Ga0075435_1000661953 335
11 3300037312 Ga0395899_0079865 Ga0395899_0079865_1055_2200 335
12 3300037418 Ga0395900_0006012 Ga0395900_0006012_6905_8050 335
13 3300037466 Ga0395898_0027496 Ga0395898_0027496_4017_5162 335
14 3300037471 Ga0395905_0021749 Ga0395905_0021749_1822_2967 335
15 3300038443 Ga0395901_0031459 Ga0395901_0031459_3255_4400 335
16 3300050512 nmdc:mga0n895_156849_c1 nmdc:mga0n895_156849_c1_848_1975 335
17 3300050513 nmdc:mga0rr50_59331_c1 nmdc:mga0rr50_59331_c1_70_1197 335
18 3300005336 Ga0070680_100032404 Ga0070680_1000324043 336
19 3300005530 Ga0070679_100009379 Ga0070679_1000093794 336
20 3300005536 Ga0070697_100021631 Ga0070697_1000216312 341
21 3300006847 Ga0075431_100055559 Ga0075431_1000555592 342
22 3300006844 Ga0075428_100033997 Ga0075428_1000339974 343
23 3300009147 Ga0114129_10004092 Ga0114129_1000409225 343
24 3300050507 nmdc:mga05p37_4582_c1 nmdc:mga05p37_4582_c1_863_1963 343
25 3300005458 Ga0070681_10004315 Ga0070681_100043155 344
26 3300025912 Ga0207707_10032030 Ga0207707_100320305 344
27 3300054114 Ga0501084_0413579 Ga0501084_0413579_58_1125 344
28 3300046538 Ga0495609_0111969 Ga0495609_0111969_14_1078 345
29 3300048911 Ga0496108_0117937 Ga0496108_0117937_320_1429 347
30 3300048912 Ga0496109_0360097 Ga0496109_0360097_121_1230 347
31 3300005329 Ga0070683_100117836 Ga0070683_1001178362 350
32 3300005337 Ga0070682_100131238 Ga0070682_1001312382 350
33 3300005535 Ga0070684_100135774 Ga0070684_1001357743 350
34 3300005578 Ga0068854_100169841 Ga0068854_1001698412 350
35 3300025912 Ga0207707_10141291 Ga0207707_101412911 350
36 3300035090 Ga0373949_0028378 Ga0373949_0028378_13_1134 350
37 3300049573 Ga0501037_0136568 Ga0501037_0136568_10_1131 350
38 3300050515 nmdc:mga0a205_398206_c1 nmdc:mga0a205_398206_c1_13_1134 350
39 3300045976 Ga0466967_0082101 Ga0466967_0082101_540_1664 351
40 3300048917 Ga0496114_0014274 Ga0496114_0014274_2003_3118 352
41 3300045976 Ga0466967_0182474 Ga0466967_0182474_32_1132 353
42 3300046675 Ga0495657_0100762 Ga0495657_0100762_339_1430 353
43 3300005985 Ga0081539_10002754 Ga0081539_1000275412 354
44 3300039438 Ga0436360_0422562 Ga0436360_0422562_634_1737 354
45 3300048911 Ga0496108_0113713 Ga0496108_0113713_816_1919 354
46 3300045976 Ga0466967_0418870 Ga0466967_0418870_114_1238 355
47 3300046462 Ga0495651_0144538 Ga0495651_0144538_136_1239 355
48 3300048088 Ga0495602_0069823 Ga0495602_0069823_593_1696 355
49 3300005981 Ga0081538_10084753 Ga0081538_100847532 356
50 3300037418 Ga0395900_0266194 Ga0395900_0266194_273_1388 356
51 3300038443 Ga0395901_0329392 Ga0395901_0329392_15_1130 356
52 3300049569 Ga0501032_0009499 Ga0501032_0009499_521_1672 356
53 3300049744 Ga0501083_0017440 Ga0501083_0017440_1732_2883 356
54 3300049823 Ga0501044_0157716 Ga0501044_0157716_160_1311 356
55 3300050511 nmdc:mga08y16_138664_c1 nmdc:mga08y16_138664_c1_627_1769 356
56 3300005456 Ga0070678_100107550 Ga0070678_1001075502 357
57 3300005840 Ga0068870_10063658 Ga0068870_100636583 357
58 3300009148 Ga0105243_10006839 Ga0105243_100068396 357
59 3300009553 Ga0105249_10343266 Ga0105249_103432662 357
60 3300014325 Ga0163163_10355333 Ga0163163_103553331 357
61 3300037418 Ga0395900_0025384 Ga0395900_0025384_3640_4782 357
62 3300038443 Ga0395901_0054431 Ga0395901_0054431_1146_2288 357
63 3300048904 Ga0496101_0031048 Ga0496101_0031048_1284_2432 357
64 3300048904 Ga0496101_0056633 Ga0496101_0056633_1268_2413 357
65 3300048905 Ga0496102_0220402 Ga0496102_0220402_133_1281 357
66 3300048907 Ga0496104_0387987 Ga0496104_0387987_104_1252 357
67 3300048908 Ga0496105_0198469 Ga0496105_0198469_14_1162 357
68 3300048909 Ga0496106_0020958 Ga0496106_0020958_3473_4621 357
69 3300048910 Ga0496107_0040804 Ga0496107_0040804_1779_2927 357
70 3300048911 Ga0496108_0041709 Ga0496108_0041709_473_1621 357
71 3300049568 Ga0501031_0017160 Ga0501031_0017160_574_1716 357
72 3300049572 Ga0501036_0023454 Ga0501036_0023454_1402_2544 357
73 3300049573 Ga0501037_0230025 Ga0501037_0230025_91_1233 357
74 3300049575 Ga0501039_0031596 Ga0501039_0031596_703_1845 357
75 3300049577 Ga0501041_0008515 Ga0501041_0008515_1532_2674 357
76 3300049582 Ga0501048_0061804 Ga0501048_0061804_1099_2241 357
77 3300049587 Ga0501071_0002637 Ga0501071_0002637_9752_10894 357
78 3300049587 Ga0501071_0011103 Ga0501071_0011103_2935_4077 357
79 3300049588 Ga0501072_0022731 Ga0501072_0022731_1559_2701 357
80 3300049590 Ga0501074_0029295 Ga0501074_0029295_2237_3379 357
81 3300049591 Ga0501075_0047023 Ga0501075_0047023_142_1284 357
82 3300049592 Ga0501076_0002533 Ga0501076_0002533_8917_10059 357
83 3300049592 Ga0501076_0024282 Ga0501076_0024282_2968_4110 357
84 3300049593 Ga0501077_0020436 Ga0501077_0020436_510_1652 357
85 3300049741 Ga0501079_0037053 Ga0501079_0037053_1383_2525 357
86 3300049742 Ga0501080_0055563 Ga0501080_0055563_1512_2654 357
87 3300049743 Ga0501081_0008667 Ga0501081_0008667_5438_6580 357
88 3300049824 Ga0501045_0013202 Ga0501045_0013202_2040_3182 357
89 3300054114 Ga0501084_0064556 Ga0501084_0064556_1750_2892 357
90 3300005329 Ga0070683_100138825 Ga0070683_1001388252 358
91 3300005331 Ga0070670_100127803 Ga0070670_1001278032 358
92 3300005334 Ga0068869_100199092 Ga0068869_1001990922 358
93 3300005338 Ga0068868_100029932 Ga0068868_1000299321 358
94 3300005339 Ga0070660_100126703 Ga0070660_1001267033 358
95 3300005343 Ga0070687_100065373 Ga0070687_1000653733 358
96 3300005345 Ga0070692_10042393 Ga0070692_100423931 358
97 3300005347 Ga0070668_100177352 Ga0070668_1001773522 358
98 3300005354 Ga0070675_100073619 Ga0070675_1000736194 358
99 3300005356 Ga0070674_100006099 Ga0070674_1000060993 358
100 3300005364 Ga0070673_100036857 Ga0070673_1000368571 358
101 3300005365 Ga0070688_100009091 Ga0070688_1000090913 358
102 3300005406 Ga0070703_10020978 Ga0070703_100209782 358
103 3300005441 Ga0070700_100110277 Ga0070700_1001102772 358
104 3300005455 Ga0070663_100085589 Ga0070663_1000855893 358
105 3300005456 Ga0070678_100080894 Ga0070678_1000808943 358
106 3300005543 Ga0070672_100011868 Ga0070672_1000118681 358
107 3300005544 Ga0070686_100084381 Ga0070686_1000843812 358
108 3300005546 Ga0070696_100097058 Ga0070696_1000970582 358
109 3300005548 Ga0070665_100026962 Ga0070665_1000269622 358
110 3300005577 Ga0068857_100174190 Ga0068857_1001741903 358
111 3300005614 Ga0068856_100246521 Ga0068856_1002465212 358
112 3300005616 Ga0068852_100091564 Ga0068852_1000915642 358
113 3300005617 Ga0068859_100042738 Ga0068859_1000427385 358
114 3300005834 Ga0068851_10145605 Ga0068851_101456051 358
115 3300005840 Ga0068870_10007440 Ga0068870_100074405 358
116 3300005842 Ga0068858_100154774 Ga0068858_1001547742 358
117 3300005843 Ga0068860_100325648 Ga0068860_1003256481 358
118 3300005844 Ga0068862_100076290 Ga0068862_1000762903 358
119 3300006237 Ga0097621_100120527 Ga0097621_1001205272 358
120 3300006358 Ga0068871_100303981 Ga0068871_1003039812 358
121 3300006852 Ga0075433_10088345 Ga0075433_100883453 358
122 3300006881 Ga0068865_100098550 Ga0068865_1000985502 358
123 3300006931 Ga0097620_100042737 Ga0097620_1000427375 358
124 3300009094 Ga0111539_10277101 Ga0111539_102771013 358
125 3300009094 Ga0111539_10284180 Ga0111539_102841803 358
126 3300009098 Ga0105245_10146555 Ga0105245_101465553 358
127 3300009101 Ga0105247_10023979 Ga0105247_100239792 358
128 3300009176 Ga0105242_10009376 Ga0105242_100093763 358
129 3300009177 Ga0105248_10031295 Ga0105248_100312955 358
130 3300009551 Ga0105238_10015628 Ga0105238_100156283 358
131 3300009553 Ga0105249_10123526 Ga0105249_101235263 358
132 3300013296 Ga0157374_10175068 Ga0157374_101750681 358
133 3300014326 Ga0157380_10025600 Ga0157380_100256004 358
134 3300014968 Ga0157379_10101297 Ga0157379_101012972 358
135 3300025321 Ga0207656_10011064 Ga0207656_100110643 358
136 3300025900 Ga0207710_10005058 Ga0207710_100050584 358
137 3300025901 Ga0207688_10010940 Ga0207688_100109405 358
138 3300025908 Ga0207643_10005135 Ga0207643_100051356 358
139 3300025918 Ga0207662_10043290 Ga0207662_100432904 358
140 3300025919 Ga0207657_10025802 Ga0207657_100258024 358
141 3300025926 Ga0207659_10358582 Ga0207659_103585821 358
142 3300025927 Ga0207687_10072029 Ga0207687_100720293 358
143 3300025927 Ga0207687_10181771 Ga0207687_101817712 358
144 3300025933 Ga0207706_10037083 Ga0207706_100370834 358
145 3300025934 Ga0207686_10190860 Ga0207686_101908601 358
146 3300025936 Ga0207670_10017826 Ga0207670_100178265 358
147 3300025940 Ga0207691_10012079 Ga0207691_100120795 358
148 3300025942 Ga0207689_10024119 Ga0207689_100241192 358
149 3300025949 Ga0207667_10314505 Ga0207667_103145052 358
150 3300025981 Ga0207640_10119660 Ga0207640_101196602 358
151 3300026035 Ga0207703_10059681 Ga0207703_100596812 358
152 3300026067 Ga0207678_10043858 Ga0207678_100438583 358
153 3300026075 Ga0207708_10011411 Ga0207708_100114115 358
154 3300026078 Ga0207702_10214253 Ga0207702_102142532 358
155 3300026089 Ga0207648_10012528 Ga0207648_1001252810 358
156 3300026116 Ga0207674_10180838 Ga0207674_101808382 358
157 3300026121 Ga0207683_10021066 Ga0207683_100210663 358
158 3300028380 Ga0268265_10041936 Ga0268265_100419361 358
159 3300028381 Ga0268264_10267588 Ga0268264_102675881 358
160 3300034819 Ga0373958_0016516 Ga0373958_0016516_92_1240 358
161 3300035725 Ga0373947_0068045 Ga0373947_0068045_606_1721 358
162 3300044694 Ga0466963_0005521 Ga0466963_0005521_2268_3380 358
163 3300044706 Ga0466964_0002782 Ga0466964_0002782_3029_4141 358
164 3300044842 Ga0466957_0009060 Ga0466957_0009060_3031_4143 358
165 3300045976 Ga0466967_0005143 Ga0466967_0005143_3311_4426 358
166 3300045976 Ga0466967_0155314 Ga0466967_0155314_698_1810 358
167 3300046454 Ga0495592_0019579 Ga0495592_0019579_2985_4103 358
168 3300046459 Ga0495629_0021760 Ga0495629_0021760_264_1379 358
169 3300046517 Ga0495630_0049785 Ga0495630_0049785_1883_2998 358
170 3300046533 Ga0495640_0052554 Ga0495640_0052554_1067_2182 358
171 3300046642 Ga0495634_0055350 Ga0495634_0055350_578_1693 358
172 3300046663 Ga0495635_0106627 Ga0495635_0106627_393_1538 358
173 3300046683 Ga0495658_0036304 Ga0495658_0036304_636_1751 358
174 3300046689 Ga0495613_0012660 Ga0495613_0012660_4730_5845 358
175 3300046690 Ga0495624_0029664 Ga0495624_0029664_1808_2923 358
176 3300047315 Ga0495581_0133934 Ga0495581_0133934_211_1326 358
177 3300047321 Ga0495676_0155735 Ga0495676_0155735_50_1165 358
178 3300047322 Ga0495680_0023256 Ga0495680_0023256_1904_3019 358
179 3300047471 Ga0495684_0066809 Ga0495684_0066809_1093_2208 358
180 3300048907 Ga0496104_0049875 Ga0496104_0049875_521_1669 358
181 3300048911 Ga0496108_0061648 Ga0496108_0061648_658_1806 358
182 3300048912 Ga0496109_0043225 Ga0496109_0043225_34_1176 358
183 3300048913 Ga0496110_0036616 Ga0496110_0036616_45_1193 358
184 3300048914 Ga0496111_0065900 Ga0496111_0065900_1192_2340 358
185 3300049572 Ga0501036_0002911 Ga0501036_0002911_9898_11043 358
186 3300049575 Ga0501039_0005424 Ga0501039_0005424_893_2038 358
187 3300049577 Ga0501041_0030363 Ga0501041_0030363_563_1708 358
188 3300049578 Ga0501042_0003550 Ga0501042_0003550_2728_3873 358
189 3300049579 Ga0501043_0027956 Ga0501043_0027956_2871_4016 358
190 3300049580 Ga0501046_0006355 Ga0501046_0006355_8975_10120 358
191 3300049584 Ga0501068_0012067 Ga0501068_0012067_1626_2771 358
192 3300049585 Ga0501069_0054532 Ga0501069_0054532_730_1875 358
193 3300049590 Ga0501074_0013222 Ga0501074_0013222_4147_5292 358
194 3300049591 Ga0501075_0030898 Ga0501075_0030898_2414_3559 358
195 3300049593 Ga0501077_0002613 Ga0501077_0002613_3259_4404 358
196 3300049741 Ga0501079_0003011 Ga0501079_0003011_8435_9580 358
197 3300049742 Ga0501080_0006559 Ga0501080_0006559_8308_9453 358
198 3300049744 Ga0501083_0006107 Ga0501083_0006107_5987_7132 358
199 3300049824 Ga0501045_0004481 Ga0501045_0004481_609_1754 358
200 3300050511 nmdc:mga08y16_17248_c1 nmdc:mga08y16_17248_c1_3657_4805 358
201 3300053077 Ga0495601_0117903 Ga0495601_0117903_292_1437 358
202 3300053085 Ga0495619_0005547 Ga0495619_0005547_6382_7497 358
203 3300060353 Ga0501082_0006790 Ga0501082_0006790_979_2124 358
204 3300061734 Ga0530510_0003120 Ga0530510_0003120_7767_8912 358
205 3300038443 Ga0395901_0305862 Ga0395901_0305862_380_1522 359
206 3300050515 nmdc:mga0a205_24400_c1 nmdc:mga0a205_24400_c1_1539_2693 359
207 3300054114 Ga0501084_0099502 Ga0501084_0099502_1198_2346 359
208 3300005471 Ga0070698_100038037 Ga0070698_1000380374 360
209 3300006028 Ga0070717_10020221 Ga0070717_100202213 360
210 3300006844 Ga0075428_100024429 Ga0075428_1000244291 360
211 3300006852 Ga0075433_10021142 Ga0075433_100211424 360
212 3300006871 Ga0075434_100005828 Ga0075434_1000058284 360
213 3300007076 Ga0075435_100032344 Ga0075435_1000323443 360
214 3300009094 Ga0111539_10010042 Ga0111539_100100428 360
215 3300009098 Ga0105245_10347320 Ga0105245_103473201 360
216 3300009098 Ga0105245_10411143 Ga0105245_104111431 360
217 3300009176 Ga0105242_10092488 Ga0105242_100924883 360
218 3300009177 Ga0105248_10011530 Ga0105248_100115307 360
219 3300009551 Ga0105238_10035931 Ga0105238_100359313 360
220 3300013306 Ga0163162_10201780 Ga0163162_102017802 360
221 3300025901 Ga0207688_10017894 Ga0207688_100178944 360
222 3300025907 Ga0207645_10087416 Ga0207645_100874162 360
223 3300025915 Ga0207693_10092683 Ga0207693_100926833 360
224 3300025927 Ga0207687_10083177 Ga0207687_100831771 360
225 3300025928 Ga0207700_10216674 Ga0207700_102166743 360
226 3300025933 Ga0207706_10100779 Ga0207706_101007792 360
227 3300025941 Ga0207711_10030829 Ga0207711_100308293 360
228 3300026023 Ga0207677_10091353 Ga0207677_100913533 360
229 3300026116 Ga0207674_10022430 Ga0207674_100224304 360
230 3300027907 Ga0207428_10036615 Ga0207428_100366155 360
231 3300035120 Ga0373957_0043644 Ga0373957_0043644_261_1376 360
232 3300036401 Ga0373937_0030316 Ga0373937_0030316_3373_4488 360
233 3300046463 Ga0495653_0027976 Ga0495653_0027976_1968_3083 360
234 3300046511 Ga0495608_0003819 Ga0495608_0003819_4872_5987 360
235 3300046514 Ga0495618_0070772 Ga0495618_0070772_780_1895 360
236 3300046559 Ga0495667_0012022 Ga0495667_0012022_879_1994 360
237 3300046675 Ga0495657_0020035 Ga0495657_0020035_3198_4313 360
238 3300046678 Ga0495599_0004930 Ga0495599_0004930_2914_4029 360
239 3300046679 Ga0495623_0047549 Ga0495623_0047549_611_1726 360
240 3300046680 Ga0495646_0028999 Ga0495646_0028999_2078_3193 360
241 3300046689 Ga0495613_0025165 Ga0495613_0025165_203_1354 360
242 3300046690 Ga0495624_0096050 Ga0495624_0096050_79_1194 360
243 3300046809 Ga0495600_0007954 Ga0495600_0007954_1707_2822 360
244 3300047317 Ga0495604_0008367 Ga0495604_0008367_4042_5157 360
245 3300047319 Ga0495674_0117234 Ga0495674_0117234_497_1612 360
246 3300047322 Ga0495680_0007687 Ga0495680_0007687_3639_4754 360
247 3300047444 Ga0495675_0005148 Ga0495675_0005148_6539_7654 360
248 3300047471 Ga0495684_0032603 Ga0495684_0032603_2381_3496 360
249 3300048088 Ga0495602_0013823 Ga0495602_0013823_5657_6772 360
250 3300048088 Ga0495602_0056568 Ga0495602_0056568_2104_3219 360
251 3300048913 Ga0496110_0015243 Ga0496110_0015243_1263_2462 360
252 3300048918 Ga0496115_0010598 Ga0496115_0010598_4900_6015 360
253 3300050511 nmdc:mga08y16_7663_c1 nmdc:mga08y16_7663_c1_7026_8177 360
254 3300050512 nmdc:mga0n895_14265_c1 nmdc:mga0n895_14265_c1_4282_5436 360
255 3300053077 Ga0495601_0177239 Ga0495601_0177239_74_1189 360
256 3300039438 Ga0436360_0560791 Ga0436360_0560791_528_1646 361
257 3300050507 nmdc:mga05p37_134912_c1 nmdc:mga05p37_134912_c1_1817_2935 361
258 3300005336 Ga0070680_100023700 Ga0070680_1000237005 362
259 3300005445 Ga0070708_100246732 Ga0070708_1002467321 362
260 3300005458 Ga0070681_10014813 Ga0070681_100148135 362
261 3300005530 Ga0070679_100085037 Ga0070679_1000850374 362
262 3300009093 Ga0105240_10038750 Ga0105240_1003875010 362
263 3300035410 Ga0373924_0036460 Ga0373924_0036460_298_1419 362
264 3300035692 Ga0373935_0073386 Ga0373935_0073386_12_1133 362
265 3300035695 Ga0373927_0063614 Ga0373927_0063614_301_1422 362
266 3300035724 Ga0373933_0086191 Ga0373933_0086191_21_1142 362
267 3300035725 Ga0373947_0068108 Ga0373947_0068108_41_1162 362
268 3300037068 Ga0373925_0076798 Ga0373925_0076798_1230_2351 362
269 3300046492 Ga0495585_0074859 Ga0495585_0074859_280_1422 362
270 3300049576 Ga0501040_0189141 Ga0501040_0189141_120_1244 362
271 3300049824 Ga0501045_0094963 Ga0501045_0094963_641_1765 362
272 3300005536 Ga0070697_100140243 Ga0070697_1001402432 363
273 3300009148 Ga0105243_10079721 Ga0105243_100797213 363
274 3300009176 Ga0105242_10301250 Ga0105242_103012501 363
275 3300025935 Ga0207709_10128340 Ga0207709_101283401 363
276 3300035691 Ga0373931_0123775 Ga0373931_0123775_97_1215 363
277 3300037312 Ga0395899_0003704 Ga0395899_0003704_9835_10962 363
278 3300037418 Ga0395900_0035599 Ga0395900_0035599_3602_4729 363
279 3300037466 Ga0395898_0039142 Ga0395898_0039142_1715_2842 363
280 3300037471 Ga0395905_0260712 Ga0395905_0260712_154_1281 363
281 3300038443 Ga0395901_0244301 Ga0395901_0244301_646_1773 363
282 3300045976 Ga0466967_0201087 Ga0466967_0201087_500_1642 363
283 3300005329 Ga0070683_100013383 Ga0070683_1000133833 366
284 3300005535 Ga0070684_100008288 Ga0070684_1000082888 366
285 3300005577 Ga0068857_100027256 Ga0068857_1000272563 366
286 3300005937 Ga0081455_10169928 Ga0081455_101699283 366
287 3300006175 Ga0070712_100039241 Ga0070712_1000392413 366
288 3300025915 Ga0207693_10052205 Ga0207693_100522052 366
289 3300025944 Ga0207661_10043525 Ga0207661_100435256 366
290 3300026116 Ga0207674_10002131 Ga0207674_1000213121 366
291 3300048907 Ga0496104_0007884 Ga0496104_0007884_5338_6477 366
292 3300048908 Ga0496105_0009769 Ga0496105_0009769_4583_5722 366
293 3300050507 nmdc:mga05p37_223309_c1 nmdc:mga05p37_223309_c1_994_2124 366
294 3300005471 Ga0070698_100204161 Ga0070698_1002041612 367
295 3300005549 Ga0070704_100001582 Ga0070704_10000158212 367
296 3300005719 Ga0068861_100004620 Ga0068861_1000046203 367
297 3300005843 Ga0068860_100136828 Ga0068860_1001368282 367
298 3300006058 Ga0075432_10001799 Ga0075432_100017994 367
299 3300006844 Ga0075428_100039421 Ga0075428_1000394214 367
300 3300006847 Ga0075431_100010011 Ga0075431_1000100116 367
301 3300006852 Ga0075433_10011686 Ga0075433_100116864 367
302 3300006871 Ga0075434_100007538 Ga0075434_1000075383 367
303 3300025961 Ga0207712_10037324 Ga0207712_100373242 367
304 3300027907 Ga0207428_10000597 Ga0207428_1000059730 367
305 3300027907 Ga0207428_10000612 Ga0207428_1000061219 367
306 3300037312 Ga0395899_0005616 Ga0395899_0005616_1610_2749 367
307 3300037312 Ga0395899_0020638 Ga0395899_0020638_2758_3903 367
308 3300037418 Ga0395900_0011358 Ga0395900_0011358_3843_4988 367
309 3300037418 Ga0395900_0020004 Ga0395900_0020004_1979_3118 367
310 3300037466 Ga0395898_0031515 Ga0395898_0031515_3729_4868 367
311 3300037466 Ga0395898_0268485 Ga0395898_0268485_361_1503 367
312 3300037471 Ga0395905_0020103 Ga0395905_0020103_5105_6244 367
313 3300037471 Ga0395905_0024628 Ga0395905_0024628_3911_5056 367
314 3300038443 Ga0395901_0087819 Ga0395901_0087819_988_2133 367
315 3300048917 Ga0496114_0126572 Ga0496114_0126572_874_2013 367
316 3300050507 nmdc:mga05p37_200162_c1 nmdc:mga05p37_200162_c1_22_1161 367
317 3300050509 nmdc:mga0qj67_4158_c1 nmdc:mga0qj67_4158_c1_7202_8341 367
318 3300050510 nmdc:mga06r32_30480_c1 nmdc:mga06r32_30480_c1_1807_2946 367
319 3300050511 nmdc:mga08y16_126060_c1 nmdc:mga08y16_126060_c1_1498_2637 367
320 3300050512 nmdc:mga0n895_387574_c1 nmdc:mga0n895_387574_c1_147_1286 367
321 3300005364 Ga0070673_100100796 Ga0070673_1001007962 368
322 3300005459 Ga0068867_100066769 Ga0068867_1000667694 368
323 3300005535 Ga0070684_100193799 Ga0070684_1001937992 368
324 3300005545 Ga0070695_100077719 Ga0070695_1000777193 368
325 3300005549 Ga0070704_100236631 Ga0070704_1002366312 368
326 3300005615 Ga0070702_100159756 Ga0070702_1001597562 368
327 3300005718 Ga0068866_10062500 Ga0068866_100625003 368
328 3300005937 Ga0081455_10015172 Ga0081455_100151727 368
329 3300006881 Ga0068865_100206360 Ga0068865_1002063602 368
330 3300009148 Ga0105243_10009871 Ga0105243_100098713 368
331 3300010375 Ga0105239_10113594 Ga0105239_101135945 368
332 3300014326 Ga0157380_10267225 Ga0157380_102672252 368
333 3300025901 Ga0207688_10005746 Ga0207688_100057466 368
334 3300026118 Ga0207675_100133465 Ga0207675_1001334653 368
335 3300031731 Ga0307405_10089568 Ga0307405_100895683 368
336 3300037312 Ga0395899_0003576 Ga0395899_0003576_2137_3279 368
337 3300037418 Ga0395900_0002509 Ga0395900_0002509_7820_8962 368
338 3300037418 Ga0395900_0182108 Ga0395900_0182108_941_2086 368
339 3300037466 Ga0395898_0010957 Ga0395898_0010957_6392_7534 368
340 3300037466 Ga0395898_0223399 Ga0395898_0223399_276_1421 368
341 3300037471 Ga0395905_0014012 Ga0395905_0014012_2382_3524 368
342 3300038443 Ga0395901_0014998 Ga0395901_0014998_4353_5495 368
343 3300038443 Ga0395901_0251348 Ga0395901_0251348_152_1297 368
344 3300046525 Ga0495663_0044208 Ga0495663_0044208_175_1317 368
345 3300046528 Ga0495642_0098470 Ga0495642_0098470_51_1193 368
346 3300046536 Ga0495587_0045090 Ga0495587_0045090_170_1315 368
347 3300046538 Ga0495609_0054158 Ga0495609_0054158_210_1352 368
348 3300046692 Ga0495671_0039722 Ga0495671_0039722_356_1498 368
349 3300046809 Ga0495600_0098998 Ga0495600_0098998_547_1692 368
350 3300048906 Ga0496103_0150855 Ga0496103_0150855_332_1474 368
351 3300048911 Ga0496108_0080591 Ga0496108_0080591_229_1371 368
352 3300048912 Ga0496109_0020397 Ga0496109_0020397_3458_4600 368
353 3300005329 Ga0070683_100011873 Ga0070683_1000118734 369
354 3300005329 Ga0070683_100087096 Ga0070683_1000870964 369
355 3300005535 Ga0070684_100110415 Ga0070684_1001104153 369
356 3300005535 Ga0070684_100138515 Ga0070684_1001385153 369
357 3300005577 Ga0068857_100048240 Ga0068857_1000482403 369
358 3300005614 Ga0068856_100271507 Ga0068856_1002715072 369
359 3300005937 Ga0081455_10051279 Ga0081455_100512793 369
360 3300005983 Ga0081540_1000879 Ga0081540_100087928 369
361 3300006844 Ga0075428_100007325 Ga0075428_1000073253 369
362 3300006846 Ga0075430_100082386 Ga0075430_1000823862 369
363 3300006880 Ga0075429_100214842 Ga0075429_1002148423 369
364 3300009098 Ga0105245_10247230 Ga0105245_102472301 369
365 3300009147 Ga0114129_10089440 Ga0114129_100894403 369
366 3300009148 Ga0105243_10032066 Ga0105243_100320662 369
367 3300025944 Ga0207661_10011462 Ga0207661_100114622 369
368 3300037418 Ga0395900_0032470 Ga0395900_0032470_4192_5343 369
369 3300037418 Ga0395900_0044769 Ga0395900_0044769_2322_3476 369
370 3300037418 Ga0395900_0095862 Ga0395900_0095862_1576_2715 369
371 3300037418 Ga0395900_0114443 Ga0395900_0114443_338_1483 369
372 3300037466 Ga0395898_0214444 Ga0395898_0214444_511_1662 369
373 3300037471 Ga0395905_0238415 Ga0395905_0238415_378_1523 369
374 3300038443 Ga0395901_0019865 Ga0395901_0019865_3624_4763 369
375 3300038443 Ga0395901_0100214 Ga0395901_0100214_1717_2862 369
376 3300042461 Ga0439460_0017901 Ga0439460_0017901_329_1468 369
377 3300046520 Ga0495637_0029404 Ga0495637_0029404_963_2123 369
378 3300046794 Ga0495589_0025551 Ga0495589_0025551_770_1930 369
379 3300048912 Ga0496109_0076056 Ga0496109_0076056_1341_2486 369
380 3300048913 Ga0496110_0049636 Ga0496110_0049636_610_1755 369
381 3300050508 nmdc:mga09592_298439_c1 nmdc:mga09592_298439_c1_212_1357 369
382 3300050509 nmdc:mga0qj67_2994_c1 nmdc:mga0qj67_2994_c1_9526_10671 369
383 3300050510 nmdc:mga06r32_195905_c1 nmdc:mga06r32_195905_c1_414_1559 369
384 3300002155 JGI24033J26618_1001669 JGI24033J26618_10016692 370
385 3300002459 JGI24751J29686_10000223 JGI24751J29686_100002233 370
386 3300002459 JGI24751J29686_10007378 JGI24751J29686_100073782 370
387 3300005329 Ga0070683_100001131 Ga0070683_10000113115 370
388 3300005331 Ga0070670_100011290 Ga0070670_1000112905 370
389 3300005347 Ga0070668_100122997 Ga0070668_1001229972 370
390 3300005354 Ga0070675_100187551 Ga0070675_1001875513 370
391 3300005356 Ga0070674_100009469 Ga0070674_1000094692 370
392 3300005406 Ga0070703_10003075 Ga0070703_100030753 370
393 3300005436 Ga0070713_100160823 Ga0070713_1001608233 370
394 3300005441 Ga0070700_100019689 Ga0070700_1000196893 370
395 3300005459 Ga0068867_100114305 Ga0068867_1001143052 370
396 3300005535 Ga0070684_100000718 Ga0070684_1000007183 370
397 3300005535 Ga0070684_100128526 Ga0070684_1001285261 370
398 3300005564 Ga0070664_100019961 Ga0070664_1000199612 370
399 3300005564 Ga0070664_100098038 Ga0070664_1000980381 370
400 3300005618 Ga0068864_100080192 Ga0068864_1000801922 370
401 3300005618 Ga0068864_100150585 Ga0068864_1001505852 370
402 3300005718 Ga0068866_10165344 Ga0068866_101653441 370
403 3300005840 Ga0068870_10004753 Ga0068870_100047533 370
404 3300005840 Ga0068870_10087930 Ga0068870_100879302 370
405 3300005841 Ga0068863_100028952 Ga0068863_1000289522 370
406 3300005937 Ga0081455_10023102 Ga0081455_100231022 370
407 3300006028 Ga0070717_10046917 Ga0070717_100469173 370
408 3300006844 Ga0075428_100068594 Ga0075428_1000685942 370
409 3300006846 Ga0075430_100010189 Ga0075430_1000101894 370
410 3300006852 Ga0075433_10000149 Ga0075433_1000014934 370
411 3300009147 Ga0114129_10000667 Ga0114129_1000066736 370
412 3300011119 Ga0105246_10022863 Ga0105246_100228632 370
413 3300014325 Ga0163163_10263831 Ga0163163_102638312 370
414 3300014326 Ga0157380_10004114 Ga0157380_100041143 370
415 3300014745 Ga0157377_10037023 Ga0157377_100370232 370
416 3300025885 Ga0207653_10001669 Ga0207653_100016696 370
417 3300025899 Ga0207642_10148628 Ga0207642_101486281 370
418 3300025908 Ga0207643_10114293 Ga0207643_101142932 370
419 3300025934 Ga0207686_10195907 Ga0207686_101959072 370
420 3300025936 Ga0207670_10115103 Ga0207670_101151031 370
421 3300025937 Ga0207669_10020000 Ga0207669_100200003 370
422 3300025944 Ga0207661_10003786 Ga0207661_100037862 370
423 3300026075 Ga0207708_10019504 Ga0207708_100195043 370
424 3300026089 Ga0207648_10137370 Ga0207648_101373702 370
425 3300026095 Ga0207676_10001154 Ga0207676_100011543 370
426 3300026116 Ga0207674_10000474 Ga0207674_100004743 370
427 3300026118 Ga0207675_100094356 Ga0207675_1000943563 370
428 3300027907 Ga0207428_10066471 Ga0207428_100664712 370
429 3300028380 Ga0268265_10133410 Ga0268265_101334102 370
430 3300031251 Ga0265327_10004847 Ga0265327_100048476 370
431 3300032002 Ga0307416_100028459 Ga0307416_1000284595 370
432 3300037312 Ga0395899_0024678 Ga0395899_0024678_2637_3818 370
433 3300037418 Ga0395900_0003775 Ga0395900_0003775_1498_2679 370
434 3300037466 Ga0395898_0008185 Ga0395898_0008185_6114_7295 370
435 3300037471 Ga0395905_0017698 Ga0395905_0017698_3470_4651 370
436 3300038443 Ga0395901_0004795 Ga0395901_0004795_5250_6431 370
437 3300045051 Ga0451576_0098706 Ga0451576_0098706_260_1459 370
438 3300046523 Ga0495644_0065961 Ga0495644_0065961_93_1289 370
439 3300048912 Ga0496109_0021245 Ga0496109_0021245_799_1938 370
440 3300049575 Ga0501039_0141218 Ga0501039_0141218_536_1684 370
441 3300050508 nmdc:mga09592_48952_c1 nmdc:mga09592_48952_c1_1777_2958 370
442 3300050511 nmdc:mga08y16_60836_c1 nmdc:mga08y16_60836_c1_1202_2383 370
443 3300050515 nmdc:mga0a205_51265_c1 nmdc:mga0a205_51265_c1_408_1589 370

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

8

119

0.96

PF00211

Guanylate_cyc

Adenylate and Guanylate cyclase catalytic domain

183

368

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3t6k-assembly2.cif.gz_B crystal structure of a putative response regulator (caur_3799) from chloroflexus aurantiacus j-10-fl at 1.86 a resolution 0.9606 5 121
6rh1-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 d53a ph 7 0.9594 4 120
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9568 6 121
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9563 6 121
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9489 4 124
ID Description Score Start End Superfamily
af_I1NCE1_621_722_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9662 5 72 3.40.50.2300
af_P30855_946_1081_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9459 5 119 3.40.50.2300
4nicD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9458 6 121 3.40.50.2300
1nxoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9451 6 121 3.40.50.2300
3gt7A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9429 4 121 3.40.50.2300
ID Description Score Start End GO Terms
AF-L9PJN4-F1-model_v4 deleted 0.9783 5 136
AF-A0A358QP21-F1-model_v4 Hybrid sensor histidine kinase/response regulator 0.9757 9 122 GO:0000160
GO:0016301
AF-A0A7C4UQ69-F1-model_v4 Response regulator 0.975 4 118 GO:0000160
AF-A0A7C3H2C9-F1-model_v4 Response regulator 0.9707 4 121 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A0F9CXP9-F1-model_v4 Response regulatory domain-containing protein 0.9704 4 127 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0010181
GO:0032993

Feature Viewer

pLDDT pTM Quality
84.94 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map