F445187

General Info

Members Datasets Scaffolds Average Seq Length
443 291 886 326

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2751185734|2753072944
Length 365
Sequence RILTAGTLAAERFAERDHPSDARVVVPLGFGQGGRMEYTQLGRSGLSVSRLCLGTMNFGPETSEADSHAIMDRAHEHGINFFDTADVYGWERGEGITENIIGRWFAQGGGRREKTVLATKLYGDMGDWPNEGRLSALHIRRAADASLARLQTDHIDLLQMHHVDRNTPWDEIWEAFSVLRQQGKVVYFGSSNFAGWHIAQAQEAARSRHFLGLVSEQSIYNLVNRFAELEVLPAARHYGLGVIPWSPLGGGLLGGVLRKQREGGGSRGNSGRSLEALEKHRDAIEAYEKLSADLGEDPAHVGVAWLLHQEGVTAPIIGPRTAGQLDGSLRSTEIELDADVLAKLDELFPAPGPNGSKPAPEAYAW

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
69 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
72 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
108 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
111 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
112 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
113 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
114 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
115 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
120 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
139 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
140 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
143 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
148 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
160 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
161 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
162 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
168 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
179 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
180 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
181 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
210 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
211 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
212 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
213 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
216 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
217 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
223 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
224 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
225 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
236 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
237 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
238 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
242 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
243 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
244 2501939600 Micromonospora sp. L5 Isolate Unclassified
245 2508501039 Frankia saprophytica CN3 Isolate Nodule
246 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
247 2517572101 Frankia sp. DC12 Isolate Nodule
248 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
249 2619618881 Frankia sp. ACN1ag Isolate Unclassified
250 2619619003 Frankia sp. CpI1-P Isolate Nodule
251 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
252 2626541554 Frankia sp. AvcI.1 Isolate Nodule
253 2671180195 Frankia sp. CcI49 Isolate Nodule
254 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
255 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
256 2687453737 Frankia sp. BMG5.36 Isolate Nodule
257 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
258 2773857922 Frankia sp. CcI49 Isolate Nodule
259 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
260 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
261 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
262 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
263 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
264 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
265 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
266 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
267 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
268 2858868258 Micromonospora sp. MH33 Isolate Unclassified
269 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
270 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
271 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
272 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
273 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
274 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
275 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
276 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
277 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
278 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
279 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
280 649633069 Micromonospora sp. L5 Isolate Unclassified
281 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
282 8002775197 Frankia nepalensis CN7 Isolate Nodule
283 8002784119 Frankia sp. AgB1.9 Isolate Nodule
284 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
285 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
286 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
287 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
288 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
289 8054920844 Frankia tisae Agncl-8 Isolate Nodule
290 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
291 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.81
Metatranscriptomes 0.68
Isolates 11.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.81
Nodule 3.84
Rhizoplane 6.55
Rhizosphere 76.52
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000087 3300002987 Bacteria 43868
2 JGI25151J46595_10003060 3300003187 Bacteria 9454
3 JGI25406J46586_10017557 3300003203 Bacteria 2956
4 Ga0070658_10002283 3300005327 Bacteria 16078
5 Ga0070658_10066143 3300005327 Bacteria 2952
6 Ga0070666_10013881 3300005335 Bacteria 5119
7 Ga0070680_100004871 3300005336 Bacteria 10107
8 Ga0070680_100122861 3300005336 Bacteria 2168
9 Ga0070660_100105180 3300005339 Bacteria 2240
10 Ga0070660_100138369 3300005339 Bacteria 1952
11 Ga0070691_10011837 3300005341 Bacteria 3991
12 Ga0070661_100058258 3300005344 Bacteria 2831
13 Ga0070669_100008169 3300005353 Bacteria 7474
14 Ga0070675_100016114 3300005354 Bacteria 5925
15 Ga0070675_100204441 3300005354 Bacteria 1715
16 Ga0070671_100059770 3300005355 Bacteria 3172
17 Ga0070674_100003120 3300005356 Bacteria 9231
18 Ga0070674_100020081 3300005356 Bacteria 4259
19 Ga0070673_100006068 3300005364 Bacteria 7828
20 Ga0070667_100062618 3300005367 Bacteria 3151
21 Ga0070703_10018191 3300005406 Bacteria 2029
22 Ga0070709_10009756 3300005434 Bacteria 5303
23 Ga0070714_100023722 3300005435 Bacteria 5044
24 Ga0070713_100039040 3300005436 Bacteria 3850
25 Ga0070710_10001380 3300005437 Bacteria 11454
26 Ga0070705_100001260 3300005440 Bacteria 13652
27 Ga0070700_100005719 3300005441 Bacteria 6599
28 Ga0070694_100001230 3300005444 Bacteria 14813
29 Ga0070708_100002843 3300005445 Bacteria 13445
30 Ga0070663_100015658 3300005455 Bacteria 4903
31 Ga0070678_100021400 3300005456 Bacteria 4264
32 Ga0070678_100034494 3300005456 Bacteria 3525
33 Ga0070681_10000045 3300005458 Bacteria 84615
34 Ga0070681_10003004 3300005458 Bacteria 15654
35 Ga0070681_10072369 3300005458 Bacteria 3410
36 Ga0070698_100014078 3300005471 Bacteria 8457
37 Ga0070699_100001764 3300005518 Bacteria 19726
38 Ga0070679_100000198 3300005530 Bacteria 49262
39 Ga0070679_100003703 3300005530 Bacteria 14009
40 Ga0070679_100115626 3300005530 Bacteria 2668
41 Ga0070697_100023117 3300005536 Bacteria 4942
42 Ga0070672_100122032 3300005543 Bacteria 2134
43 Ga0070665_100065592 3300005548 Bacteria 3642
44 Ga0070665_100128898 3300005548 Bacteria 2532
45 Ga0070704_100000829 3300005549 Bacteria 15351
46 Ga0068855_100001428 3300005563 Bacteria 29696
47 Ga0068855_100335986 3300005563 Bacteria 1667
48 Ga0068859_100002344 3300005617 Bacteria 19259
49 Ga0068859_100177695 3300005617 Bacteria 2211
50 Ga0068858_100000057 3300005842 Bacteria 117928
51 Ga0068860_100028843 3300005843 Bacteria 5340
52 Ga0068860_100048481 3300005843 Bacteria 4049
53 Ga0068862_100001246 3300005844 Bacteria 23940
54 Ga0068862_100001720 3300005844 Bacteria 19803
55 Ga0081455_10005120 3300005937 Bacteria 14454
56 Ga0081539_10003816 3300005985 Bacteria 17715
57 Ga0075365_10053199 3300006038 Bacteria 2681
58 Ga0075428_100042123 3300006844 Bacteria 5022
59 Ga0075428_100076994 3300006844 Bacteria 3641
60 Ga0075428_100543830 3300006844 Bacteria 1242
61 Ga0075430_100008562 3300006846 Bacteria 8629
62 Ga0075431_100001414 3300006847 Bacteria 22041
63 Ga0075431_100018633 3300006847 Bacteria 7072
64 Ga0075433_10488377 3300006852 Bacteria 1084
65 Ga0075429_100035112 3300006880 Bacteria 4359
66 Ga0075429_100073849 3300006880 Bacteria 2970
67 Ga0097620_100002344 3300006931 Bacteria 19259
68 Ga0097620_100118009 3300006931 Bacteria 2719
69 Ga0097620_100177698 3300006931 Bacteria 2211
70 Ga0105251_10005632 3300009011 Bacteria 8137
71 Ga0105251_10063677 3300009011 Bacteria 1730
72 Ga0105240_10016421 3300009093 Bacteria 10024
73 Ga0105247_10000042 3300009101 Bacteria 158046
74 Ga0114129_10000039 3300009147 Bacteria 108531
75 Ga0114129_10010025 3300009147 Bacteria 13507
76 Ga0114129_10082714 3300009147 Bacteria 4460
77 Ga0114129_10435507 3300009147 Bacteria 1722
78 Ga0105243_10049493 3300009148 Bacteria 3316
79 Ga0105243_10106763 3300009148 Bacteria 2335
80 Ga0105243_10507253 3300009148 Bacteria 1144
81 Ga0105242_10080521 3300009176 Bacteria 2722
82 Ga0105242_10146791 3300009176 Bacteria 2053
83 Ga0105242_10284826 3300009176 Bacteria 1502
84 Ga0105248_10000065 3300009177 Bacteria 121445
85 Ga0105248_10006153 3300009177 Bacteria 13157
86 Ga0105248_10160300 3300009177 Bacteria 2538
87 Ga0105249_10005736 3300009553 Bacteria 10735
88 Ga0105246_10092132 3300011119 Bacteria 2186
89 Ga0105246_10101654 3300011119 Bacteria 2094
90 Ga0157370_10063744 3300013104 Bacteria 3490
91 Ga0157369_10001067 3300013105 Bacteria 34384
92 Ga0157369_10028541 3300013105 Bacteria 6176
93 Ga0157369_10111843 3300013105 Bacteria 2902
94 Ga0157369_10365454 3300013105 Bacteria 1498
95 Ga0157374_10262379 3300013296 Bacteria 1702
96 Ga0157375_10275539 3300013308 Bacteria 1845
97 Ga0157375_10379706 3300013308 Bacteria 1580
98 Ga0163163_10013191 3300014325 Bacteria 7552
99 Ga0163163_10604019 3300014325 Bacteria 1160
100 Ga0157380_10414164 3300014326 Bacteria 1283
101 Ga0157379_10000612 3300014968 Bacteria 28845
102 Ga0157379_10003460 3300014968 Bacteria 13359
103 Ga0157379_10039906 3300014968 Bacteria 4189
104 Ga0163161_10091645 3300017792 Bacteria 2250
105 Ga0206354_11281303 3300020081 Bacteria 13672
106 Ga0206353_10404455 3300020082 Bacteria 11000
107 Ga0213873_10000642 3300021358 Bacteria 5720
108 Ga0213874_10008215 3300021377 Bacteria 2537
109 Ga0213876_10050168 3300021384 Bacteria 2205
110 Ga0213875_10003846 3300021388 Bacteria 8428
111 Ga0213875_10004414 3300021388 Bacteria 7725
112 Ga0209025_1000596 3300025294 Bacteria 65217
113 Ga0207697_10002311 3300025315 Bacteria 9938
114 Ga0207655_1002784 3300025728 Bacteria 13599
115 Ga0207653_10004298 3300025885 Bacteria 4474
116 Ga0207682_10028391 3300025893 Bacteria 2232
117 Ga0207692_10000171 3300025898 Bacteria 20632
118 Ga0207710_10000058 3300025900 Bacteria 172242
119 Ga0207710_10000092 3300025900 Bacteria 121199
120 Ga0207645_10000377 3300025907 Bacteria 36714
121 Ga0207643_10047335 3300025908 Bacteria 2433
122 Ga0207705_10002204 3300025909 Bacteria 15064
123 Ga0207705_10010836 3300025909 Bacteria 6619
124 Ga0207705_10251255 3300025909 Bacteria 1349
125 Ga0207707_10000066 3300025912 Bacteria 106182
126 Ga0207707_10000376 3300025912 Bacteria 46648
127 Ga0207707_10084081 3300025912 Bacteria 2779
128 Ga0207707_10167873 3300025912 Bacteria 1918
129 Ga0207695_10029460 3300025913 Bacteria 6064
130 Ga0207660_10000470 3300025917 Bacteria 26751
131 Ga0207660_10000754 3300025917 Bacteria 21515
132 Ga0207660_10110278 3300025917 Bacteria 2070
133 Ga0207657_10176881 3300025919 Bacteria 1727
134 Ga0207652_10000182 3300025921 Bacteria 66390
135 Ga0207652_10000591 3300025921 Bacteria 36343
136 Ga0207652_10031676 3300025921 Bacteria 4443
137 Ga0207652_10074136 3300025921 Bacteria 2963
138 Ga0207652_10109206 3300025921 Bacteria 2452
139 Ga0207652_10111444 3300025921 Bacteria 2427
140 Ga0207681_10097774 3300025923 Bacteria 2110
141 Ga0207650_10002153 3300025925 Bacteria 13758
142 Ga0207664_10024980 3300025929 Bacteria 4494
143 Ga0207664_10274091 3300025929 Bacteria 1479
144 Ga0207706_10140123 3300025933 Bacteria 2128
145 Ga0207686_10093263 3300025934 Bacteria 1993
146 Ga0207709_10020744 3300025935 Bacteria 3711
147 Ga0207669_10011464 3300025937 Bacteria 4315
148 Ga0207669_10107461 3300025937 Bacteria 1861
149 Ga0207704_10056230 3300025938 Bacteria 2409
150 Ga0207704_10282588 3300025938 Bacteria 1262
151 Ga0207691_10028499 3300025940 Bacteria 5229
152 Ga0207691_10130956 3300025940 Bacteria 2216
153 Ga0207711_10000113 3300025941 Bacteria 84359
154 Ga0207711_10341326 3300025941 Bacteria 1386
155 Ga0207651_10076305 3300025960 Bacteria 2395
156 Ga0207712_10375744 3300025961 Bacteria 1188
157 Ga0207703_10000074 3300026035 Bacteria 118844
158 Ga0207678_10021375 3300026067 Bacteria 5674
159 Ga0207708_10017055 3300026075 Bacteria 5466
160 Ga0207648_10073698 3300026089 Bacteria 2975
161 Ga0207683_10002627 3300026121 Bacteria 15705
162 Ga0207683_10043001 3300026121 Bacteria 3946
163 Ga0207683_10105547 3300026121 Bacteria 2518
164 Ga0207683_10515494 3300026121 Bacteria 1105
165 Ga0268266_10093003 3300028379 Bacteria 2646
166 Ga0268266_10251204 3300028379 Bacteria 1636
167 Ga0268265_10000039 3300028380 Bacteria 198606
168 Ga0268265_10001196 3300028380 Bacteria 22609
169 Ga0268265_10180930 3300028380 Bacteria 1811
170 Ga0268264_10012402 3300028381 Bacteria 7015
171 Ga0307517_10160927 3300028786 Bacteria 1507
172 Ga0307515_10000436 3300028794 Bacteria 100131
173 Ga0307515_10014931 3300028794 Bacteria 14353
174 Ga0265338_10055320 3300028800 Bacteria 3530
175 Ga0265338_10070340 3300028800 Bacteria 3001
176 Ga0307512_10003331 3300030522 Bacteria 18848
177 Ga0307512_10008862 3300030522 Bacteria 9757
178 Ga0307512_10057858 3300030522 Bacteria 3026
179 Ga0316176_1022095 3300030732 Bacteria 5973
180 Ga0314311_1113890 3300030733 Bacteria 5144
181 Ga0316180_1183122 3300030736 Bacteria 3310
182 Ga0265340_10002581 3300031247 Bacteria 10284
183 Ga0265340_10002853 3300031247 Bacteria 9837
184 Ga0265339_10139993 3300031249 Bacteria 1232
185 Ga0307513_10016595 3300031456 Bacteria 8875
186 Ga0307513_10099715 3300031456 Bacteria 2932
187 Ga0307509_10110231 3300031507 Bacteria 2759
188 Ga0307408_100218434 3300031548 Bacteria 1554
189 Ga0307508_10004053 3300031616 Bacteria 14495
190 Ga0307516_10002049 3300031730 Bacteria 27469
191 Ga0307516_10064755 3300031730 Bacteria 3533
192 Ga0307410_10078460 3300031852 Bacteria 2311
193 Ga0307406_10009355 3300031901 Bacteria 5493
194 Ga0307406_10044008 3300031901 Bacteria 2796
195 Ga0307406_10103454 3300031901 Bacteria 1945
196 Ga0307407_10054179 3300031903 Bacteria 2312
197 Ga0307412_10189089 3300031911 Bacteria 1555
198 Ga0307409_100021678 3300031995 Bacteria 4411
199 Ga0307409_100064559 3300031995 Bacteria 2877
200 Ga0307409_100258868 3300031995 Bacteria 1595
201 Ga0307409_100329519 3300031995 Bacteria 1432
202 Ga0307416_100025107 3300032002 Bacteria 4363
203 Ga0307416_100029149 3300032002 Bacteria 4119
204 Ga0307416_100038774 3300032002 Bacteria 3679
205 Ga0307416_100345146 3300032002 Bacteria 1504
206 Ga0307416_100449220 3300032002 Bacteria 1341
207 Ga0307414_10147845 3300032004 Bacteria 1849
208 Ga0307414_10206617 3300032004 Bacteria 1602
209 Ga0307415_100044918 3300032126 Bacteria 2958
210 Ga0307415_100083725 3300032126 Bacteria 2286
211 Ga0307415_100106115 3300032126 Bacteria 2073
212 Ga0316583_10042681 3300032133 Bacteria 1603
213 Ga0373937_0192745 3300036401 Bacteria 1915
214 Ga0265778_000399 3300036457 Bacteria 3375
215 Ga0395899_0120913 3300037312 Bacteria 1876
216 Ga0395898_0015295 3300037466 Bacteria 7875
217 Ga0395898_0023381 3300037466 Bacteria 6247
218 Ga0395898_0025337 3300037466 Bacteria 5979
219 Ga0395905_0000115 3300037471 Bacteria 133996
220 Ga0436364_1184375 3300037853 Bacteria 65712
221 Ga0436364_1377792 3300037853 Bacteria 24360
222 Ga0395901_0012452 3300038443 Bacteria 8633
223 Ga0395901_0021395 3300038443 Bacteria 6626
224 Ga0436365_1371755 3300039437 Bacteria 4217
225 Ga0436363_0170025 3300039450 Bacteria 8219
226 Ga0436363_0497135 3300039450 Bacteria 1167
227 Ga0436362_0951368 3300039453 Bacteria 53655
228 Ga0439449_0023297 3300042007 Bacteria 2316
229 Ga0451577_0031010 3300042876 Bacteria 4826
230 Ga0466969_0002221 3300044656 Bacteria 10370
231 Ga0466969_0023762 3300044656 Bacteria 3157
232 Ga0466965_0015600 3300044683 Bacteria 3609
233 Ga0466965_0027333 3300044683 Bacteria 2769
234 Ga0466966_0006495 3300044684 Bacteria 7739
235 Ga0466961_0010196 3300044693 Bacteria 5986
236 Ga0466961_0210194 3300044693 Bacteria 1201
237 Ga0466963_0069234 3300044694 Bacteria 2371
238 Ga0466963_0096307 3300044694 Bacteria 2021
239 Ga0466971_0009519 3300044719 Bacteria 4242
240 Ga0466968_0000128 3300044735 Bacteria 22239
241 Ga0466957_0201370 3300044842 Bacteria 1308
242 Ga0466960_0001896 3300044901 Bacteria 7694
243 Ga0466960_0024996 3300044901 Bacteria 2699
244 Ga0466959_0035670 3300045049 Bacteria 3676
245 Ga0466959_0044523 3300045049 Bacteria 3270
246 Ga0466958_0076256 3300045836 Bacteria 2058
247 Ga0466967_0049977 3300045976 Bacteria 3659
248 Ga0495638_0000504 3300046460 Bacteria 46106
249 Ga0495638_0025766 3300046460 Bacteria 3818
250 Ga0495651_0001064 3300046462 Bacteria 21212
251 Ga0495653_0002086 3300046463 Bacteria 15738
252 Ga0495653_0114266 3300046463 Bacteria 1934
253 Ga0495580_0019269 3300046472 Bacteria 5069
254 Ga0495582_0022157 3300046473 Bacteria 3476
255 Ga0495639_0083679 3300046475 Bacteria 1489
256 Ga0495662_0000944 3300046476 Bacteria 14235
257 Ga0495662_0003679 3300046476 Bacteria 7731
258 Ga0495664_0001220 3300046477 Bacteria 13451
259 Ga0495664_0008836 3300046477 Bacteria 5629
260 Ga0495594_0003472 3300046499 Bacteria 8138
261 Ga0495608_0001061 3300046511 Bacteria 19348
262 Ga0495618_0055425 3300046514 Bacteria 2510
263 Ga0495628_0004626 3300046516 Bacteria 12158
264 Ga0495630_0008531 3300046517 Bacteria 7356
265 Ga0495630_0051825 3300046517 Bacteria 3071
266 Ga0495666_0002423 3300046526 Bacteria 9275
267 Ga0495642_0013595 3300046528 Bacteria 3152
268 Ga0495665_0006070 3300046531 Bacteria 6518
269 Ga0495665_0011809 3300046531 Bacteria 4731
270 Ga0495640_0015322 3300046533 Bacteria 5771
271 Ga0495586_0000724 3300046535 Bacteria 18847
272 Ga0495586_0006003 3300046535 Bacteria 6494
273 Ga0495587_0010457 3300046536 Bacteria 5904
274 Ga0495645_0005615 3300046543 Bacteria 8628
275 Ga0495645_0010094 3300046543 Bacteria 6616
276 Ga0495645_0030788 3300046543 Bacteria 3909
277 Ga0495645_0046199 3300046543 Bacteria 3175
278 Ga0495667_0000400 3300046559 Bacteria 27725
279 Ga0495667_0008263 3300046559 Bacteria 7057
280 Ga0495656_0001937 3300046615 Bacteria 6829
281 Ga0495656_0102820 3300046615 Bacteria 1324
282 Ga0495656_0146039 3300046615 Bacteria 1138
283 Ga0495634_0086707 3300046642 Bacteria 2038
284 Ga0495635_0005243 3300046663 Bacteria 9017
285 Ga0495635_0066516 3300046663 Bacteria 2472
286 Ga0495588_0016487 3300046674 Bacteria 3571
287 Ga0495657_0010837 3300046675 Bacteria 6844
288 Ga0495623_0011089 3300046679 Bacteria 5832
289 Ga0495623_0080906 3300046679 Bacteria 2010
290 Ga0495646_0038694 3300046680 Bacteria 2943
291 Ga0495658_0121383 3300046683 Bacteria 1581
292 Ga0495613_0026667 3300046689 Bacteria 4303
293 Ga0495670_0003692 3300046691 Bacteria 7524
294 Ga0495670_0073479 3300046691 Bacteria 1733
295 Ga0495600_0150733 3300046809 Bacteria 1505
296 Ga0495600_0272789 3300046809 Bacteria 1072
297 Ga0495581_0005497 3300047315 Bacteria 7334
298 Ga0495581_0043990 3300047315 Bacteria 2582
299 Ga0495581_0054451 3300047315 Bacteria 2309
300 Ga0495581_0056211 3300047315 Bacteria 2271
301 Ga0495604_0001988 3300047317 Bacteria 16503
302 Ga0495604_0068467 3300047317 Bacteria 2694
303 Ga0495674_0234821 3300047319 Bacteria 1512
304 Ga0495680_0022624 3300047322 Bacteria 5236
305 Ga0495675_0037199 3300047444 Bacteria 3099
306 Ga0495675_0085391 3300047444 Bacteria 1984
307 Ga0495675_0117175 3300047444 Bacteria 1660
308 Ga0495684_0153091 3300047471 Bacteria 1723
309 Ga0495686_0004479 3300047472 Bacteria 11486
310 Ga0495593_0012391 3300047673 Bacteria 4874
311 Ga0496100_0070876 3300048903 Bacteria 2325
312 Ga0496100_0263592 3300048903 Bacteria 1279
313 Ga0496101_0009688 3300048904 Bacteria 6340
314 Ga0496101_0143639 3300048904 Bacteria 1821
315 Ga0496102_0000532 3300048905 Bacteria 41259
316 Ga0496102_0025145 3300048905 Bacteria 5296
317 Ga0496102_0053613 3300048905 Bacteria 3675
318 Ga0496102_0054898 3300048905 Bacteria 3633
319 Ga0496102_0158591 3300048905 Bacteria 2128
320 Ga0496103_0010102 3300048906 Bacteria 5580
321 Ga0496103_0089774 3300048906 Bacteria 1938
322 Ga0496104_0037733 3300048907 Bacteria 4518
323 Ga0496104_0342668 3300048907 Bacteria 1407
324 Ga0496105_0077563 3300048908 Bacteria 2744
325 Ga0496106_0000745 3300048909 Bacteria 23471
326 Ga0496107_0002468 3300048910 Bacteria 11997
327 Ga0496107_0008061 3300048910 Bacteria 7274
328 Ga0496108_0072505 3300048911 Bacteria 2907
329 Ga0496108_0082725 3300048911 Bacteria 2722
330 Ga0496108_0163048 3300048911 Bacteria 1927
331 Ga0496109_0040627 3300048912 Bacteria 4212
332 Ga0496109_0112465 3300048912 Bacteria 2532
333 Ga0496109_0132261 3300048912 Bacteria 2329
334 Ga0496110_0151607 3300048913 Bacteria 2099
335 Ga0496111_0034522 3300048914 Bacteria 3611
336 Ga0496112_0234795 3300048915 Bacteria 1788
337 Ga0496113_0021424 3300048916 Bacteria 4559
338 Ga0496115_0030328 3300048918 Bacteria 4254
339 Ga0496115_0251049 3300048918 Bacteria 1456
340 Ga0496116_0000133 3300048919 Bacteria 153938
341 Ga0496117_0013552 3300048920 Bacteria 7106
342 Ga0496118_0001804 3300048921 Bacteria 30851
343 Ga0496118_0002251 3300048921 Bacteria 26452
344 Ga0496119_0004985 3300048922 Bacteria 12958
345 Ga0496119_0013025 3300048922 Bacteria 6675
346 Ga0496119_0099872 3300048922 Bacteria 1631
347 Ga0496120_0004690 3300048923 Bacteria 11284
348 Ga0496120_0107984 3300048923 Bacteria 1459
349 Ga0496121_0012993 3300048924 Bacteria 8999
350 Ga0496121_0029712 3300048924 Bacteria 5042
351 Ga0496121_0098210 3300048924 Bacteria 2267
352 Ga0496124_0035281 3300048927 Bacteria 4377
353 Ga0496125_0212747 3300048928 Bacteria 1254
354 Ga0495682_0056465 3300049460 Bacteria 1423
355 Ga0501036_0215285 3300049572 Bacteria 1614
356 Ga0501041_0176596 3300049577 Bacteria 1337
357 Ga0501042_0350734 3300049578 Bacteria 1067
358 Ga0501070_0206780 3300049586 Bacteria 1612
359 Ga0501071_0270291 3300049587 Bacteria 1285
360 Ga0501072_0020942 3300049588 Bacteria 5069
361 Ga0501072_0117337 3300049588 Bacteria 2120
362 Ga0501075_0094065 3300049591 Bacteria 2275
363 Ga0501076_0012040 3300049592 Bacteria 6464
364 Ga0501076_0120200 3300049592 Bacteria 2127
365 Ga0501079_0013104 3300049741 Bacteria 6322
366 Ga0501080_0071847 3300049742 Bacteria 3219
367 Ga0501081_0007128 3300049743 Bacteria 7266
368 Ga0501081_0258785 3300049743 Bacteria 1271
369 Ga0501083_0017025 3300049744 Bacteria 5075
370 Ga0501045_0013606 3300049824 Bacteria 5749
371 Ga0501045_0084052 3300049824 Bacteria 2348
372 nmdc:mga05p37_153_c1 3300050507 Bacteria 65478
373 nmdc:mga05p37_379563_c1 3300050507 Bacteria 1657
374 nmdc:mga05p37_698371_c1 3300050507 Bacteria 1127
375 nmdc:mga09592_218791_c1 3300050508 Bacteria 1650
376 nmdc:mga09592_4_c1 3300050508 Bacteria 133185
377 nmdc:mga09592_75518_c1 3300050508 Bacteria 2865
378 nmdc:mga0qj67_3_c2 3300050509 Bacteria 152036
379 nmdc:mga0qj67_625_c1 3300050509 Bacteria 24268
380 nmdc:mga0qj67_8801_c1 3300050509 Bacteria 7490
381 nmdc:mga06r32_36370_c1 3300050510 Bacteria 3632
382 nmdc:mga06r32_68704_c1 3300050510 Bacteria 3424
383 nmdc:mga06r32_6_c2 3300050510 Bacteria 109995
384 Ga0500641_0062202 3300053096 Bacteria 1557
385 Ga0500555_024119 3300053103 Bacteria 1744
386 Ga0500594_0010251 3300053118 Bacteria 2173
387 Ga0500568_0020879 3300053139 Bacteria 2826
388 Ga0501084_0061919 3300054114 Bacteria 3133
389 Ga0501084_0189221 3300054114 Bacteria 1736
390 Ga0501082_0354649 3300060353 Bacteria 1279
391 Ga0466962_0020240 3300061719 Bacteria 3199
392 Ga0530510_0079835 3300061734 Bacteria 2380
393 2753072944 2751185734 Bacteria 8863695
394 2501945012 2501939600 Bacteria 6907073
395 2508674795 2508501039 Bacteria 9978592
396 2514046392 2513237166 Bacteria 10373764
397 2517759004 2517572101 Bacteria 6884336
398 2579858224 2579778521 Bacteria 7624758
399 2619858866 2619618881 Bacteria 7521104
400 2620353998 2619619003 Bacteria 7619552
401 2623499214 2622736605 Bacteria 4992138
402 2626637075 2626541554 Bacteria 7741902
403 2671838058 2671180195 Bacteria 9757215
404 2676202616 2675902999 Bacteria 9438463
405 2676484156 2675903059 Bacteria 8644972
406 2689959084 2687453737 Bacteria 11203906
407 2774847192 2773857921 Bacteria 9435764
408 2774856214 2773857922 Bacteria 9757215
409 2791910409 2791354901 Bacteria 8322202
410 2795785756 2795385470 Bacteria 8317180
411 2795796803 2795385472 Bacteria 6627535
412 2819692928 2818991462 Bacteria 4320267
413 2819727334 2818991469 Bacteria 4644110
414 2819739036 2818991472 Bacteria 10089953
415 2856290019 2856287931 Bacteria 7223934
416 2856860169 2856858025 Bacteria 7255264
417 2857362940 2857357740 Bacteria 9937880
418 2858870081 2858868258 Bacteria 7683772
419 2858905415 2858902515 Bacteria 7086037
420 2867512526 2867507094 Bacteria 6506033
421 2870727170 2870721527 Bacteria 9689237
422 2891330146 2891326441 Bacteria 6439512
423 2891398385 2891395885 Bacteria 9251614
424 2891400634 2891395885 Bacteria 9251614
425 2891555558 2891554331 Bacteria 8812224
426 2921648669 2921643360 Bacteria 11448031
427 2954696919 2954691527 Bacteria 10720516
428 2954705216 2954701450 Bacteria 10834262
429 2995467559 2995463766 Bacteria 8577691
430 2996223378 2996221748 Bacteria 6799777
431 649810870 649633069 Bacteria 6962533
432 8001789272 8001781756 Bacteria 9586736
433 8001790178 8001781756 Bacteria 9586736
434 8002777684 8002775197 Bacteria 10728764
435 8002788407 8002784119 Bacteria 9788632
436 8003857610 8003856774 Bacteria 7675274
437 8004023488 8004021418 Bacteria 4313954
438 8047717011 8047710418 Bacteria 11023148
439 8054111341 8054107350 Bacteria 5022511
440 8054919190 8054913762 Bacteria 7713009
441 8054926473 8054920844 Bacteria 7068637
442 8055162341 8055157932 Bacteria 6429399
443 8057535850 8057529695 Bacteria 6306553
444 JGI25159J45721_1000087
445 JGI25151J46595_10003060
446 JGI25406J46586_10017557
447 Ga0070658_10002283
448 Ga0070658_10066143
449 Ga0070666_10013881
450 Ga0070680_100004871
451 Ga0070680_100122861
452 Ga0070660_100105180
453 Ga0070660_100138369
454 Ga0070691_10011837
455 Ga0070661_100058258
456 Ga0070669_100008169
457 Ga0070675_100016114
458 Ga0070675_100204441
459 Ga0070671_100059770
460 Ga0070674_100003120
461 Ga0070674_100020081
462 Ga0070673_100006068
463 Ga0070667_100062618
464 Ga0070703_10018191
465 Ga0070709_10009756
466 Ga0070714_100023722
467 Ga0070713_100039040
468 Ga0070710_10001380
469 Ga0070705_100001260
470 Ga0070700_100005719
471 Ga0070694_100001230
472 Ga0070708_100002843
473 Ga0070663_100015658
474 Ga0070678_100021400
475 Ga0070678_100034494
476 Ga0070681_10000045
477 Ga0070681_10003004
478 Ga0070681_10072369
479 Ga0070698_100014078
480 Ga0070699_100001764
481 Ga0070679_100000198
482 Ga0070679_100003703
483 Ga0070679_100115626
484 Ga0070697_100023117
485 Ga0070672_100122032
486 Ga0070665_100065592
487 Ga0070665_100128898
488 Ga0070704_100000829
489 Ga0068855_100001428
490 Ga0068855_100335986
491 Ga0068859_100002344
492 Ga0068859_100177695
493 Ga0068858_100000057
494 Ga0068860_100028843
495 Ga0068860_100048481
496 Ga0068862_100001246
497 Ga0068862_100001720
498 Ga0081455_10005120
499 Ga0081539_10003816
500 Ga0075365_10053199
501 Ga0075428_100042123
502 Ga0075428_100076994
503 Ga0075428_100543830
504 Ga0075430_100008562
505 Ga0075431_100001414
506 Ga0075431_100018633
507 Ga0075433_10488377
508 Ga0075429_100035112
509 Ga0075429_100073849
510 Ga0097620_100002344
511 Ga0097620_100118009
512 Ga0097620_100177698
513 Ga0105251_10005632
514 Ga0105251_10063677
515 Ga0105240_10016421
516 Ga0105247_10000042
517 Ga0114129_10000039
518 Ga0114129_10010025
519 Ga0114129_10082714
520 Ga0114129_10435507
521 Ga0105243_10049493
522 Ga0105243_10106763
523 Ga0105243_10507253
524 Ga0105242_10080521
525 Ga0105242_10146791
526 Ga0105242_10284826
527 Ga0105248_10000065
528 Ga0105248_10006153
529 Ga0105248_10160300
530 Ga0105249_10005736
531 Ga0105246_10092132
532 Ga0105246_10101654
533 Ga0157370_10063744
534 Ga0157369_10001067
535 Ga0157369_10028541
536 Ga0157369_10111843
537 Ga0157369_10365454
538 Ga0157374_10262379
539 Ga0157375_10275539
540 Ga0157375_10379706
541 Ga0163163_10013191
542 Ga0163163_10604019
543 Ga0157380_10414164
544 Ga0157379_10000612
545 Ga0157379_10003460
546 Ga0157379_10039906
547 Ga0163161_10091645
548 Ga0206354_11281303
549 Ga0206353_10404455
550 Ga0213873_10000642
551 Ga0213874_10008215
552 Ga0213876_10050168
553 Ga0213875_10003846
554 Ga0213875_10004414
555 Ga0209025_1000596
556 Ga0207697_10002311
557 Ga0207655_1002784
558 Ga0207653_10004298
559 Ga0207682_10028391
560 Ga0207692_10000171
561 Ga0207710_10000058
562 Ga0207710_10000092
563 Ga0207645_10000377
564 Ga0207643_10047335
565 Ga0207705_10002204
566 Ga0207705_10010836
567 Ga0207705_10251255
568 Ga0207707_10000066
569 Ga0207707_10000376
570 Ga0207707_10084081
571 Ga0207707_10167873
572 Ga0207695_10029460
573 Ga0207660_10000470
574 Ga0207660_10000754
575 Ga0207660_10110278
576 Ga0207657_10176881
577 Ga0207652_10000182
578 Ga0207652_10000591
579 Ga0207652_10031676
580 Ga0207652_10074136
581 Ga0207652_10109206
582 Ga0207652_10111444
583 Ga0207681_10097774
584 Ga0207650_10002153
585 Ga0207664_10024980
586 Ga0207664_10274091
587 Ga0207706_10140123
588 Ga0207686_10093263
589 Ga0207709_10020744
590 Ga0207669_10011464
591 Ga0207669_10107461
592 Ga0207704_10056230
593 Ga0207704_10282588
594 Ga0207691_10028499
595 Ga0207691_10130956
596 Ga0207711_10000113
597 Ga0207711_10341326
598 Ga0207651_10076305
599 Ga0207712_10375744
600 Ga0207703_10000074
601 Ga0207678_10021375
602 Ga0207708_10017055
603 Ga0207648_10073698
604 Ga0207683_10002627
605 Ga0207683_10043001
606 Ga0207683_10105547
607 Ga0207683_10515494
608 Ga0268266_10093003
609 Ga0268266_10251204
610 Ga0268265_10000039
611 Ga0268265_10001196
612 Ga0268265_10180930
613 Ga0268264_10012402
614 Ga0307517_10160927
615 Ga0307515_10000436
616 Ga0307515_10014931
617 Ga0265338_10055320
618 Ga0265338_10070340
619 Ga0307512_10003331
620 Ga0307512_10008862
621 Ga0307512_10057858
622 Ga0316176_1022095
623 Ga0314311_1113890
624 Ga0316180_1183122
625 Ga0265340_10002581
626 Ga0265340_10002853
627 Ga0265339_10139993
628 Ga0307513_10016595
629 Ga0307513_10099715
630 Ga0307509_10110231
631 Ga0307408_100218434
632 Ga0307508_10004053
633 Ga0307516_10002049
634 Ga0307516_10064755
635 Ga0307410_10078460
636 Ga0307406_10009355
637 Ga0307406_10044008
638 Ga0307406_10103454
639 Ga0307407_10054179
640 Ga0307412_10189089
641 Ga0307409_100021678
642 Ga0307409_100064559
643 Ga0307409_100258868
644 Ga0307409_100329519
645 Ga0307416_100025107
646 Ga0307416_100029149
647 Ga0307416_100038774
648 Ga0307416_100345146
649 Ga0307416_100449220
650 Ga0307414_10147845
651 Ga0307414_10206617
652 Ga0307415_100044918
653 Ga0307415_100083725
654 Ga0307415_100106115
655 Ga0316583_10042681
656 Ga0373937_0192745
657 Ga0265778_000399
658 Ga0395899_0120913
659 Ga0395898_0015295
660 Ga0395898_0023381
661 Ga0395898_0025337
662 Ga0395905_0000115
663 Ga0436364_1184375
664 Ga0436364_1377792
665 Ga0395901_0012452
666 Ga0395901_0021395
667 Ga0436365_1371755
668 Ga0436363_0170025
669 Ga0436363_0497135
670 Ga0436362_0951368
671 Ga0439449_0023297
672 Ga0451577_0031010
673 Ga0466969_0002221
674 Ga0466969_0023762
675 Ga0466965_0015600
676 Ga0466965_0027333
677 Ga0466966_0006495
678 Ga0466961_0010196
679 Ga0466961_0210194
680 Ga0466963_0069234
681 Ga0466963_0096307
682 Ga0466971_0009519
683 Ga0466968_0000128
684 Ga0466957_0201370
685 Ga0466960_0001896
686 Ga0466960_0024996
687 Ga0466959_0035670
688 Ga0466959_0044523
689 Ga0466958_0076256
690 Ga0466967_0049977
691 Ga0495638_0000504
692 Ga0495638_0025766
693 Ga0495651_0001064
694 Ga0495653_0002086
695 Ga0495653_0114266
696 Ga0495580_0019269
697 Ga0495582_0022157
698 Ga0495639_0083679
699 Ga0495662_0000944
700 Ga0495662_0003679
701 Ga0495664_0001220
702 Ga0495664_0008836
703 Ga0495594_0003472
704 Ga0495608_0001061
705 Ga0495618_0055425
706 Ga0495628_0004626
707 Ga0495630_0008531
708 Ga0495630_0051825
709 Ga0495666_0002423
710 Ga0495642_0013595
711 Ga0495665_0006070
712 Ga0495665_0011809
713 Ga0495640_0015322
714 Ga0495586_0000724
715 Ga0495586_0006003
716 Ga0495587_0010457
717 Ga0495645_0005615
718 Ga0495645_0010094
719 Ga0495645_0030788
720 Ga0495645_0046199
721 Ga0495667_0000400
722 Ga0495667_0008263
723 Ga0495656_0001937
724 Ga0495656_0102820
725 Ga0495656_0146039
726 Ga0495634_0086707
727 Ga0495635_0005243
728 Ga0495635_0066516
729 Ga0495588_0016487
730 Ga0495657_0010837
731 Ga0495623_0011089
732 Ga0495623_0080906
733 Ga0495646_0038694
734 Ga0495658_0121383
735 Ga0495613_0026667
736 Ga0495670_0003692
737 Ga0495670_0073479
738 Ga0495600_0150733
739 Ga0495600_0272789
740 Ga0495581_0005497
741 Ga0495581_0043990
742 Ga0495581_0054451
743 Ga0495581_0056211
744 Ga0495604_0001988
745 Ga0495604_0068467
746 Ga0495674_0234821
747 Ga0495680_0022624
748 Ga0495675_0037199
749 Ga0495675_0085391
750 Ga0495675_0117175
751 Ga0495684_0153091
752 Ga0495686_0004479
753 Ga0495593_0012391
754 Ga0496100_0070876
755 Ga0496100_0263592
756 Ga0496101_0009688
757 Ga0496101_0143639
758 Ga0496102_0000532
759 Ga0496102_0025145
760 Ga0496102_0053613
761 Ga0496102_0054898
762 Ga0496102_0158591
763 Ga0496103_0010102
764 Ga0496103_0089774
765 Ga0496104_0037733
766 Ga0496104_0342668
767 Ga0496105_0077563
768 Ga0496106_0000745
769 Ga0496107_0002468
770 Ga0496107_0008061
771 Ga0496108_0072505
772 Ga0496108_0082725
773 Ga0496108_0163048
774 Ga0496109_0040627
775 Ga0496109_0112465
776 Ga0496109_0132261
777 Ga0496110_0151607
778 Ga0496111_0034522
779 Ga0496112_0234795
780 Ga0496113_0021424
781 Ga0496115_0030328
782 Ga0496115_0251049
783 Ga0496116_0000133
784 Ga0496117_0013552
785 Ga0496118_0001804
786 Ga0496118_0002251
787 Ga0496119_0004985
788 Ga0496119_0013025
789 Ga0496119_0099872
790 Ga0496120_0004690
791 Ga0496120_0107984
792 Ga0496121_0012993
793 Ga0496121_0029712
794 Ga0496121_0098210
795 Ga0496124_0035281
796 Ga0496125_0212747
797 Ga0495682_0056465
798 Ga0501036_0215285
799 Ga0501041_0176596
800 Ga0501042_0350734
801 Ga0501070_0206780
802 Ga0501071_0270291
803 Ga0501072_0020942
804 Ga0501072_0117337
805 Ga0501075_0094065
806 Ga0501076_0012040
807 Ga0501076_0120200
808 Ga0501079_0013104
809 Ga0501080_0071847
810 Ga0501081_0007128
811 Ga0501081_0258785
812 Ga0501083_0017025
813 Ga0501045_0013606
814 Ga0501045_0084052
815 nmdc:mga05p37_153_c1
816 nmdc:mga05p37_379563_c1
817 nmdc:mga05p37_698371_c1
818 nmdc:mga09592_218791_c1
819 nmdc:mga09592_4_c1
820 nmdc:mga09592_75518_c1
821 nmdc:mga0qj67_3_c2
822 nmdc:mga0qj67_625_c1
823 nmdc:mga0qj67_8801_c1
824 nmdc:mga06r32_36370_c1
825 nmdc:mga06r32_68704_c1
826 nmdc:mga06r32_6_c2
827 Ga0500641_0062202
828 Ga0500555_024119
829 Ga0500594_0010251
830 Ga0500568_0020879
831 Ga0501084_0061919
832 Ga0501084_0189221
833 Ga0501082_0354649
834 Ga0466962_0020240
835 Ga0530510_0079835
836 2753072944
837 2501945012
838 2508674795
839 2514046392
840 2517759004
841 2579858224
842 2619858866
843 2620353998
844 2623499214
845 2626637075
846 2671838058
847 2676202616
848 2676484156
849 2689959084
850 2774847192
851 2774856214
852 2791910409
853 2795785756
854 2795796803
855 2819692928
856 2819727334
857 2819739036
858 2856290019
859 2856860169
860 2857362940
861 2858870081
862 2858905415
863 2867512526
864 2870727170
865 2891330146
866 2891398385
867 2891400634
868 2891555558
869 2921648669
870 2954696919
871 2954705216
872 2995467559
873 2996223378
874 649810870
875 8001789272
876 8001790178
877 8002777684
878 8002788407
879 8003857610
880 8004023488
881 8047717011
882 8054111341
883 8054919190
884 8054926473
885 8055162341
886 8057535850

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

50

348

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7utf-assembly1.cif.gz_C structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9532 1 324
7utf-assembly2.cif.gz_D structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9458 1 327
7utf-assembly2.cif.gz_B structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9427 1 327
7utf-assembly1.cif.gz_A structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9383 1 324
4xk2-assembly2.cif.gz_B crystal structure of aldo-keto reductase from polaromonas sp. js666 0.9378 1 322
ID Description Score Start End Superfamily
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9393 1 326 3.20.20.100
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9308 1 326 3.20.20.100
4xapA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.92 6 322 3.20.20.100
af_A0A1D6KXU0_49_191_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9188 1 130 3.20.20.100
af_O59826_13_339_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9166 1 323 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A832ALX0-F1-model_v4 Aldo/keto reductase 0.9895 1 206 GO:0005829
AF-A0A6I3AV08-F1-model_v4 deleted 0.9845 1 219
AF-A0A536CH75-F1-model_v4 Aldo/keto reductase 0.9827 73 268 GO:0005829
GO:0016491
AF-A0A7C4YQS2-F1-model_v4 Aldo/keto reductase 0.9826 1 220 GO:0016020
GO:0016491
AF-A0A7Y5GJ78-F1-model_v4 Aldo/keto reductase 0.9813 1 202 GO:0005829
GO:0016491

Map