F445165

General Info

Members Datasets Scaffolds Average Seq Length
443 263 886 123

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0033099|Ga0501034_0033099_2115_2522
Length 135
Sequence MTDTSERKFTAEHEWLDIDPSAGSGQGTTITIGITDFAAEKLGDVVFVELPAVGSTVSAGRVVGEIESTKSVGELFAPVDGTVVEVNDEVVANPELVNEDPYGRGWMIKVEVADAAVLDSADLLDFDAYTALVGE

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
83 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
86 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
126 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
127 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
143 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
144 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
145 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
146 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
147 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
148 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
149 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
150 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
151 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
152 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
153 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
154 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
155 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
158 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
159 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
185 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
188 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
207 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
208 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
209 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
215 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
218 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
223 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
224 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
225 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
226 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
227 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
228 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
229 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
230 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
231 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
232 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
233 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
234 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
235 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
236 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
237 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
238 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
239 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
240 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
243 2643221549 Agromyces sp. Root1464 Isolate Unclassified
244 2643221616 Leifsonia sp. Root227 Isolate Unclassified
245 2643221619 Agromyces sp. Root81 Isolate Unclassified
246 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
247 2808606372 Agromyces sp. 23-23 Isolate Unclassified
248 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
249 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
250 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
251 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
252 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
253 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
254 2919395869 Microbacterium resistens 2980 Isolate Unclassified
255 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
256 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
257 2928153084 Leifsonia sp. 563 Isolate Unclassified
258 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
259 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
260 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
261 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
262 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
263 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.45
Metatranscriptomes 1.81
Isolates 4.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.77
Nodule 0
Rhizoplane 9.03
Rhizosphere 64.79
Stem 0
Stem Tuber 0.23
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0033099 3300049571 Bacteria 5248
2 JGI24740J21852_10040512 3300001979 Bacteria 1412
3 JGI24737J22298_10035052 3300001990 Bacteria 1554
4 JGI24735J21928_10000532 3300002067 Bacteria 13458
5 JGI25164J39214_1000715 3300002772 Bacteria 12633
6 JGI25165J46597_1000004 3300003214 Bacteria 667510
7 Ga0006562J51391_1021236 3300003578 Bacteria 11150
8 Ga0006562J51391_1021237 3300003578 Bacteria 4600
9 Ga0055539_1000005 3300003752 Bacteria 609598
10 Ga0055533_1000001 3300003756 Bacteria 1863437
11 Ga0055532_1006167 3300003758 Bacteria 1621
12 Ga0055525_1000448 3300003759 Bacteria 23663
13 Ga0055525_1002883 3300003759 Bacteria 1625
14 Ga0055527_1000001 3300003760 Bacteria 850044
15 Ga0055542_1022351 3300003762 Bacteria 900
16 Ga0055529_1000019 3300003763 Bacteria 332786
17 Ga0055529_1016728 3300003763 Bacteria 921
18 Ga0055541_1002712 3300003841 Bacteria 3461
19 Ga0065714_10266707 3300005288 Bacteria 746
20 Ga0070658_10100848 3300005327 Bacteria 2386
21 Ga0070658_11270332 3300005327 Bacteria 640
22 Ga0070676_10421475 3300005328 Bacteria 933
23 Ga0068869_100078814 3300005334 Bacteria 2454
24 Ga0070682_101886578 3300005337 Bacteria 523
25 Ga0068868_100016229 3300005338 Bacteria 5526
26 Ga0070660_100070203 3300005339 Bacteria 2733
27 Ga0070661_100202451 3300005344 Bacteria 1517
28 Ga0070668_100541951 3300005347 Bacteria 1012
29 Ga0070671_100289973 3300005355 Bacteria 1393
30 Ga0070667_100060637 3300005367 Bacteria 3201
31 Ga0070709_10063663 3300005434 Bacteria 2356
32 Ga0070710_10044935 3300005437 Bacteria 2453
33 Ga0070663_101572199 3300005455 Bacteria 586
34 Ga0070678_100106261 3300005456 Bacteria 2187
35 Ga0070685_10319254 3300005466 Bacteria 1052
36 Ga0070679_101619262 3300005530 Bacteria 595
37 Ga0068853_100074633 3300005539 Bacteria 2959
38 Ga0068853_100270130 3300005539 Bacteria 1566
39 Ga0070672_100919809 3300005543 Bacteria 773
40 Ga0070665_101035576 3300005548 Bacteria 833
41 Ga0070665_101553529 3300005548 Bacteria 670
42 Ga0068855_100073223 3300005563 Bacteria 3981
43 Ga0068855_100182537 3300005563 Bacteria 2371
44 Ga0068855_100186968 3300005563 Bacteria 2339
45 Ga0068857_100012086 3300005577 Bacteria 7507
46 Ga0068857_100193366 3300005577 Bacteria 1853
47 Ga0068854_100689426 3300005578 Bacteria 881
48 Ga0068856_100246078 3300005614 Bacteria 1803
49 Ga0068856_100265439 3300005614 Bacteria 1732
50 Ga0068856_100318779 3300005614 Bacteria 1572
51 Ga0068856_101625729 3300005614 Bacteria 659
52 Ga0068856_102234100 3300005614 Bacteria 556
53 Ga0068852_100010253 3300005616 Bacteria 6989
54 Ga0068852_100011554 3300005616 Bacteria 6655
55 Ga0068852_100790517 3300005616 Bacteria 963
56 Ga0068852_101618554 3300005616 Bacteria 670
57 Ga0068864_100439757 3300005618 Bacteria 1246
58 Ga0068851_10000009 3300005834 Bacteria 217844
59 Ga0068863_100635763 3300005841 Bacteria 1058
60 Ga0068858_100000839 3300005842 Bacteria 31914
61 Ga0075365_10046743 3300006038 Bacteria 2843
62 Ga0075365_10785932 3300006038 Bacteria 672
63 Ga0075364_10001010 3300006051 Bacteria 14910
64 Ga0075364_10039496 3300006051 Bacteria 3060
65 Ga0075369_10376458 3300006186 Bacteria 668
66 Ga0097621_101847885 3300006237 Bacteria 576
67 Ga0105244_10355396 3300009036 Bacteria 675
68 Ga0105240_10094273 3300009093 Bacteria 3652
69 Ga0105240_10202397 3300009093 Bacteria 2326
70 Ga0105240_10453750 3300009093 Bacteria 1434
71 Ga0105240_10658193 3300009093 Bacteria 1147
72 Ga0111539_10527527 3300009094 Bacteria 1376
73 Ga0105245_10051202 3300009098 Bacteria 3702
74 Ga0105245_10440717 3300009098 Bacteria 1309
75 Ga0105245_11811293 3300009098 Bacteria 663
76 Ga0105245_12437327 3300009098 Bacteria 577
77 Ga0105247_10048167 3300009101 Bacteria 2617
78 Ga0105243_10336378 3300009148 Bacteria 1381
79 Ga0105241_10001322 3300009174 Bacteria 18835
80 Ga0105241_10677412 3300009174 Bacteria 939
81 Ga0105241_11075561 3300009174 Bacteria 756
82 Ga0105248_10000533 3300009177 Bacteria 43245
83 Ga0105248_10159522 3300009177 Bacteria 2544
84 Ga0105237_10000898 3300009545 Bacteria 40152
85 Ga0105237_10097526 3300009545 Bacteria 2930
86 Ga0105237_10738558 3300009545 Bacteria 991
87 Ga0105238_10010729 3300009551 Bacteria 9201
88 Ga0105238_10291766 3300009551 Bacteria 1613
89 Ga0105249_10185366 3300009553 Bacteria 2028
90 Ga0105246_10088391 3300011119 Bacteria 2226
91 Ga0105246_10943449 3300011119 Bacteria 777
92 Ga0157371_10004593 3300013102 Bacteria 11988
93 Ga0157370_10483620 3300013104 Bacteria 1137
94 Ga0157370_11650293 3300013104 Bacteria 576
95 Ga0157369_10071225 3300013105 Bacteria 3732
96 Ga0157369_10241799 3300013105 Bacteria 1885
97 Ga0157369_11510659 3300013105 Bacteria 683
98 Ga0157369_12453825 3300013105 Bacteria 528
99 Ga0157374_10571927 3300013296 Bacteria 1139
100 Ga0163162_10429800 3300013306 Bacteria 1453
101 Ga0163162_10884051 3300013306 Bacteria 1007
102 Ga0163162_13137563 3300013306 Bacteria 530
103 Ga0157372_10353026 3300013307 Bacteria 1713
104 Ga0157375_10719830 3300013308 Bacteria 1151
105 Ga0163163_10149031 3300014325 Bacteria 2384
106 Ga0157380_10196816 3300014326 Bacteria 1784
107 Ga0157379_10002021 3300014968 Bacteria 16811
108 Ga0163161_10199355 3300017792 Bacteria 1542
109 Ga0197907_10877910 3300020069 Bacteria 2488
110 Ga0206350_10030166 3300020080 Bacteria 1148
111 Ga0206353_11026904 3300020082 Bacteria 4734
112 Ga0224712_10160219 3300022467 Bacteria 1003
113 Ga0209566_100105 3300025225 Bacteria 125766
114 Ga0209674_100001 3300025226 Bacteria 4013750
115 Ga0209672_100006 3300025228 Bacteria 1004497
116 Ga0209147_103179 3300025229 Bacteria 3368
117 Ga0209563_100001 3300025230 Bacteria 4013775
118 Ga0209563_100404 3300025230 Bacteria 15438
119 Ga0209563_120257 3300025230 Bacteria 750
120 Ga0207427_100010 3300025231 Bacteria 648610
121 Ga0209437_100550 3300025233 Bacteria 25143
122 Ga0209677_100001 3300025253 Bacteria 4013787
123 Ga0209677_101020 3300025253 Bacteria 13368
124 Ga0209148_1000015 3300025254 Bacteria 850103
125 Ga0209148_1002193 3300025254 Bacteria 7202
126 Ga0209233_1000001 3300025261 Bacteria 2992747
127 Ga0209455_1000013 3300025272 Bacteria 850103
128 Ga0209455_1000938 3300025272 Bacteria 14930
129 Ga0207656_10000001 3300025321 Bacteria 1323684
130 Ga0207656_10000003 3300025321 Bacteria 771644
131 Ga0207656_10000004 3300025321 Bacteria 632320
132 Ga0207692_10171072 3300025898 Bacteria 1259
133 Ga0207692_10264255 3300025898 Bacteria 1036
134 Ga0207688_10276059 3300025901 Bacteria 1023
135 Ga0207647_10141773 3300025904 Bacteria 1408
136 Ga0207647_10320944 3300025904 Bacteria 879
137 Ga0207643_10100200 3300025908 Bacteria 1698
138 Ga0207705_10161073 3300025909 Bacteria 1686
139 Ga0207705_11051340 3300025909 Bacteria 628
140 Ga0207654_10000003 3300025911 Bacteria 1030378
141 Ga0207695_10004194 3300025913 Bacteria 19808
142 Ga0207695_10067802 3300025913 Bacteria 3658
143 Ga0207695_10294006 3300025913 Bacteria 1516
144 Ga0207695_10400574 3300025913 Bacteria 1257
145 Ga0207671_10000001 3300025914 Bacteria 1318881
146 Ga0207671_10060217 3300025914 Bacteria 2816
147 Ga0207671_10445383 3300025914 Bacteria 1031
148 Ga0207657_10002482 3300025919 Bacteria 19943
149 Ga0207694_10000305 3300025924 Bacteria 46177
150 Ga0207694_10054758 3300025924 Bacteria 3096
151 Ga0207650_10500551 3300025925 Bacteria 1015
152 Ga0207659_10414807 3300025926 Bacteria 1128
153 Ga0207687_10768096 3300025927 Bacteria 821
154 Ga0207664_10534914 3300025929 Bacteria 1051
155 Ga0207644_10102476 3300025931 Bacteria 2153
156 Ga0207690_10000386 3300025932 Bacteria 29106
157 Ga0207709_10072605 3300025935 Bacteria 2189
158 Ga0207691_10582229 3300025940 Bacteria 948
159 Ga0207711_10000906 3300025941 Bacteria 28505
160 Ga0207711_10117580 3300025941 Bacteria 2371
161 Ga0207689_10199533 3300025942 Bacteria 1651
162 Ga0207667_10002288 3300025949 Bacteria 24073
163 Ga0207667_10011003 3300025949 Bacteria 10543
164 Ga0207667_10061471 3300025949 Bacteria 3929
165 Ga0207667_10399635 3300025949 Bacteria 1399
166 Ga0207712_10129247 3300025961 Bacteria 1922
167 Ga0207668_11736157 3300025972 Bacteria 563
168 Ga0207658_10083265 3300025986 Bacteria 2458
169 Ga0207677_10061631 3300026023 Bacteria 2599
170 Ga0207703_10000625 3300026035 Bacteria 35584
171 Ga0207639_10057114 3300026041 Bacteria 2995
172 Ga0207639_10548986 3300026041 Bacteria 1061
173 Ga0207639_10865347 3300026041 Bacteria 844
174 Ga0207678_10250870 3300026067 Bacteria 1515
175 Ga0207678_10392612 3300026067 Bacteria 1201
176 Ga0207702_10100661 3300026078 Bacteria 2550
177 Ga0207702_10544647 3300026078 Bacteria 1135
178 Ga0207676_10166232 3300026095 Bacteria 1917
179 Ga0207674_10007090 3300026116 Bacteria 13097
180 Ga0207674_10225070 3300026116 Bacteria 1824
181 Ga0207674_10578370 3300026116 Bacteria 1085
182 Ga0207683_10133880 3300026121 Bacteria 2230
183 Ga0207698_10008031 3300026142 Bacteria 6655
184 Ga0207698_10009582 3300026142 Bacteria 6185
185 Ga0268266_10428204 3300028379 Bacteria 1255
186 Ga0268266_12140025 3300028379 Bacteria 532
187 Ga0268264_11738435 3300028381 Bacteria 634
188 Ga0307515_10067151 3300028794 Bacteria 4952
189 Ga0307515_10074654 3300028794 Bacteria 4531
190 Ga0307515_10248813 3300028794 Bacteria 1534
191 Ga0265338_10069181 3300028800 Bacteria 3035
192 Ga0265332_10143132 3300031238 Bacteria 1001
193 Ga0265339_10021205 3300031249 Bacteria 3785
194 Ga0307509_10858461 3300031507 Bacteria 572
195 Ga0307408_100916667 3300031548 Bacteria 803
196 Ga0307408_101348693 3300031548 Bacteria 670
197 Ga0307514_10002865 3300031649 Bacteria 17241
198 Ga0307405_10677754 3300031731 Bacteria 851
199 Ga0307413_10110326 3300031824 Bacteria 1841
200 Ga0307410_10142339 3300031852 Bacteria 1776
201 Ga0307410_11590913 3300031852 Bacteria 577
202 Ga0307406_10236304 3300031901 Bacteria 1368
203 Ga0307406_11302768 3300031901 Bacteria 634
204 Ga0307412_11063994 3300031911 Bacteria 718
205 Ga0307409_100132495 3300031995 Bacteria 2133
206 Ga0307409_100468358 3300031995 Bacteria 1220
207 Ga0307416_100675790 3300032002 Bacteria 1120
208 Ga0307416_100763892 3300032002 Bacteria 1060
209 Ga0307416_100948384 3300032002 Bacteria 962
210 Ga0307414_10219560 3300032004 Bacteria 1560
211 Ga0307414_11419811 3300032004 Bacteria 645
212 Ga0307415_100146207 3300032126 Bacteria 1813
213 Ga0307415_100756577 3300032126 Bacteria 883
214 Ga0307415_102082125 3300032126 Bacteria 554
215 Ga0395899_0011794 3300037312 Bacteria 6688
216 Ga0395899_0381605 3300037312 Bacteria 936
217 Ga0395900_0006021 3300037418 Bacteria 12649
218 Ga0395898_0000015 3300037466 Bacteria 439819
219 Ga0439466_0250240 3300041411 Bacteria 537
220 Ga0439465_0052049 3300041413 Bacteria 1343
221 Ga0451791_0153954 3300041451 Bacteria 622
222 Ga0451791_0274962 3300041451 Bacteria 750
223 Ga0451791_0415820 3300041451 Bacteria 759
224 Ga0451791_1392788 3300041451 Bacteria 514
225 Ga0451791_1445672 3300041451 Bacteria 878
226 Ga0451791_1664969 3300041451 Bacteria 588
227 Ga0451793_0905247 3300041452 Bacteria 845
228 Ga0451793_1909176 3300041452 Bacteria 1060
229 Ga0451802_1054913 3300041460 Bacteria 578
230 Ga0451802_1377088 3300041460 Bacteria 627
231 Ga0451806_196865 3300041462 Bacteria 1343
232 Ga0451806_292452 3300041462 Bacteria 1145
233 Ga0451804_1083078 3300041463 Bacteria 723
234 Ga0451807_2657271 3300041486 Bacteria 773
235 Ga0451839_1188536 3300041496 Bacteria 654
236 Ga0451843_1534693 3300041509 Bacteria 632
237 Ga0451855_1825245 3300041511 Bacteria 530
238 Ga0450908_107830 3300042184 Bacteria 513
239 Ga0466972_0046782 3300044658 Bacteria 2094
240 Ga0466972_0050827 3300044658 Bacteria 2000
241 Ga0466972_0106687 3300044658 Bacteria 1324
242 Ga0466972_0279237 3300044658 Bacteria 780
243 Ga0466965_0045416 3300044683 Bacteria 2173
244 Ga0466965_0075867 3300044683 Bacteria 1696
245 Ga0466965_0312553 3300044683 Bacteria 854
246 Ga0466961_0070342 3300044693 Bacteria 2221
247 Ga0466971_0576030 3300044719 Bacteria 560
248 Ga0466968_0050511 3300044735 Bacteria 1775
249 Ga0466970_0478684 3300044765 Bacteria 715
250 Ga0466970_0804860 3300044765 Bacteria 550
251 Ga0466957_0011563 3300044842 Bacteria 5098
252 Ga0466957_0070403 3300044842 Bacteria 2161
253 Ga0466960_0070131 3300044901 Bacteria 1743
254 Ga0466960_0574915 3300044901 Bacteria 667
255 Ga0466959_0035554 3300045049 Bacteria 3683
256 Ga0466958_0034963 3300045836 Bacteria 3000
257 Ga0495638_0137910 3300046460 Bacteria 1426
258 Ga0495606_0094693 3300046507 Bacteria 1830
259 Ga0495625_0131026 3300046660 Bacteria 1698
260 Ga0495672_0009811 3300047320 Bacteria 6892
261 Ga0495673_0095992 3300047469 Bacteria 1205
262 Ga0496100_0050922 3300048903 Bacteria 2685
263 Ga0496100_0269126 3300048903 Bacteria 1266
264 Ga0496101_0014615 3300048904 Bacteria 5279
265 Ga0496101_0314584 3300048904 Bacteria 1228
266 Ga0496102_0033073 3300048905 Bacteria 4646
267 Ga0496102_0064186 3300048905 Bacteria 3364
268 Ga0496102_0233434 3300048905 Bacteria 1734
269 Ga0496103_0121635 3300048906 Bacteria 1663
270 Ga0496103_0405861 3300048906 Bacteria 875
271 Ga0496104_0088646 3300048907 Bacteria 2956
272 Ga0496104_0104968 3300048907 Bacteria 2707
273 Ga0496104_0212693 3300048907 Bacteria 1845
274 Ga0496105_0012241 3300048908 Bacteria 6792
275 Ga0496105_0016403 3300048908 Bacteria 5914
276 Ga0496107_1176176 3300048910 Bacteria 552
277 Ga0496108_0877127 3300048911 Bacteria 771
278 Ga0496109_0388749 3300048912 Bacteria 1318
279 Ga0496110_0647701 3300048913 Bacteria 956
280 Ga0496113_0162867 3300048916 Bacteria 1764
281 Ga0496114_0100567 3300048917 Bacteria 2467
282 Ga0496114_0228734 3300048917 Bacteria 1633
283 Ga0496114_1734956 3300048917 Bacteria 512
284 Ga0496115_0021594 3300048918 Bacteria 4974
285 Ga0496115_0034419 3300048918 Bacteria 4003
286 Ga0496115_0058536 3300048918 Bacteria 3101
287 Ga0496115_0150980 3300048918 Bacteria 1918
288 Ga0496117_0000120 3300048920 Bacteria 171697
289 Ga0496117_0001880 3300048920 Bacteria 28246
290 Ga0496117_0027383 3300048920 Bacteria 4443
291 Ga0496117_0062405 3300048920 Bacteria 2554
292 Ga0496117_0166814 3300048920 Bacteria 1283
293 Ga0496117_0552755 3300048920 Bacteria 548
294 Ga0496118_0015499 3300048921 Bacteria 7052
295 Ga0496118_0039288 3300048921 Bacteria 3778
296 Ga0496118_0093121 3300048921 Bacteria 2066
297 Ga0496119_0002415 3300048922 Bacteria 20506
298 Ga0496119_0008851 3300048922 Bacteria 8754
299 Ga0496119_0068606 3300048922 Bacteria 2087
300 Ga0496120_0004295 3300048923 Bacteria 12082
301 Ga0496120_0077017 3300048923 Bacteria 1816
302 Ga0496120_0134684 3300048923 Bacteria 1261
303 Ga0496120_0159144 3300048923 Bacteria 1128
304 Ga0496120_0300606 3300048923 Bacteria 735
305 Ga0496121_0000132 3300048924 Bacteria 167578
306 Ga0496121_0081464 3300048924 Bacteria 2562
307 Ga0496121_0195769 3300048924 Bacteria 1445
308 Ga0496121_0476331 3300048924 Bacteria 798
309 Ga0496122_0005732 3300048925 Bacteria 14641
310 Ga0496122_0024765 3300048925 Bacteria 5241
311 Ga0496122_0075280 3300048925 Bacteria 2383
312 Ga0496122_0126166 3300048925 Bacteria 1638
313 Ga0496122_0405329 3300048925 Bacteria 691
314 Ga0496123_0000500 3300048926 Bacteria 68065
315 Ga0496124_0050333 3300048927 Bacteria 3551
316 Ga0496125_0064529 3300048928 Bacteria 2909
317 Ga0496125_0254594 3300048928 Bacteria 1105
318 Ga0496125_0556785 3300048928 Bacteria 634
319 Ga0496126_0002482 3300048929 Bacteria 24819
320 Ga0496126_0049596 3300048929 Bacteria 3832
321 Ga0496126_0111153 3300048929 Bacteria 2386
322 Ga0496126_0111620 3300048929 Bacteria 2381
323 Ga0496126_0221903 3300048929 Bacteria 1587
324 Ga0501308_058947 3300049128 Bacteria 576
325 Ga0501315_057151 3300049531 Bacteria 624
326 Ga0501031_0019934 3300049568 Bacteria 4371
327 Ga0501031_0388753 3300049568 Bacteria 902
328 Ga0501032_0003977 3300049569 Bacteria 11209
329 Ga0501032_0120517 3300049569 Bacteria 1734
330 Ga0501032_0324607 3300049569 Bacteria 993
331 Ga0501032_0492332 3300049569 Bacteria 784
332 Ga0501032_0694484 3300049569 Bacteria 645
333 Ga0501033_0072046 3300049570 Bacteria 2538
334 Ga0501034_0002709 3300049571 Bacteria 20874
335 Ga0501034_0004461 3300049571 Bacteria 15560
336 Ga0501034_0064738 3300049571 Bacteria 3669
337 Ga0501034_0242177 3300049571 Bacteria 1749
338 Ga0501034_0266288 3300049571 Bacteria 1656
339 Ga0501034_0409255 3300049571 Bacteria 1278
340 Ga0501034_1111703 3300049571 Bacteria 671
341 Ga0501036_0001002 3300049572 Bacteria 21360
342 Ga0501037_0001216 3300049573 Bacteria 19066
343 Ga0501037_0013644 3300049573 Bacteria 5986
344 Ga0501037_0050483 3300049573 Bacteria 3044
345 Ga0501038_0000560 3300049574 Bacteria 32917
346 Ga0501039_0004184 3300049575 Bacteria 10868
347 Ga0501042_0005340 3300049578 Bacteria 8259
348 Ga0501043_0003802 3300049579 Bacteria 12412
349 Ga0501043_0033214 3300049579 Bacteria 4058
350 Ga0501043_0052111 3300049579 Bacteria 3215
351 Ga0501046_0000916 3300049580 Bacteria 28889
352 Ga0501046_0067186 3300049580 Bacteria 2792
353 Ga0501046_0134094 3300049580 Bacteria 1877
354 Ga0501046_0231109 3300049580 Bacteria 1366
355 Ga0501047_0001949 3300049581 Bacteria 19833
356 Ga0501047_0037342 3300049581 Bacteria 4697
357 Ga0501048_1271426 3300049582 Bacteria 529
358 Ga0501067_0515545 3300049583 Bacteria 669
359 Ga0501068_0022727 3300049584 Bacteria 3670
360 Ga0501069_0055571 3300049585 Bacteria 2206
361 Ga0501070_0000414 3300049586 Bacteria 38868
362 Ga0501070_0003336 3300049586 Bacteria 13945
363 Ga0501070_0013991 3300049586 Bacteria 6756
364 Ga0501070_0122635 3300049586 Bacteria 2148
365 Ga0501070_0148519 3300049586 Bacteria 1934
366 Ga0501070_0417434 3300049586 Bacteria 1084
367 Ga0501071_0001239 3300049587 Bacteria 14455
368 Ga0501071_0437178 3300049587 Bacteria 1001
369 Ga0501072_0069490 3300049588 Bacteria 2781
370 Ga0501073_0000038 3300049589 Bacteria 86286
371 Ga0501073_0055157 3300049589 Bacteria 2781
372 Ga0501073_0101084 3300049589 Bacteria 2002
373 Ga0501074_0175333 3300049590 Bacteria 1530
374 Ga0501077_0067017 3300049593 Bacteria 2277
375 Ga0501217_197726 3300049661 Bacteria 625
376 Ga0501080_0000261 3300049742 Bacteria 39938
377 Ga0501080_0060790 3300049742 Bacteria 3517
378 Ga0501080_0219516 3300049742 Bacteria 1740
379 Ga0501080_0796294 3300049742 Bacteria 829
380 Ga0501080_1822751 3300049742 Bacteria 511
381 Ga0501083_0089265 3300049744 Bacteria 2037
382 Ga0501083_0273365 3300049744 Bacteria 1099
383 Ga0501266_054214 3300049763 Bacteria 627
384 Ga0501035_0004789 3300049822 Bacteria 12837
385 Ga0501035_0008721 3300049822 Bacteria 9441
386 Ga0501035_0428878 3300049822 Bacteria 1097
387 Ga0501044_0002815 3300049823 Bacteria 19825
388 Ga0501044_0034354 3300049823 Bacteria 5317
389 Ga0501044_0219680 3300049823 Bacteria 1851
390 Ga0501045_0007075 3300049824 Bacteria 7777
391 Ga0501045_1402405 3300049824 Bacteria 507
392 nmdc:mga00v17_33496_c1 3300050491 Bacteria 3044
393 nmdc:mga00v17_97582_c1 3300050491 Bacteria 1852
394 nmdc:mga0yw44_1131225_c1 3300050492 Bacteria 529
395 nmdc:mga0yw44_484035_c1 3300050492 Bacteria 839
396 nmdc:mga0yw44_778146_c1 3300050492 Bacteria 650
397 Ga0500635_0000039 3300053080 Bacteria 93004
398 Ga0500643_000092 3300053087 Bacteria 93617
399 Ga0500651_0000505 3300053093 Bacteria 20183
400 Ga0500650_0001108 3300053098 Bacteria 7784
401 Ga0500556_0000007 3300053104 Bacteria 331400
402 Ga0500556_0000173 3300053104 Bacteria 52855
403 Ga0500562_003633 3300053108 Bacteria 3876
404 Ga0500572_001120 3300053111 Bacteria 7823
405 Ga0500593_010372 3300053117 Bacteria 3906
406 Ga0500597_137248 3300053120 Bacteria 1055
407 Ga0500559_0000370 3300053136 Bacteria 33075
408 Ga0500559_0160384 3300053136 Bacteria 1057
409 Ga0500559_0249188 3300053136 Bacteria 837
410 Ga0500568_0000008 3300053139 Bacteria 281012
411 Ga0500568_0000009 3300053139 Bacteria 270298
412 Ga0500568_0015649 3300053139 Bacteria 3392
413 Ga0500577_0012336 3300053142 Bacteria 2579
414 Ga0500588_0220700 3300053146 Bacteria 707
415 Ga0500590_031252 3300053148 Bacteria 2760
416 Ga0500616_0000058 3300053153 Bacteria 266276
417 Ga0500616_0000151 3300053153 Bacteria 116796
418 Ga0500620_000180 3300053155 Bacteria 12911
419 Ga0500645_022225 3300053730 Bacteria 1953
420 Ga0501084_0331581 3300054114 Bacteria 1285
421 Ga0501084_0580587 3300054114 Bacteria 947
422 Ga0466962_0134432 3300061719 Bacteria 1196
423 2643769704 2643221549 Bacteria 4042819
424 2644096944 2643221616 Bacteria 4066575
425 2644114358 2643221619 Bacteria 4158469
426 2723641533 2721755702 Bacteria 4373124
427 2808901484 2808606372 Bacteria 4649509
428 2844842881 2844841374 Bacteria 3917147
429 2844855920 2844852863 Bacteria 3849151
430 2857736562 2857733635 Bacteria 3532004
431 2862995226 2862993130 Bacteria 3860849
432 2884765860 2884763398 Bacteria 4091164
433 2919058854 2919055335 Bacteria 3875751
434 2919396016 2919395869 Bacteria 3704152
435 2919446818 2919443155 Bacteria 4072969
436 2919524964 2919523602 Bacteria 3788128
437 2928156838 2928153084 Bacteria 4020257
438 2935410951 2935409751 Bacteria 4179611
439 2939657192 2939657138 Bacteria 3740283
440 2964328959 2964326757 Bacteria 3290868
441 2966921742 2966921586 Bacteria 3092803
442 8056039799 8056037122 Bacteria 3854319
443 8057348296 8057345674 Bacteria 4160394
444 Ga0501034_0033099
445 JGI24740J21852_10040512
446 JGI24737J22298_10035052
447 JGI24735J21928_10000532
448 JGI25164J39214_1000715
449 JGI25165J46597_1000004
450 Ga0006562J51391_1021236
451 Ga0006562J51391_1021237
452 Ga0055539_1000005
453 Ga0055533_1000001
454 Ga0055532_1006167
455 Ga0055525_1000448
456 Ga0055525_1002883
457 Ga0055527_1000001
458 Ga0055542_1022351
459 Ga0055529_1000019
460 Ga0055529_1016728
461 Ga0055541_1002712
462 Ga0065714_10266707
463 Ga0070658_10100848
464 Ga0070658_11270332
465 Ga0070676_10421475
466 Ga0068869_100078814
467 Ga0070682_101886578
468 Ga0068868_100016229
469 Ga0070660_100070203
470 Ga0070661_100202451
471 Ga0070668_100541951
472 Ga0070671_100289973
473 Ga0070667_100060637
474 Ga0070709_10063663
475 Ga0070710_10044935
476 Ga0070663_101572199
477 Ga0070678_100106261
478 Ga0070685_10319254
479 Ga0070679_101619262
480 Ga0068853_100074633
481 Ga0068853_100270130
482 Ga0070672_100919809
483 Ga0070665_101035576
484 Ga0070665_101553529
485 Ga0068855_100073223
486 Ga0068855_100182537
487 Ga0068855_100186968
488 Ga0068857_100012086
489 Ga0068857_100193366
490 Ga0068854_100689426
491 Ga0068856_100246078
492 Ga0068856_100265439
493 Ga0068856_100318779
494 Ga0068856_101625729
495 Ga0068856_102234100
496 Ga0068852_100010253
497 Ga0068852_100011554
498 Ga0068852_100790517
499 Ga0068852_101618554
500 Ga0068864_100439757
501 Ga0068851_10000009
502 Ga0068863_100635763
503 Ga0068858_100000839
504 Ga0075365_10046743
505 Ga0075365_10785932
506 Ga0075364_10001010
507 Ga0075364_10039496
508 Ga0075369_10376458
509 Ga0097621_101847885
510 Ga0105244_10355396
511 Ga0105240_10094273
512 Ga0105240_10202397
513 Ga0105240_10453750
514 Ga0105240_10658193
515 Ga0111539_10527527
516 Ga0105245_10051202
517 Ga0105245_10440717
518 Ga0105245_11811293
519 Ga0105245_12437327
520 Ga0105247_10048167
521 Ga0105243_10336378
522 Ga0105241_10001322
523 Ga0105241_10677412
524 Ga0105241_11075561
525 Ga0105248_10000533
526 Ga0105248_10159522
527 Ga0105237_10000898
528 Ga0105237_10097526
529 Ga0105237_10738558
530 Ga0105238_10010729
531 Ga0105238_10291766
532 Ga0105249_10185366
533 Ga0105246_10088391
534 Ga0105246_10943449
535 Ga0157371_10004593
536 Ga0157370_10483620
537 Ga0157370_11650293
538 Ga0157369_10071225
539 Ga0157369_10241799
540 Ga0157369_11510659
541 Ga0157369_12453825
542 Ga0157374_10571927
543 Ga0163162_10429800
544 Ga0163162_10884051
545 Ga0163162_13137563
546 Ga0157372_10353026
547 Ga0157375_10719830
548 Ga0163163_10149031
549 Ga0157380_10196816
550 Ga0157379_10002021
551 Ga0163161_10199355
552 Ga0197907_10877910
553 Ga0206350_10030166
554 Ga0206353_11026904
555 Ga0224712_10160219
556 Ga0209566_100105
557 Ga0209674_100001
558 Ga0209672_100006
559 Ga0209147_103179
560 Ga0209563_100001
561 Ga0209563_100404
562 Ga0209563_120257
563 Ga0207427_100010
564 Ga0209437_100550
565 Ga0209677_100001
566 Ga0209677_101020
567 Ga0209148_1000015
568 Ga0209148_1002193
569 Ga0209233_1000001
570 Ga0209455_1000013
571 Ga0209455_1000938
572 Ga0207656_10000001
573 Ga0207656_10000003
574 Ga0207656_10000004
575 Ga0207692_10171072
576 Ga0207692_10264255
577 Ga0207688_10276059
578 Ga0207647_10141773
579 Ga0207647_10320944
580 Ga0207643_10100200
581 Ga0207705_10161073
582 Ga0207705_11051340
583 Ga0207654_10000003
584 Ga0207695_10004194
585 Ga0207695_10067802
586 Ga0207695_10294006
587 Ga0207695_10400574
588 Ga0207671_10000001
589 Ga0207671_10060217
590 Ga0207671_10445383
591 Ga0207657_10002482
592 Ga0207694_10000305
593 Ga0207694_10054758
594 Ga0207650_10500551
595 Ga0207659_10414807
596 Ga0207687_10768096
597 Ga0207664_10534914
598 Ga0207644_10102476
599 Ga0207690_10000386
600 Ga0207709_10072605
601 Ga0207691_10582229
602 Ga0207711_10000906
603 Ga0207711_10117580
604 Ga0207689_10199533
605 Ga0207667_10002288
606 Ga0207667_10011003
607 Ga0207667_10061471
608 Ga0207667_10399635
609 Ga0207712_10129247
610 Ga0207668_11736157
611 Ga0207658_10083265
612 Ga0207677_10061631
613 Ga0207703_10000625
614 Ga0207639_10057114
615 Ga0207639_10548986
616 Ga0207639_10865347
617 Ga0207678_10250870
618 Ga0207678_10392612
619 Ga0207702_10100661
620 Ga0207702_10544647
621 Ga0207676_10166232
622 Ga0207674_10007090
623 Ga0207674_10225070
624 Ga0207674_10578370
625 Ga0207683_10133880
626 Ga0207698_10008031
627 Ga0207698_10009582
628 Ga0268266_10428204
629 Ga0268266_12140025
630 Ga0268264_11738435
631 Ga0307515_10067151
632 Ga0307515_10074654
633 Ga0307515_10248813
634 Ga0265338_10069181
635 Ga0265332_10143132
636 Ga0265339_10021205
637 Ga0307509_10858461
638 Ga0307408_100916667
639 Ga0307408_101348693
640 Ga0307514_10002865
641 Ga0307405_10677754
642 Ga0307413_10110326
643 Ga0307410_10142339
644 Ga0307410_11590913
645 Ga0307406_10236304
646 Ga0307406_11302768
647 Ga0307412_11063994
648 Ga0307409_100132495
649 Ga0307409_100468358
650 Ga0307416_100675790
651 Ga0307416_100763892
652 Ga0307416_100948384
653 Ga0307414_10219560
654 Ga0307414_11419811
655 Ga0307415_100146207
656 Ga0307415_100756577
657 Ga0307415_102082125
658 Ga0395899_0011794
659 Ga0395899_0381605
660 Ga0395900_0006021
661 Ga0395898_0000015
662 Ga0439466_0250240
663 Ga0439465_0052049
664 Ga0451791_0153954
665 Ga0451791_0274962
666 Ga0451791_0415820
667 Ga0451791_1392788
668 Ga0451791_1445672
669 Ga0451791_1664969
670 Ga0451793_0905247
671 Ga0451793_1909176
672 Ga0451802_1054913
673 Ga0451802_1377088
674 Ga0451806_196865
675 Ga0451806_292452
676 Ga0451804_1083078
677 Ga0451807_2657271
678 Ga0451839_1188536
679 Ga0451843_1534693
680 Ga0451855_1825245
681 Ga0450908_107830
682 Ga0466972_0046782
683 Ga0466972_0050827
684 Ga0466972_0106687
685 Ga0466972_0279237
686 Ga0466965_0045416
687 Ga0466965_0075867
688 Ga0466965_0312553
689 Ga0466961_0070342
690 Ga0466971_0576030
691 Ga0466968_0050511
692 Ga0466970_0478684
693 Ga0466970_0804860
694 Ga0466957_0011563
695 Ga0466957_0070403
696 Ga0466960_0070131
697 Ga0466960_0574915
698 Ga0466959_0035554
699 Ga0466958_0034963
700 Ga0495638_0137910
701 Ga0495606_0094693
702 Ga0495625_0131026
703 Ga0495672_0009811
704 Ga0495673_0095992
705 Ga0496100_0050922
706 Ga0496100_0269126
707 Ga0496101_0014615
708 Ga0496101_0314584
709 Ga0496102_0033073
710 Ga0496102_0064186
711 Ga0496102_0233434
712 Ga0496103_0121635
713 Ga0496103_0405861
714 Ga0496104_0088646
715 Ga0496104_0104968
716 Ga0496104_0212693
717 Ga0496105_0012241
718 Ga0496105_0016403
719 Ga0496107_1176176
720 Ga0496108_0877127
721 Ga0496109_0388749
722 Ga0496110_0647701
723 Ga0496113_0162867
724 Ga0496114_0100567
725 Ga0496114_0228734
726 Ga0496114_1734956
727 Ga0496115_0021594
728 Ga0496115_0034419
729 Ga0496115_0058536
730 Ga0496115_0150980
731 Ga0496117_0000120
732 Ga0496117_0001880
733 Ga0496117_0027383
734 Ga0496117_0062405
735 Ga0496117_0166814
736 Ga0496117_0552755
737 Ga0496118_0015499
738 Ga0496118_0039288
739 Ga0496118_0093121
740 Ga0496119_0002415
741 Ga0496119_0008851
742 Ga0496119_0068606
743 Ga0496120_0004295
744 Ga0496120_0077017
745 Ga0496120_0134684
746 Ga0496120_0159144
747 Ga0496120_0300606
748 Ga0496121_0000132
749 Ga0496121_0081464
750 Ga0496121_0195769
751 Ga0496121_0476331
752 Ga0496122_0005732
753 Ga0496122_0024765
754 Ga0496122_0075280
755 Ga0496122_0126166
756 Ga0496122_0405329
757 Ga0496123_0000500
758 Ga0496124_0050333
759 Ga0496125_0064529
760 Ga0496125_0254594
761 Ga0496125_0556785
762 Ga0496126_0002482
763 Ga0496126_0049596
764 Ga0496126_0111153
765 Ga0496126_0111620
766 Ga0496126_0221903
767 Ga0501308_058947
768 Ga0501315_057151
769 Ga0501031_0019934
770 Ga0501031_0388753
771 Ga0501032_0003977
772 Ga0501032_0120517
773 Ga0501032_0324607
774 Ga0501032_0492332
775 Ga0501032_0694484
776 Ga0501033_0072046
777 Ga0501034_0002709
778 Ga0501034_0004461
779 Ga0501034_0064738
780 Ga0501034_0242177
781 Ga0501034_0266288
782 Ga0501034_0409255
783 Ga0501034_1111703
784 Ga0501036_0001002
785 Ga0501037_0001216
786 Ga0501037_0013644
787 Ga0501037_0050483
788 Ga0501038_0000560
789 Ga0501039_0004184
790 Ga0501042_0005340
791 Ga0501043_0003802
792 Ga0501043_0033214
793 Ga0501043_0052111
794 Ga0501046_0000916
795 Ga0501046_0067186
796 Ga0501046_0134094
797 Ga0501046_0231109
798 Ga0501047_0001949
799 Ga0501047_0037342
800 Ga0501048_1271426
801 Ga0501067_0515545
802 Ga0501068_0022727
803 Ga0501069_0055571
804 Ga0501070_0000414
805 Ga0501070_0003336
806 Ga0501070_0013991
807 Ga0501070_0122635
808 Ga0501070_0148519
809 Ga0501070_0417434
810 Ga0501071_0001239
811 Ga0501071_0437178
812 Ga0501072_0069490
813 Ga0501073_0000038
814 Ga0501073_0055157
815 Ga0501073_0101084
816 Ga0501074_0175333
817 Ga0501077_0067017
818 Ga0501217_197726
819 Ga0501080_0000261
820 Ga0501080_0060790
821 Ga0501080_0219516
822 Ga0501080_0796294
823 Ga0501080_1822751
824 Ga0501083_0089265
825 Ga0501083_0273365
826 Ga0501266_054214
827 Ga0501035_0004789
828 Ga0501035_0008721
829 Ga0501035_0428878
830 Ga0501044_0002815
831 Ga0501044_0034354
832 Ga0501044_0219680
833 Ga0501045_0007075
834 Ga0501045_1402405
835 nmdc:mga00v17_33496_c1
836 nmdc:mga00v17_97582_c1
837 nmdc:mga0yw44_1131225_c1
838 nmdc:mga0yw44_484035_c1
839 nmdc:mga0yw44_778146_c1
840 Ga0500635_0000039
841 Ga0500643_000092
842 Ga0500651_0000505
843 Ga0500650_0001108
844 Ga0500556_0000007
845 Ga0500556_0000173
846 Ga0500562_003633
847 Ga0500572_001120
848 Ga0500593_010372
849 Ga0500597_137248
850 Ga0500559_0000370
851 Ga0500559_0160384
852 Ga0500559_0249188
853 Ga0500568_0000008
854 Ga0500568_0000009
855 Ga0500568_0015649
856 Ga0500577_0012336
857 Ga0500588_0220700
858 Ga0500590_031252
859 Ga0500616_0000058
860 Ga0500616_0000151
861 Ga0500620_000180
862 Ga0500645_022225
863 Ga0501084_0331581
864 Ga0501084_0580587
865 Ga0466962_0134432
866 2643769704
867 2644096944
868 2644114358
869 2723641533
870 2808901484
871 2844842881
872 2844855920
873 2857736562
874 2862995226
875 2884765860
876 2919058854
877 2919396016
878 2919446818
879 2919524964
880 2928156838
881 2935410951
882 2939657192
883 2964328959
884 2966921742
885 8056039799
886 8057348296

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

7

135

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.9654 7 120
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9646 5 123
3mxu-assembly1.cif.gz_A crystal structure of glycine cleavage system protein h from bartonella henselae 0.9646 6 107
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.9626 5 123
1zko-assembly1.cif.gz_A crystal structure of glycine cleavage system h protein (tm0212) from thermotoga maritima at 1.65 a resolution 0.9616 7 124
ID Description Score Start End Superfamily
af_Q4E4F5_6_138_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.982 5 121 2.40.50.100
af_Q20634_6_139_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.971 7 121 2.40.50.100
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9654 7 120 2.40.50.100
3mxuA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9646 6 107 2.40.50.100
af_Q5AKX1_36_173_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9598 7 123 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A1B1BHB9-F1-model_v4 Glycine cleavage system H protein 0.9935 1 124 GO:0005829
GO:0005960
GO:0019464
AF-Q38E17-F1-model_v4 Glycine cleavage system H protein 0.9875 7 121 GO:0005739
GO:0005960
GO:0006546
GO:0010608
GO:0016740
GO:0019464
GO:0020023
AF-A0A2U1ZS75-F1-model_v4 Glycine cleavage system H protein 0.9867 5 123 GO:0005829
GO:0005960
GO:0019464
AF-A0A841W7Z0-F1-model_v4 Glycine cleavage system H protein 0.9864 5 123 GO:0005737
GO:0005960
GO:0016020
GO:0019464
AF-A0A3B8UCB1-F1-model_v4 Glycine cleavage system H protein 0.9862 9 106 GO:0005737
GO:0005960
GO:0019464

Map