F445178

General Info

Members Datasets Scaffolds Average Seq Length
443 279 886 256

Family's Representative Sequence

Representative Sequence 3300053086|Ga0500578_0099651|Ga0500578_0099651_878_1714
Length 278
Sequence MSSPDRPKSDHRRAQHEGTPVISPLIFITGASSGIGQALAARFHRAGYRLALVARRAESVSAWAQAQGFDAASFAVYAADVRDVNAIVGVGRECMARQGLPDVVIANAGISVGMDTAEFDDLEVMRTTFETNNLGMAATFHPFVSAMRDRRSGTLVGIASVAGIRGLPGHGAYCSSKAAVIAYCESLRGELQSSNVRVVTIGPGYIDTPLTRENPYGMPFLMQADDFADRAFSAIVRGVSYRVIPWQMGVVAKLMRLLPNVLFDKAVGGRARKPRQKK

Samples

Sample ID Description Type Environment
1 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
65 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
75 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
85 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
86 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
90 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
91 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
92 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
94 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
95 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
136 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
144 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
149 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
154 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
155 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
156 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
163 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
164 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
165 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
166 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
167 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
168 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
169 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
172 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
173 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
182 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
183 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
184 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
185 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
186 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
187 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
188 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
189 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
190 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
191 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
192 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
193 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
194 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
195 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
196 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
199 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
200 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
201 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
204 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
205 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
206 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
207 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
219 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
223 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
226 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
227 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
232 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
233 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
234 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
235 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
236 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
237 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
238 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
239 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
240 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
241 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
242 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
243 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
244 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
245 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
246 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
247 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
248 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
249 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
250 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
251 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
252 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
253 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
254 2547132374 Acidovorax radicis N35 Isolate Unclassified
255 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
256 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
257 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
258 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
259 2643221570 Acidovorax sp. Root568 Isolate Unclassified
260 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
261 2643221596 Acidovorax sp. Root70 Isolate Unclassified
262 2643221609 Acidovorax sp. Root217 Isolate Unclassified
263 2643221611 Acidovorax sp. Root219 Isolate Unclassified
264 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
265 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
266 2643221652 Acidovorax sp. Root402 Isolate Unclassified
267 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
268 2643221717 Acidovorax sp. Root267 Isolate Unclassified
269 2816332133 Acidovorax radicis 2721A Isolate Unclassified
270 2831864461 Roseateles noduli HZ7 Isolate Nodule
271 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
272 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
273 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
274 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
275 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
276 2928058823 Ralstonia sp. 1138 Isolate Unclassified
277 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
278 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
279 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.13
Metatranscriptomes 0
Isolates 5.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.44
Nodule 0.9
Rhizoplane 2.26
Rhizosphere 53.05
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500578_0099651 3300053086 Bacteria 1839
2 JGI24740J21852_10030321 3300001979 Bacteria 1762
3 JGI25152J39213_1001209 3300002773 Bacteria 11840
4 JGI25150J39212_1013781 3300002774 Bacteria 1389
5 JGI25153J46596_10004156 3300003215 Bacteria 7862
6 JGI25153J46596_10019569 3300003215 Bacteria 2588
7 rootH1_10010532 3300003316 Bacteria 4738
8 rootH1_10023689 3300003316 Bacteria 1270
9 rootL2_10003007 3300003322 Bacteria 53160
10 rootL2_10035584 3300003322 Bacteria 4662
11 rootL2_10065163 3300003322 Bacteria 5190
12 rootH1_10003144 3300003323 Bacteria 41895
13 Ga0055539_1000522 3300003752 Bacteria 11764
14 Ga0055533_1000026 3300003756 Bacteria 323407
15 Ga0055533_1000068 3300003756 Bacteria 155215
16 Ga0055525_1000036 3300003759 Bacteria 298878
17 Ga0055525_1003040 3300003759 Bacteria 1553
18 Ga0055526_1015937 3300003771 Bacteria 2982
19 Ga0055526_1028531 3300003771 Bacteria 1686
20 Ga0055524_1003664 3300003775 Bacteria 7366
21 Ga0055530_10021005 3300003791 Bacteria 1935
22 Ga0055540_1025694 3300003792 Bacteria 1437
23 Ga0055531_10000519 3300003794 Bacteria 34728
24 Ga0055531_10005443 3300003794 Bacteria 7453
25 Ga0055543_1008757 3300004625 Bacteria 2219
26 Ga0065165_1000304 3300005262 Bacteria 81791
27 Ga0065165_1000757 3300005262 Bacteria 43947
28 Ga0065165_1002631 3300005262 Bacteria 14600
29 Ga0070676_10018873 3300005328 Bacteria 3829
30 Ga0070690_100055751 3300005330 Bacteria 2532
31 Ga0070690_100074532 3300005330 Bacteria 2211
32 Ga0070670_100034439 3300005331 Bacteria 4358
33 Ga0068869_100029092 3300005334 Bacteria 3868
34 Ga0068869_100206925 3300005334 Bacteria 1550
35 Ga0070666_10002560 3300005335 Bacteria 10993
36 Ga0068868_100110446 3300005338 Bacteria 2233
37 Ga0068868_100227084 3300005338 Bacteria 1565
38 Ga0070668_100195028 3300005347 Bacteria 1660
39 Ga0070675_100003315 3300005354 Bacteria 12210
40 Ga0070671_100008293 3300005355 Bacteria 8313
41 Ga0070671_100612918 3300005355 Bacteria 941
42 Ga0070674_100168434 3300005356 Bacteria 1668
43 Ga0070674_100408915 3300005356 Bacteria 1111
44 Ga0070673_100056564 3300005364 Bacteria 3095
45 Ga0070659_100359036 3300005366 Bacteria 1224
46 Ga0070659_100389430 3300005366 Bacteria 1175
47 Ga0070667_100001374 3300005367 Bacteria 21779
48 Ga0070667_100025564 3300005367 Bacteria 4909
49 Ga0070663_100426948 3300005455 Bacteria 1088
50 Ga0070678_100159121 3300005456 Bacteria 1828
51 Ga0070662_100024822 3300005457 Bacteria 4134
52 Ga0068867_100000004 3300005459 Bacteria 180739
53 Ga0068867_100076981 3300005459 Bacteria 2506
54 Ga0068867_100457597 3300005459 Bacteria 1089
55 Ga0070706_100004299 3300005467 Bacteria 13799
56 Ga0070672_100007483 3300005543 Bacteria 7414
57 Ga0070672_100073928 3300005543 Bacteria 2718
58 Ga0070665_100097268 3300005548 Bacteria 2949
59 Ga0070665_100362243 3300005548 Bacteria 1456
60 Ga0068855_100237051 3300005563 Bacteria 2040
61 Ga0068855_100275725 3300005563 Bacteria 1869
62 Ga0068857_100046187 3300005577 Bacteria 3864
63 Ga0068857_100075322 3300005577 Bacteria 3009
64 Ga0068857_100624214 3300005577 Bacteria 1020
65 Ga0068859_100413501 3300005617 Bacteria 1445
66 Ga0068859_100508285 3300005617 Bacteria 1300
67 Ga0068864_100423752 3300005618 Bacteria 1268
68 Ga0068861_100062863 3300005719 Bacteria 2852
69 Ga0068861_100413703 3300005719 Bacteria 1200
70 Ga0068851_10098223 3300005834 Bacteria 1550
71 Ga0068863_100043338 3300005841 Bacteria 4272
72 Ga0068863_100062304 3300005841 Bacteria 3527
73 Ga0068858_100001797 3300005842 Bacteria 21879
74 Ga0068858_100669567 3300005842 Bacteria 1009
75 Ga0068860_100177320 3300005843 Bacteria 2059
76 Ga0068862_100707988 3300005844 Bacteria 976
77 Ga0075365_10001315 3300006038 Bacteria 11091
78 Ga0075368_10093983 3300006042 Bacteria 1228
79 Ga0075368_10129818 3300006042 Bacteria 1047
80 Ga0075363_100053395 3300006048 Bacteria 2159
81 Ga0075364_10026450 3300006051 Bacteria 3702
82 Ga0075364_10295814 3300006051 Bacteria 1102
83 Ga0075362_10094634 3300006177 Bacteria 1390
84 Ga0075367_10006530 3300006178 Bacteria 5900
85 Ga0075367_10149406 3300006178 Bacteria 1449
86 Ga0075369_10029610 3300006186 Bacteria 2301
87 Ga0075369_10041564 3300006186 Bacteria 1969
88 Ga0075366_10006106 3300006195 Bacteria 6567
89 Ga0075366_10010775 3300006195 Bacteria 5140
90 Ga0075366_10052817 3300006195 Bacteria 2414
91 Ga0075366_10065678 3300006195 Bacteria 2158
92 Ga0075366_10083115 3300006195 Bacteria 1914
93 Ga0075366_10251641 3300006195 Bacteria 1077
94 Ga0097621_100340064 3300006237 Bacteria 1333
95 Ga0075370_10002116 3300006353 Bacteria 9060
96 Ga0075370_10003398 3300006353 Bacteria 7569
97 Ga0075370_10011645 3300006353 Bacteria 4627
98 Ga0075370_10021591 3300006353 Bacteria 3527
99 Ga0075370_10184165 3300006353 Bacteria 1230
100 Ga0075370_10223567 3300006353 Bacteria 1113
101 Ga0068871_100334295 3300006358 Bacteria 1336
102 Ga0068871_100337002 3300006358 Bacteria 1331
103 Ga0075430_100350977 3300006846 Bacteria 1218
104 Ga0075429_100003990 3300006880 Bacteria 12633
105 Ga0068865_100437427 3300006881 Bacteria 1079
106 Ga0097620_100413468 3300006931 Bacteria 1445
107 Ga0097620_100508192 3300006931 Bacteria 1300
108 Ga0099823_1000015 3300006944 Bacteria 88096
109 Ga0079104_1018865 3300006946 Bacteria 1943
110 Ga0105240_10154640 3300009093 Bacteria 2729
111 Ga0105240_10197986 3300009093 Bacteria 2356
112 Ga0105245_10084908 3300009098 Bacteria 2901
113 Ga0105245_10095807 3300009098 Bacteria 2738
114 Ga0105243_10028502 3300009148 Bacteria 4287
115 Ga0105243_10199533 3300009148 Bacteria 1753
116 Ga0105242_10249436 3300009176 Bacteria 1599
117 Ga0105248_10233410 3300009177 Bacteria 2071
118 Ga0105237_10426668 3300009545 Bacteria 1331
119 Ga0105239_10014978 3300010375 Bacteria 8595
120 Ga0105246_10094646 3300011119 Bacteria 2161
121 Ga0105246_10134964 3300011119 Bacteria 1848
122 Ga0157319_1000052 3300012497 Bacteria 13081
123 Ga0157327_1006024 3300012512 Bacteria 1006
124 Ga0157378_10264818 3300013297 Bacteria 1651
125 Ga0163162_10044715 3300013306 Bacteria 4436
126 Ga0157375_10081292 3300013308 Bacteria 3280
127 Ga0157375_10151675 3300013308 Bacteria 2454
128 Ga0163163_10030072 3300014325 Bacteria 5229
129 Ga0163163_10605840 3300014325 Bacteria 1158
130 Ga0157377_10000010 3300014745 Bacteria 380929
131 Ga0157379_10028177 3300014968 Bacteria 5000
132 Ga0157379_10194822 3300014968 Bacteria 1831
133 Ga0157379_10928486 3300014968 Bacteria 827
134 Ga0157376_10244463 3300014969 Bacteria 1673
135 Ga0163161_10087786 3300017792 Bacteria 2298
136 Ga0213872_10000266 3300021361 Bacteria 45265
137 Ga0213872_10000942 3300021361 Bacteria 20402
138 Ga0209435_100008 3300025206 Bacteria 503644
139 Ga0209674_100024 3300025226 Bacteria 535481
140 Ga0209563_100014 3300025230 Bacteria 940582
141 Ga0209563_100101 3300025230 Bacteria 152297
142 Ga0209258_100589 3300025242 Bacteria 30120
143 Ga0207425_1000986 3300025245 Bacteria 13369
144 Ga0209646_1000029 3300025246 Bacteria 386414
145 Ga0209026_1000016 3300025250 Bacteria 386457
146 Ga0209677_100048 3300025253 Bacteria 183563
147 Ga0209759_1000016 3300025256 Bacteria 386414
148 Ga0209129_1000038 3300025258 Bacteria 322778
149 Ga0209565_1018598 3300025263 Bacteria 1500
150 Ga0209673_1019320 3300025273 Bacteria 2450
151 Ga0209564_1000030 3300025295 Bacteria 503296
152 Ga0209564_1000129 3300025295 Bacteria 195163
153 Ga0209758_1000197 3300025297 Bacteria 133706
154 Ga0209758_1000213 3300025297 Bacteria 126745
155 Ga0209758_1033034 3300025297 Bacteria 2087
156 Ga0209050_1000720 3300025298 Bacteria 48448
157 Ga0209256_1004520 3300025299 Bacteria 8681
158 Ga0209256_1005321 3300025299 Bacteria 7485
159 Ga0209256_1019788 3300025299 Bacteria 2127
160 Ga0209051_1000241 3300025303 Bacteria 91816
161 Ga0209051_1002996 3300025303 Bacteria 11480
162 Ga0209051_1039662 3300025303 Bacteria 1698
163 Ga0209257_1000015 3300025304 Bacteria 908141
164 Ga0209257_1005729 3300025304 Bacteria 8511
165 Ga0207680_10001011 3300025903 Bacteria 13260
166 Ga0207645_10025254 3300025907 Bacteria 3845
167 Ga0207643_10073969 3300025908 Bacteria 1964
168 Ga0207684_10247745 3300025910 Bacteria 1537
169 Ga0207671_10146671 3300025914 Bacteria 1821
170 Ga0207650_10017518 3300025925 Bacteria 5018
171 Ga0207650_10512854 3300025925 Bacteria 1003
172 Ga0207659_10004962 3300025926 Bacteria 8066
173 Ga0207659_10556265 3300025926 Bacteria 975
174 Ga0207644_10017016 3300025931 Bacteria 4901
175 Ga0207644_10377280 3300025931 Bacteria 1156
176 Ga0207690_10542589 3300025932 Bacteria 945
177 Ga0207706_10143379 3300025933 Bacteria 2102
178 Ga0207706_10302469 3300025933 Bacteria 1393
179 Ga0207686_10300075 3300025934 Bacteria 1193
180 Ga0207709_10015440 3300025935 Bacteria 4234
181 Ga0207709_10123327 3300025935 Bacteria 1753
182 Ga0207669_10143501 3300025937 Bacteria 1661
183 Ga0207704_10394165 3300025938 Bacteria 1091
184 Ga0207691_10006020 3300025940 Bacteria 11710
185 Ga0207691_10041229 3300025940 Bacteria 4264
186 Ga0207691_10140770 3300025940 Bacteria 2126
187 Ga0207691_10516036 3300025940 Bacteria 1014
188 Ga0207711_10064571 3300025941 Bacteria 3163
189 Ga0207689_10029983 3300025942 Bacteria 4535
190 Ga0207689_10222978 3300025942 Bacteria 1558
191 Ga0207667_10060449 3300025949 Bacteria 3966
192 Ga0207651_10000886 3300025960 Bacteria 13121
193 Ga0207668_10126181 3300025972 Bacteria 1946
194 Ga0207640_10025482 3300025981 Bacteria 3581
195 Ga0207658_10001308 3300025986 Bacteria 19644
196 Ga0207658_10161775 3300025986 Bacteria 1835
197 Ga0207677_10014128 3300026023 Bacteria 4652
198 Ga0207677_10102863 3300026023 Bacteria 2107
199 Ga0207703_10006896 3300026035 Bacteria 9042
200 Ga0207703_10834416 3300026035 Bacteria 881
201 Ga0207678_10161106 3300026067 Bacteria 1916
202 Ga0207641_10024820 3300026088 Bacteria 4941
203 Ga0207641_10162832 3300026088 Bacteria 2029
204 Ga0207648_10000002 3300026089 Bacteria 307909
205 Ga0207648_10039639 3300026089 Bacteria 4142
206 Ga0207648_10384243 3300026089 Bacteria 1270
207 Ga0207676_10000221 3300026095 Bacteria 49106
208 Ga0207676_10502523 3300026095 Bacteria 1151
209 Ga0207674_10024109 3300026116 Bacteria 6506
210 Ga0207674_10038521 3300026116 Bacteria 4959
211 Ga0207674_10207238 3300026116 Bacteria 1910
212 Ga0207674_10235098 3300026116 Bacteria 1780
213 Ga0207675_100075719 3300026118 Bacteria 3150
214 Ga0207675_100175851 3300026118 Bacteria 2048
215 Ga0207675_100280753 3300026118 Bacteria 1618
216 Ga0207675_100475999 3300026118 Bacteria 1240
217 Ga0207683_10028484 3300026121 Bacteria 4829
218 Ga0207683_10242217 3300026121 Bacteria 1645
219 Ga0207698_10017801 3300026142 Bacteria 4829
220 Ga0209389_1000831 3300027296 Bacteria 19759
221 Ga0209371_1010405 3300027312 Bacteria 2863
222 Ga0209974_10052263 3300027876 Unclassified 1375
223 Ga0209974_10096261 3300027876 Bacteria 1031
224 Ga0268266_10400578 3300028379 Bacteria 1297
225 Ga0268265_10016860 3300028380 Bacteria 5029
226 Ga0268264_10501029 3300028381 Bacteria 1184
227 Ga0307517_10015465 3300028786 Bacteria 10139
228 Ga0307517_10163980 3300028786 Bacteria 1482
229 Ga0307517_10272580 3300028786 Bacteria 972
230 Ga0307515_10000239 3300028794 Bacteria 135971
231 Ga0307515_10000567 3300028794 Bacteria 87086
232 Ga0307515_10007744 3300028794 Bacteria 21142
233 Ga0307515_10087552 3300028794 Bacteria 3950
234 Ga0307515_10094254 3300028794 Bacteria 3700
235 Ga0307515_10143219 3300028794 Bacteria 2549
236 Ga0268256_1011161 3300030500 Bacteria 2863
237 Ga0307512_10085667 3300030522 Bacteria 2231
238 Ga0307512_10136407 3300030522 Bacteria 1518
239 Ga0307512_10139352 3300030522 Bacteria 1490
240 Ga0307513_10011623 3300031456 Bacteria 10928
241 Ga0307513_10095004 3300031456 Bacteria 3024
242 Ga0307513_10274310 3300031456 Bacteria 1468
243 Ga0307509_10015099 3300031507 Bacteria 9039
244 Ga0307509_10024044 3300031507 Bacteria 6830
245 Ga0307509_10072789 3300031507 Bacteria 3579
246 Ga0307509_10109176 3300031507 Bacteria 2777
247 Ga0307509_10223700 3300031507 Bacteria 1692
248 Ga0307408_100013417 3300031548 Bacteria 5437
249 Ga0307508_10000133 3300031616 Bacteria 87867
250 Ga0307508_10002482 3300031616 Bacteria 19455
251 Ga0307508_10052645 3300031616 Bacteria 3614
252 Ga0307514_10001199 3300031649 Bacteria 34587
253 Ga0307514_10025372 3300031649 Bacteria 4795
254 Ga0307514_10060728 3300031649 Bacteria 2882
255 Ga0307516_10000677 3300031730 Bacteria 46191
256 Ga0307516_10004964 3300031730 Bacteria 16154
257 Ga0307516_10107458 3300031730 Bacteria 2599
258 Ga0307516_10162045 3300031730 Bacteria 1986
259 Ga0307516_10237028 3300031730 Bacteria 1525
260 Ga0307412_10200311 3300031911 Bacteria 1516
261 Ga0307412_10627432 3300031911 Bacteria 914
262 Ga0307409_100232374 3300031995 Bacteria 1673
263 Ga0307507_10042842 3300033179 Bacteria 4501
264 Ga0307507_10069728 3300033179 Bacteria 3196
265 Ga0307507_10126470 3300033179 Bacteria 2020
266 Ga0307507_10254381 3300033179 Bacteria 1130
267 Ga0307510_10004514 3300033180 Bacteria 16378
268 Ga0307510_10150481 3300033180 Bacteria 1948
269 Ga0373938_0006084 3300034957 Bacteria 2072
270 Ga0373962_0043529 3300035242 Bacteria 1273
271 Ga0373925_0096937 3300037068 Bacteria 2261
272 Ga0395899_0149909 3300037312 Bacteria 1653
273 Ga0395898_0028939 3300037466 Bacteria 5552
274 Ga0395905_0000047 3300037471 Bacteria 237582
275 Ga0395905_0000181 3300037471 Bacteria 100569
276 Ga0395905_0000574 3300037471 Bacteria 49809
277 Ga0395905_0003555 3300037471 Bacteria 16602
278 Ga0395905_0017174 3300037471 Bacteria 6873
279 Ga0395901_0009002 3300038443 Bacteria 10109
280 Ga0436361_0147437 3300039447 Bacteria 84337
281 Ga0436361_0518335 3300039447 Bacteria 20591
282 Ga0451800_0503480 3300041459 Bacteria 1367
283 Ga0439457_012108 3300042014 Bacteria 1949
284 Ga0450890_025106 3300042127 Bacteria 825
285 Ga0450891_005307 3300042129 Bacteria 1192
286 Ga0439459_0000109 3300042438 Bacteria 7715
287 Ga0450916_008606 3300042530 Bacteria 1245
288 Ga0450893_0009023 3300042532 Bacteria 1628
289 Ga0451577_0666856 3300042876 Bacteria 943
290 Ga0466986_0097561 3300044650 Bacteria 2028
291 Ga0466972_0001282 3300044658 Bacteria 12137
292 Ga0466965_0017227 3300044683 Bacteria 3451
293 Ga0466963_0453022 3300044694 Bacteria 905
294 Ga0453684_0008823 3300044712 Bacteria 17877
295 Ga0453684_0117774 3300044712 Bacteria 3214
296 Ga0466957_0127332 3300044842 Bacteria 1628
297 Ga0495590_0006351 3300046457 Bacteria 4619
298 Ga0495629_0515977 3300046459 Bacteria 805
299 Ga0495650_0012760 3300046471 Bacteria 4498
300 Ga0495582_0116995 3300046473 Bacteria 1500
301 Ga0495583_0000022 3300046506 Bacteria 282544
302 Ga0495583_0045630 3300046506 Bacteria 2026
303 Ga0495606_0001282 3300046507 Bacteria 34808
304 Ga0495620_0144026 3300046515 Bacteria 931
305 Ga0495620_0146875 3300046515 Bacteria 920
306 Ga0495632_0002762 3300046519 Bacteria 13037
307 Ga0495632_0011887 3300046519 Bacteria 5057
308 Ga0495632_0111720 3300046519 Bacteria 1283
309 Ga0495632_0113662 3300046519 Bacteria 1270
310 Ga0495632_0130813 3300046519 Bacteria 1168
311 Ga0495643_0146447 3300046522 Bacteria 1173
312 Ga0495648_0160462 3300046524 Bacteria 1163
313 Ga0495663_0063308 3300046525 Bacteria 1166
314 Ga0495654_0001471 3300046530 Bacteria 16109
315 Ga0495621_0000488 3300046539 Bacteria 9769
316 Ga0495597_0000325 3300046542 Bacteria 43126
317 Ga0495597_0073269 3300046542 Bacteria 1472
318 Ga0495656_0007829 3300046615 Bacteria 3795
319 Ga0495668_0006957 3300046616 Bacteria 7318
320 Ga0495668_0056561 3300046616 Bacteria 2165
321 Ga0495625_0007448 3300046660 Bacteria 9518
322 Ga0495625_0045959 3300046660 Bacteria 3153
323 Ga0495658_0150765 3300046683 Bacteria 1428
324 Ga0495669_0015910 3300046684 Bacteria 3221
325 Ga0495669_0045914 3300046684 Bacteria 1949
326 Ga0495624_0208671 3300046690 Bacteria 1185
327 Ga0495670_0068092 3300046691 Bacteria 1798
328 Ga0495671_0108910 3300046692 Bacteria 1353
329 Ga0495649_0002139 3300046694 Bacteria 14132
330 Ga0495660_0125174 3300046810 Bacteria 1295
331 Ga0495636_0032347 3300047318 Bacteria 2146
332 Ga0495676_0163275 3300047321 Bacteria 1574
333 Ga0495687_000128 3300047443 Bacteria 116626
334 Ga0495687_003495 3300047443 Bacteria 11338
335 Ga0495685_018816 3300047447 Bacteria 2371
336 Ga0495686_0113695 3300047472 Bacteria 1621
337 Ga0495593_0020951 3300047673 Bacteria 3655
338 Ga0495614_0052273 3300048089 Bacteria 1751
339 Ga0496102_0001753 3300048905 Bacteria 18929
340 Ga0496102_0013316 3300048905 Bacteria 7125
341 Ga0496104_0049188 3300048907 Bacteria 3976
342 Ga0496104_0642776 3300048907 Bacteria 970
343 Ga0496106_0010243 3300048909 Bacteria 6930
344 Ga0496106_0303675 3300048909 Bacteria 1280
345 Ga0496109_0436671 3300048912 Bacteria 1237
346 Ga0496113_0091744 3300048916 Bacteria 2342
347 Ga0496114_0160514 3300048917 Bacteria 1954
348 Ga0496124_0098191 3300048927 Bacteria 2377
349 Ga0496126_0019016 3300048929 Bacteria 6783
350 Ga0496126_0020164 3300048929 Bacteria 6543
351 Ga0501037_0039005 3300049573 Bacteria 3498
352 Ga0501047_0081191 3300049581 Bacteria 3117
353 Ga0501222_000001 3300049662 Bacteria 307689
354 Ga0501266_000542 3300049763 Bacteria 5024
355 Ga0501035_0079596 3300049822 Bacteria 2895
356 Ga0501044_0461466 3300049823 Bacteria 1176
357 nmdc:mga03683_122402_c1 3300050489 Bacteria 1158
358 nmdc:mga03683_85484_c1 3300050489 Bacteria 1368
359 nmdc:mga03683_87315_c1 3300050489 Bacteria 1355
360 nmdc:mga03n38_85298_c1 3300050490 Bacteria 1493
361 nmdc:mga00v17_65228_c1 3300050491 Bacteria 2246
362 nmdc:mga0k408_109487_c1 3300050493 Bacteria 1632
363 nmdc:mga0k408_141776_c1 3300050493 Bacteria 1430
364 nmdc:mga0k408_2194_c1 3300050493 Bacteria 10472
365 nmdc:mga0k408_233828_c1 3300050493 Bacteria 1097
366 nmdc:mga0k408_245320_c1 3300050493 Bacteria 1070
367 nmdc:mga0k408_36296_c1 3300050493 Bacteria 2829
368 nmdc:mga0k408_6285_c1 3300050493 Bacteria 6337
369 nmdc:mga0k408_6522_c1 3300050493 Bacteria 6218
370 nmdc:mga0k408_6611_c1 3300050493 Bacteria 6178
371 nmdc:mga0k408_7647_c1 3300050493 Bacteria 5774
372 nmdc:mga0k408_81683_c1 3300050493 Bacteria 1893
373 nmdc:mga06z11_230202_c1 3300050494 Bacteria 1086
374 nmdc:mga06z11_6369_c1 3300050494 Bacteria 4796
375 nmdc:mga04h51_106120_c1 3300050495 Bacteria 1030
376 nmdc:mga07m45_101551_c1 3300050496 Bacteria 1652
377 nmdc:mga07m45_121481_c1 3300050496 Bacteria 1509
378 nmdc:mga07m45_165107_c1 3300050496 Bacteria 1286
379 nmdc:mga07m45_2131_c1 3300050496 Bacteria 9210
380 nmdc:mga07m45_40073_c1 3300050496 Bacteria 2621
381 nmdc:mga07m45_496_c1 3300050496 Bacteria 16651
382 nmdc:mga09592_98893_c1 3300050508 Bacteria 2498
383 nmdc:mga0qj67_338215_c1 3300050509 Bacteria 1218
384 Ga0500578_0000393 3300053086 Bacteria 53719
385 Ga0500644_0006682 3300053088 Bacteria 2966
386 Ga0500644_0022913 3300053088 Bacteria 1890
387 Ga0500646_0003415 3300053090 Bacteria 4075
388 Ga0500647_0113324 3300053091 Bacteria 1288
389 Ga0500583_0086995 3300053092 Bacteria 1517
390 Ga0500650_0060506 3300053098 Bacteria 1768
391 Ga0500562_055898 3300053108 Bacteria 1058
392 Ga0500593_000561 3300053117 Bacteria 14408
393 Ga0500593_001398 3300053117 Bacteria 8684
394 Ga0500594_0011768 3300053118 Bacteria 2047
395 Ga0500607_063175 3300053121 Bacteria 1933
396 Ga0500652_003564 3300053131 Bacteria 4723
397 Ga0500658_0015687 3300053134 Bacteria 2815
398 Ga0500559_0000388 3300053136 Bacteria 32263
399 Ga0500568_0007967 3300053139 Bacteria 5147
400 Ga0500568_0052633 3300053139 Bacteria 1597
401 Ga0500568_0057528 3300053139 Bacteria 1513
402 Ga0500568_0147320 3300053139 Bacteria 872
403 Ga0500577_0044901 3300053142 Bacteria 1631
404 Ga0500589_086883 3300053147 Bacteria 1386
405 Ga0500590_000586 3300053148 Bacteria 12847
406 Ga0500619_040539 3300053154 Bacteria 1469
407 Ga0500622_0009156 3300053156 Bacteria 5496
408 Ga0500622_0033728 3300053156 Bacteria 2683
409 Ga0500622_0070704 3300053156 Bacteria 1765
410 Ga0500633_0028431 3300053160 Bacteria 1779
411 Ga0500636_0017211 3300053177 Bacteria 4265
412 Ga0500636_0021910 3300053177 Bacteria 3783
413 Ga0500570_129300 3300053724 Bacteria 964
414 Ga0500645_010354 3300053730 Bacteria 3089
415 Ga0500645_021730 3300053730 Bacteria 1978
416 Ga0500645_053573 3300053730 Bacteria 1174
417 Ga0500661_003583 3300055283 Bacteria 2918
418 2548500612 2547132374 Bacteria 5530232
419 2587729034 2585428057 Bacteria 6737412
420 2587733601 2585428058 Bacteria 6853932
421 2588294000 2588253510 Bacteria 6901809
422 2597031373 2596583598 Bacteria 5251611
423 2643864388 2643221570 Bacteria 5103772
424 2643967105 2643221592 Bacteria 6608788
425 2643991979 2643221596 Bacteria 5006805
426 2644058121 2643221609 Bacteria 6756331
427 2644073157 2643221611 Bacteria 6820941
428 2644139935 2643221625 Bacteria 6512927
429 2644271175 2643221648 Bacteria 6521465
430 2644291910 2643221652 Bacteria 5140275
431 2644305438 2643221654 Bacteria 5273570
432 2644646838 2643221717 Bacteria 5676132
433 2816469973 2816332133 Bacteria 7249298
434 2831864897 2831864461 Bacteria 6502356
435 2834644125 2834641062 Bacteria 5559922
436 2881104463 2881101125 Bacteria 4590519
437 2891633610 2891633521 Bacteria 4602265
438 2900577771 2900577576 Bacteria 5438534
439 2919708336 2919704043 Bacteria 5560311
440 2928061039 2928058823 Bacteria 5520022
441 2974321506 2974320154 Bacteria 4571377
442 2990714987 2990710928 Bacteria 5002431
443 8003403955 8003400568 Bacteria 5535898
444 Ga0500578_0099651
445 JGI24740J21852_10030321
446 JGI25152J39213_1001209
447 JGI25150J39212_1013781
448 JGI25153J46596_10004156
449 JGI25153J46596_10019569
450 rootH1_10010532
451 rootH1_10023689
452 rootL2_10003007
453 rootL2_10035584
454 rootL2_10065163
455 rootH1_10003144
456 Ga0055539_1000522
457 Ga0055533_1000026
458 Ga0055533_1000068
459 Ga0055525_1000036
460 Ga0055525_1003040
461 Ga0055526_1015937
462 Ga0055526_1028531
463 Ga0055524_1003664
464 Ga0055530_10021005
465 Ga0055540_1025694
466 Ga0055531_10000519
467 Ga0055531_10005443
468 Ga0055543_1008757
469 Ga0065165_1000304
470 Ga0065165_1000757
471 Ga0065165_1002631
472 Ga0070676_10018873
473 Ga0070690_100055751
474 Ga0070690_100074532
475 Ga0070670_100034439
476 Ga0068869_100029092
477 Ga0068869_100206925
478 Ga0070666_10002560
479 Ga0068868_100110446
480 Ga0068868_100227084
481 Ga0070668_100195028
482 Ga0070675_100003315
483 Ga0070671_100008293
484 Ga0070671_100612918
485 Ga0070674_100168434
486 Ga0070674_100408915
487 Ga0070673_100056564
488 Ga0070659_100359036
489 Ga0070659_100389430
490 Ga0070667_100001374
491 Ga0070667_100025564
492 Ga0070663_100426948
493 Ga0070678_100159121
494 Ga0070662_100024822
495 Ga0068867_100000004
496 Ga0068867_100076981
497 Ga0068867_100457597
498 Ga0070706_100004299
499 Ga0070672_100007483
500 Ga0070672_100073928
501 Ga0070665_100097268
502 Ga0070665_100362243
503 Ga0068855_100237051
504 Ga0068855_100275725
505 Ga0068857_100046187
506 Ga0068857_100075322
507 Ga0068857_100624214
508 Ga0068859_100413501
509 Ga0068859_100508285
510 Ga0068864_100423752
511 Ga0068861_100062863
512 Ga0068861_100413703
513 Ga0068851_10098223
514 Ga0068863_100043338
515 Ga0068863_100062304
516 Ga0068858_100001797
517 Ga0068858_100669567
518 Ga0068860_100177320
519 Ga0068862_100707988
520 Ga0075365_10001315
521 Ga0075368_10093983
522 Ga0075368_10129818
523 Ga0075363_100053395
524 Ga0075364_10026450
525 Ga0075364_10295814
526 Ga0075362_10094634
527 Ga0075367_10006530
528 Ga0075367_10149406
529 Ga0075369_10029610
530 Ga0075369_10041564
531 Ga0075366_10006106
532 Ga0075366_10010775
533 Ga0075366_10052817
534 Ga0075366_10065678
535 Ga0075366_10083115
536 Ga0075366_10251641
537 Ga0097621_100340064
538 Ga0075370_10002116
539 Ga0075370_10003398
540 Ga0075370_10011645
541 Ga0075370_10021591
542 Ga0075370_10184165
543 Ga0075370_10223567
544 Ga0068871_100334295
545 Ga0068871_100337002
546 Ga0075430_100350977
547 Ga0075429_100003990
548 Ga0068865_100437427
549 Ga0097620_100413468
550 Ga0097620_100508192
551 Ga0099823_1000015
552 Ga0079104_1018865
553 Ga0105240_10154640
554 Ga0105240_10197986
555 Ga0105245_10084908
556 Ga0105245_10095807
557 Ga0105243_10028502
558 Ga0105243_10199533
559 Ga0105242_10249436
560 Ga0105248_10233410
561 Ga0105237_10426668
562 Ga0105239_10014978
563 Ga0105246_10094646
564 Ga0105246_10134964
565 Ga0157319_1000052
566 Ga0157327_1006024
567 Ga0157378_10264818
568 Ga0163162_10044715
569 Ga0157375_10081292
570 Ga0157375_10151675
571 Ga0163163_10030072
572 Ga0163163_10605840
573 Ga0157377_10000010
574 Ga0157379_10028177
575 Ga0157379_10194822
576 Ga0157379_10928486
577 Ga0157376_10244463
578 Ga0163161_10087786
579 Ga0213872_10000266
580 Ga0213872_10000942
581 Ga0209435_100008
582 Ga0209674_100024
583 Ga0209563_100014
584 Ga0209563_100101
585 Ga0209258_100589
586 Ga0207425_1000986
587 Ga0209646_1000029
588 Ga0209026_1000016
589 Ga0209677_100048
590 Ga0209759_1000016
591 Ga0209129_1000038
592 Ga0209565_1018598
593 Ga0209673_1019320
594 Ga0209564_1000030
595 Ga0209564_1000129
596 Ga0209758_1000197
597 Ga0209758_1000213
598 Ga0209758_1033034
599 Ga0209050_1000720
600 Ga0209256_1004520
601 Ga0209256_1005321
602 Ga0209256_1019788
603 Ga0209051_1000241
604 Ga0209051_1002996
605 Ga0209051_1039662
606 Ga0209257_1000015
607 Ga0209257_1005729
608 Ga0207680_10001011
609 Ga0207645_10025254
610 Ga0207643_10073969
611 Ga0207684_10247745
612 Ga0207671_10146671
613 Ga0207650_10017518
614 Ga0207650_10512854
615 Ga0207659_10004962
616 Ga0207659_10556265
617 Ga0207644_10017016
618 Ga0207644_10377280
619 Ga0207690_10542589
620 Ga0207706_10143379
621 Ga0207706_10302469
622 Ga0207686_10300075
623 Ga0207709_10015440
624 Ga0207709_10123327
625 Ga0207669_10143501
626 Ga0207704_10394165
627 Ga0207691_10006020
628 Ga0207691_10041229
629 Ga0207691_10140770
630 Ga0207691_10516036
631 Ga0207711_10064571
632 Ga0207689_10029983
633 Ga0207689_10222978
634 Ga0207667_10060449
635 Ga0207651_10000886
636 Ga0207668_10126181
637 Ga0207640_10025482
638 Ga0207658_10001308
639 Ga0207658_10161775
640 Ga0207677_10014128
641 Ga0207677_10102863
642 Ga0207703_10006896
643 Ga0207703_10834416
644 Ga0207678_10161106
645 Ga0207641_10024820
646 Ga0207641_10162832
647 Ga0207648_10000002
648 Ga0207648_10039639
649 Ga0207648_10384243
650 Ga0207676_10000221
651 Ga0207676_10502523
652 Ga0207674_10024109
653 Ga0207674_10038521
654 Ga0207674_10207238
655 Ga0207674_10235098
656 Ga0207675_100075719
657 Ga0207675_100175851
658 Ga0207675_100280753
659 Ga0207675_100475999
660 Ga0207683_10028484
661 Ga0207683_10242217
662 Ga0207698_10017801
663 Ga0209389_1000831
664 Ga0209371_1010405
665 Ga0209974_10052263
666 Ga0209974_10096261
667 Ga0268266_10400578
668 Ga0268265_10016860
669 Ga0268264_10501029
670 Ga0307517_10015465
671 Ga0307517_10163980
672 Ga0307517_10272580
673 Ga0307515_10000239
674 Ga0307515_10000567
675 Ga0307515_10007744
676 Ga0307515_10087552
677 Ga0307515_10094254
678 Ga0307515_10143219
679 Ga0268256_1011161
680 Ga0307512_10085667
681 Ga0307512_10136407
682 Ga0307512_10139352
683 Ga0307513_10011623
684 Ga0307513_10095004
685 Ga0307513_10274310
686 Ga0307509_10015099
687 Ga0307509_10024044
688 Ga0307509_10072789
689 Ga0307509_10109176
690 Ga0307509_10223700
691 Ga0307408_100013417
692 Ga0307508_10000133
693 Ga0307508_10002482
694 Ga0307508_10052645
695 Ga0307514_10001199
696 Ga0307514_10025372
697 Ga0307514_10060728
698 Ga0307516_10000677
699 Ga0307516_10004964
700 Ga0307516_10107458
701 Ga0307516_10162045
702 Ga0307516_10237028
703 Ga0307412_10200311
704 Ga0307412_10627432
705 Ga0307409_100232374
706 Ga0307507_10042842
707 Ga0307507_10069728
708 Ga0307507_10126470
709 Ga0307507_10254381
710 Ga0307510_10004514
711 Ga0307510_10150481
712 Ga0373938_0006084
713 Ga0373962_0043529
714 Ga0373925_0096937
715 Ga0395899_0149909
716 Ga0395898_0028939
717 Ga0395905_0000047
718 Ga0395905_0000181
719 Ga0395905_0000574
720 Ga0395905_0003555
721 Ga0395905_0017174
722 Ga0395901_0009002
723 Ga0436361_0147437
724 Ga0436361_0518335
725 Ga0451800_0503480
726 Ga0439457_012108
727 Ga0450890_025106
728 Ga0450891_005307
729 Ga0439459_0000109
730 Ga0450916_008606
731 Ga0450893_0009023
732 Ga0451577_0666856
733 Ga0466986_0097561
734 Ga0466972_0001282
735 Ga0466965_0017227
736 Ga0466963_0453022
737 Ga0453684_0008823
738 Ga0453684_0117774
739 Ga0466957_0127332
740 Ga0495590_0006351
741 Ga0495629_0515977
742 Ga0495650_0012760
743 Ga0495582_0116995
744 Ga0495583_0000022
745 Ga0495583_0045630
746 Ga0495606_0001282
747 Ga0495620_0144026
748 Ga0495620_0146875
749 Ga0495632_0002762
750 Ga0495632_0011887
751 Ga0495632_0111720
752 Ga0495632_0113662
753 Ga0495632_0130813
754 Ga0495643_0146447
755 Ga0495648_0160462
756 Ga0495663_0063308
757 Ga0495654_0001471
758 Ga0495621_0000488
759 Ga0495597_0000325
760 Ga0495597_0073269
761 Ga0495656_0007829
762 Ga0495668_0006957
763 Ga0495668_0056561
764 Ga0495625_0007448
765 Ga0495625_0045959
766 Ga0495658_0150765
767 Ga0495669_0015910
768 Ga0495669_0045914
769 Ga0495624_0208671
770 Ga0495670_0068092
771 Ga0495671_0108910
772 Ga0495649_0002139
773 Ga0495660_0125174
774 Ga0495636_0032347
775 Ga0495676_0163275
776 Ga0495687_000128
777 Ga0495687_003495
778 Ga0495685_018816
779 Ga0495686_0113695
780 Ga0495593_0020951
781 Ga0495614_0052273
782 Ga0496102_0001753
783 Ga0496102_0013316
784 Ga0496104_0049188
785 Ga0496104_0642776
786 Ga0496106_0010243
787 Ga0496106_0303675
788 Ga0496109_0436671
789 Ga0496113_0091744
790 Ga0496114_0160514
791 Ga0496124_0098191
792 Ga0496126_0019016
793 Ga0496126_0020164
794 Ga0501037_0039005
795 Ga0501047_0081191
796 Ga0501222_000001
797 Ga0501266_000542
798 Ga0501035_0079596
799 Ga0501044_0461466
800 nmdc:mga03683_122402_c1
801 nmdc:mga03683_85484_c1
802 nmdc:mga03683_87315_c1
803 nmdc:mga03n38_85298_c1
804 nmdc:mga00v17_65228_c1
805 nmdc:mga0k408_109487_c1
806 nmdc:mga0k408_141776_c1
807 nmdc:mga0k408_2194_c1
808 nmdc:mga0k408_233828_c1
809 nmdc:mga0k408_245320_c1
810 nmdc:mga0k408_36296_c1
811 nmdc:mga0k408_6285_c1
812 nmdc:mga0k408_6522_c1
813 nmdc:mga0k408_6611_c1
814 nmdc:mga0k408_7647_c1
815 nmdc:mga0k408_81683_c1
816 nmdc:mga06z11_230202_c1
817 nmdc:mga06z11_6369_c1
818 nmdc:mga04h51_106120_c1
819 nmdc:mga07m45_101551_c1
820 nmdc:mga07m45_121481_c1
821 nmdc:mga07m45_165107_c1
822 nmdc:mga07m45_2131_c1
823 nmdc:mga07m45_40073_c1
824 nmdc:mga07m45_496_c1
825 nmdc:mga09592_98893_c1
826 nmdc:mga0qj67_338215_c1
827 Ga0500578_0000393
828 Ga0500644_0006682
829 Ga0500644_0022913
830 Ga0500646_0003415
831 Ga0500647_0113324
832 Ga0500583_0086995
833 Ga0500650_0060506
834 Ga0500562_055898
835 Ga0500593_000561
836 Ga0500593_001398
837 Ga0500594_0011768
838 Ga0500607_063175
839 Ga0500652_003564
840 Ga0500658_0015687
841 Ga0500559_0000388
842 Ga0500568_0007967
843 Ga0500568_0052633
844 Ga0500568_0057528
845 Ga0500568_0147320
846 Ga0500577_0044901
847 Ga0500589_086883
848 Ga0500590_000586
849 Ga0500619_040539
850 Ga0500622_0009156
851 Ga0500622_0033728
852 Ga0500622_0070704
853 Ga0500633_0028431
854 Ga0500636_0017211
855 Ga0500636_0021910
856 Ga0500570_129300
857 Ga0500645_010354
858 Ga0500645_021730
859 Ga0500645_053573
860 Ga0500661_003583
861 2548500612
862 2587729034
863 2587733601
864 2588294000
865 2597031373
866 2643864388
867 2643967105
868 2643991979
869 2644058121
870 2644073157
871 2644139935
872 2644271175
873 2644291910
874 2644305438
875 2644646838
876 2816469973
877 2831864897
878 2834644125
879 2881104463
880 2891633610
881 2900577771
882 2919708336
883 2928061039
884 2974321506
885 2990714987
886 8003403955

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

24

217

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

30

228

0.9

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

26

203

0.8

PF08659

KR

KR domain

25

207

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tfo-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9192 10 230
6zzo-assembly1.cif.gz_B crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with nad+ and acetoacetate 0.9187 11 230
3csd-assembly1.cif.gz_B actinorhodin polyketide ketoreductase mutant p94l bound to nadph and the inhibitor emodin 0.9166 8 231
3p19-assembly1.cif.gz_B improved nadph-dependent blue fluorescent protein 0.9161 11 231
1w4z-assembly1.cif.gz_B-2 structure of actinorhodin polyketide (actiii) reductase 0.9151 8 231
ID Description Score Start End Superfamily
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.944 10 187 3.40.50.720
af_Q2FVD5_4_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9267 11 231 3.40.50.720
af_P9WGR7_3_252_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9202 11 250 3.40.50.720
3tfoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9192 10 230 3.40.50.720
3p19C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9159 11 230 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2W5DRR8-F1-model_v4 Short-chain dehydrogenase 0.9911 10 263 GO:0016020
GO:0016491
AF-A0A109D0Z5-F1-model_v4 deleted 0.9879 70 265
AF-A0A1T4RR99-F1-model_v4 Short-chain dehydrogenase 0.9803 9 263 GO:0016020
GO:0016491
AF-A0A2W5DRR8-F1-model_v4 Short-chain dehydrogenase 0.9758 10 263 GO:0016020
GO:0016491
AF-A0A109D0Z5-F1-model_v4 deleted 0.9731 70 265

Map