F445223

General Info

Members Datasets Scaffolds Average Seq Length
444 197 888 258

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100000626|Ga0070670_10000062611
Length 307
Sequence MGGGRCRPLQRDSFMKYKLRMLLIVLAIGGLVHGQTNPPPAPRLANGKINLGTAGGEKGVWVPPNAGDERLVELDSSMAATANPFAIETNPLQRTPRPAGVTSATAGFPGKLTVSQVPFQPWARALYAFRAENQLEPHIRCKPSGGPRQFLTPYGVEFVDLPEIRRIYIVDIGGPHSMRLIDMDAGAHPKDLEPSDYGHSIGQWQGDTLVVDTIGFNEKFWIDRQGTPHTDKLHLVERFTRSDFNTLKYEFTIDDPGAYTAQWSSGILLRWSPGQELFEYVCQDNNLAPDLAVGQAGAIDRHSVIVP

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
142 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
143 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
144 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
145 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
146 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
153 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
159 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
162 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
165 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
171 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.13
Rhizosphere 98.87
Stem 0
Stem Tuber 0
Unclassified 21.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100000626 3300005331 Bacteria 27664
2 JGI24746J21847_1001312 3300001977 Unclassified 3968
3 JGI25406J46586_10000914 3300003203 Bacteria 13867
4 Ga0058863_11596308 3300004799 Bacteria 1416
5 Ga0065704_10118302 3300005289 Bacteria 1818
6 Ga0065715_10093285 3300005293 Bacteria 4739
7 Ga0065707_10211703 3300005295 Bacteria 1263
8 Ga0070658_10084488 3300005327 Bacteria 2610
9 Ga0070676_10112612 3300005328 Bacteria 1696
10 Ga0070676_10191674 3300005328 Unclassified 1335
11 Ga0070683_100006371 3300005329 Bacteria 9897
12 Ga0070683_100013274 3300005329 Bacteria 7179
13 Ga0070690_100008275 3300005330 Bacteria 5983
14 Ga0070690_100034739 3300005330 Bacteria 3160
15 Ga0070690_100253747 3300005330 Unclassified 1245
16 Ga0070670_100001818 3300005331 Bacteria 17378
17 Ga0070670_100003462 3300005331 Bacteria 13103
18 Ga0070670_100029452 3300005331 Bacteria 4727
19 Ga0070670_100290395 3300005331 Unclassified 1429
20 Ga0070670_100472383 3300005331 Bacteria 1113
21 Ga0070677_10002043 3300005333 Bacteria 6421
22 Ga0070677_10047306 3300005333 Bacteria 1724
23 Ga0068869_100050780 3300005334 Unclassified 3007
24 Ga0068869_100146078 3300005334 Bacteria 1830
25 Ga0070666_10001605 3300005335 Bacteria 13755
26 Ga0070666_10022675 3300005335 Bacteria 4079
27 Ga0070682_100191852 3300005337 Unclassified 1435
28 Ga0068868_100001940 3300005338 Bacteria 14191
29 Ga0068868_100133924 3300005338 Bacteria 2030
30 Ga0068868_100203403 3300005338 Unclassified 1652
31 Ga0070689_100011003 3300005340 Bacteria 6467
32 Ga0070687_100010039 3300005343 Bacteria 4076
33 Ga0070687_100028660 3300005343 Bacteria 2703
34 Ga0070661_100049848 3300005344 Bacteria 3065
35 Ga0070692_10041240 3300005345 Unclassified 2364
36 Ga0070668_100021463 3300005347 Bacteria 4879
37 Ga0070669_100031720 3300005353 Bacteria 3817
38 Ga0070669_100034057 3300005353 Bacteria 3687
39 Ga0070669_100043507 3300005353 Bacteria 3271
40 Ga0070669_100103330 3300005353 Unclassified 2153
41 Ga0070669_100228057 3300005353 Unclassified 1475
42 Ga0070675_100000586 3300005354 Bacteria 24958
43 Ga0070675_100001215 3300005354 Bacteria 18727
44 Ga0070675_100018469 3300005354 Bacteria 5551
45 Ga0070675_100027439 3300005354 Bacteria 4574
46 Ga0070675_100107786 3300005354 Unclassified 2353
47 Ga0070675_100110505 3300005354 Bacteria 2325
48 Ga0070675_100149134 3300005354 Unclassified 2004
49 Ga0070675_100325918 3300005354 Bacteria 1357
50 Ga0070671_100149501 3300005355 Unclassified 1972
51 Ga0070671_100175289 3300005355 Unclassified 1814
52 Ga0070674_100050640 3300005356 Unclassified 2859
53 Ga0070674_100220868 3300005356 Bacteria 1474
54 Ga0070673_100000410 3300005364 Bacteria 22606
55 Ga0070673_100004440 3300005364 Bacteria 8873
56 Ga0070673_100028015 3300005364 Bacteria 4184
57 Ga0070673_100033322 3300005364 Bacteria 3888
58 Ga0070673_100038369 3300005364 Bacteria 3658
59 Ga0070673_100577771 3300005364 Unclassified 1023
60 Ga0070688_100019655 3300005365 Unclassified 3916
61 Ga0070688_100027984 3300005365 Bacteria 3360
62 Ga0070667_100007130 3300005367 Bacteria 9291
63 Ga0070667_100015497 3300005367 Bacteria 6302
64 Ga0070667_100114115 3300005367 Bacteria 2345
65 Ga0070709_10008166 3300005434 Bacteria 5747
66 Ga0070713_100094435 3300005436 Bacteria 2578
67 Ga0070710_10042452 3300005437 Bacteria 2515
68 Ga0070710_10243463 3300005437 Bacteria 1153
69 Ga0070701_10193856 3300005438 Unclassified 1197
70 Ga0070700_100025700 3300005441 Bacteria 3469
71 Ga0070663_100009017 3300005455 Bacteria 6160
72 Ga0070678_100295204 3300005456 Bacteria 1375
73 Ga0070662_100033661 3300005457 Bacteria 3610
74 Ga0070662_100184877 3300005457 Unclassified 1645
75 Ga0068867_100087411 3300005459 Bacteria 2360
76 Ga0068867_100120346 3300005459 Unclassified 2028
77 Ga0068867_100304192 3300005459 Bacteria 1316
78 Ga0070685_10009649 3300005466 Bacteria 4996
79 Ga0070685_10134803 3300005466 Bacteria 1548
80 Ga0070698_100332451 3300005471 Bacteria 1451
81 Ga0070684_100009191 3300005535 Bacteria 7775
82 Ga0070684_100132060 3300005535 Bacteria 2253
83 Ga0070697_100477667 3300005536 Bacteria 1088
84 Ga0070672_100383360 3300005543 Bacteria 1203
85 Ga0070686_100002629 3300005544 Bacteria 9904
86 Ga0070686_100119532 3300005544 Unclassified 1807
87 Ga0070686_100480815 3300005544 Unclassified 960
88 Ga0070665_100026135 3300005548 Bacteria 5878
89 Ga0068855_100045807 3300005563 Bacteria 5171
90 Ga0070664_100001356 3300005564 Bacteria 19539
91 Ga0070664_100038646 3300005564 Bacteria 4018
92 Ga0070664_100084160 3300005564 Unclassified 2745
93 Ga0068857_100001054 3300005577 Bacteria 21353
94 Ga0068856_100121946 3300005614 Bacteria 2609
95 Ga0068856_100137898 3300005614 Bacteria 2445
96 Ga0068859_100058679 3300005617 Bacteria 3877
97 Ga0068859_100076318 3300005617 Bacteria 3392
98 Ga0068859_100116484 3300005617 Bacteria 2737
99 Ga0068859_100286292 3300005617 Unclassified 1741
100 Ga0068859_100339492 3300005617 Bacteria 1596
101 Ga0068859_100645131 3300005617 Bacteria 1151
102 Ga0068864_100050161 3300005618 Bacteria 3591
103 Ga0068864_100699306 3300005618 Bacteria 990
104 Ga0068861_100031929 3300005719 Bacteria 3873
105 Ga0068861_100044561 3300005719 Bacteria 3336
106 Ga0068870_10010727 3300005840 Bacteria 4219
107 Ga0068870_10034575 3300005840 Unclassified 2587
108 Ga0068870_10146241 3300005840 Bacteria 1388
109 Ga0068863_100001585 3300005841 Bacteria 22528
110 Ga0068863_100023617 3300005841 Bacteria 5870
111 Ga0068863_100081971 3300005841 Bacteria 3056
112 Ga0068863_100330976 3300005841 Bacteria 1481
113 Ga0068858_100021954 3300005842 Bacteria 5961
114 Ga0068858_100022603 3300005842 Bacteria 5866
115 Ga0068860_100062605 3300005843 Bacteria 3535
116 Ga0068860_100071370 3300005843 Bacteria 3300
117 Ga0068862_100071031 3300005844 Bacteria 3006
118 Ga0068862_100107284 3300005844 Unclassified 2449
119 Ga0068862_100130890 3300005844 Bacteria 2219
120 Ga0081539_10012142 3300005985 Bacteria 6688
121 Ga0097621_100010076 3300006237 Bacteria 6893
122 Ga0097621_100018791 3300006237 Bacteria 5289
123 Ga0097621_100087272 3300006237 Bacteria 2605
124 Ga0068871_100014321 3300006358 Bacteria 5909
125 Ga0068871_100018419 3300006358 Bacteria 5306
126 Ga0068871_100085829 3300006358 Archaea 2615
127 Ga0075428_100021690 3300006844 Bacteria 7111
128 Ga0075428_100023978 3300006844 Bacteria 6752
129 Ga0075428_100033856 3300006844 Bacteria 5636
130 Ga0075428_100090522 3300006844 Unclassified 3337
131 Ga0075428_100174917 3300006844 Unclassified 2325
132 Ga0075428_100194697 3300006844 Bacteria 2192
133 Ga0075428_100315081 3300006844 Bacteria 1681
134 Ga0075430_100003261 3300006846 Bacteria 13593
135 Ga0075430_100042963 3300006846 Bacteria 3821
136 Ga0075430_100091690 3300006846 Bacteria 2541
137 Ga0075431_100003341 3300006847 Bacteria 15543
138 Ga0075431_100011346 3300006847 Bacteria 8977
139 Ga0075431_100042083 3300006847 Bacteria 4711
140 Ga0075431_100053454 3300006847 Bacteria 4164
141 Ga0075431_100119399 3300006847 Bacteria 2720
142 Ga0075431_100218554 3300006847 Unclassified 1944
143 Ga0075433_10000251 3300006852 Bacteria 31061
144 Ga0075433_10023216 3300006852 Bacteria 5217
145 Ga0075433_10096965 3300006852 Bacteria 2610
146 Ga0075434_100005488 3300006871 Bacteria 11549
147 Ga0075434_100006717 3300006871 Bacteria 10568
148 Ga0075434_100025739 3300006871 Bacteria 5759
149 Ga0075434_100082350 3300006871 Bacteria 3215
150 Ga0075434_100114875 3300006871 Bacteria 2705
151 Ga0075434_100138246 3300006871 Bacteria 2456
152 Ga0075434_100217435 3300006871 Unclassified 1931
153 Ga0075429_100030098 3300006880 Bacteria 4716
154 Ga0075429_100040847 3300006880 Unclassified 4038
155 Ga0075429_100052557 3300006880 Bacteria 3545
156 Ga0075429_100091378 3300006880 Bacteria 2656
157 Ga0075429_100122128 3300006880 Unclassified 2277
158 Ga0075429_100250568 3300006880 Bacteria 1551
159 Ga0068865_100322327 3300006881 Bacteria 1243
160 Ga0075436_100015371 3300006914 Bacteria 5243
161 Ga0097620_100058680 3300006931 Bacteria 3877
162 Ga0097620_100076315 3300006931 Bacteria 3392
163 Ga0097620_100116481 3300006931 Bacteria 2737
164 Ga0097620_100286285 3300006931 Unclassified 1741
165 Ga0097620_100339486 3300006931 Bacteria 1596
166 Ga0097620_100645105 3300006931 Bacteria 1151
167 Ga0075435_100005384 3300007076 Bacteria 8927
168 Ga0075435_100062348 3300007076 Unclassified 3025
169 Ga0105240_10372803 3300009093 Bacteria 1613
170 Ga0111539_10007388 3300009094 Bacteria 14075
171 Ga0111539_10038964 3300009094 Bacteria 5731
172 Ga0111539_10060539 3300009094 Bacteria 4487
173 Ga0111539_10123588 3300009094 Unclassified 3033
174 Ga0111539_10313316 3300009094 Unclassified 1826
175 Ga0105245_10001610 3300009098 Bacteria 20538
176 Ga0105245_10005955 3300009098 Bacteria 10711
177 Ga0105245_10011788 3300009098 Bacteria 7605
178 Ga0105245_10688222 3300009098 Bacteria 1055
179 Ga0114129_10008757 3300009147 Bacteria 14431
180 Ga0114129_10020870 3300009147 Bacteria 9306
181 Ga0114129_10023863 3300009147 Bacteria 8668
182 Ga0114129_10045968 3300009147 Bacteria 6136
183 Ga0114129_10048163 3300009147 Bacteria 5989
184 Ga0114129_10059767 3300009147 Bacteria 5329
185 Ga0114129_10111614 3300009147 Bacteria 3772
186 Ga0114129_10197044 3300009147 Unclassified 2730
187 Ga0114129_10268356 3300009147 Bacteria 2284
188 Ga0114129_10512817 3300009147 Bacteria 1564
189 Ga0114129_10602878 3300009147 Bacteria 1423
190 Ga0114129_10739364 3300009147 Bacteria 1260
191 Ga0105243_10075064 3300009148 Unclassified 2744
192 Ga0105243_10194651 3300009148 Unclassified 1773
193 Ga0105243_10473189 3300009148 Unclassified 1181
194 Ga0105242_10025873 3300009176 Bacteria 4648
195 Ga0105242_10147876 3300009176 Unclassified 2045
196 Ga0105248_10003628 3300009177 Bacteria 17122
197 Ga0105248_10025687 3300009177 Bacteria 6551
198 Ga0105248_10067368 3300009177 Bacteria 4019
199 Ga0105248_10670082 3300009177 Bacteria 1170
200 Ga0105248_10910747 3300009177 Unclassified 993
201 Ga0105238_10003839 3300009551 Bacteria 14925
202 Ga0105238_10012721 3300009551 Bacteria 8494
203 Ga0105249_10012368 3300009553 Bacteria 7522
204 Ga0105249_10019650 3300009553 Bacteria 6029
205 Ga0105249_10032113 3300009553 Bacteria 4750
206 Ga0105239_10021227 3300010375 Bacteria 7160
207 Ga0105246_10022345 3300011119 Unclassified 4080
208 Ga0157371_10161517 3300013102 Bacteria 1600
209 Ga0157369_10007628 3300013105 Bacteria 12446
210 Ga0157374_10205650 3300013296 Unclassified 1929
211 Ga0157374_10503299 3300013296 Unclassified 1216
212 Ga0157378_10016522 3300013297 Bacteria 6463
213 Ga0157378_10138754 3300013297 Bacteria 2256
214 Ga0157378_10202756 3300013297 Unclassified 1877
215 Ga0163162_10000713 3300013306 Bacteria 30827
216 Ga0163162_10011337 3300013306 Bacteria 8692
217 Ga0163162_10262477 3300013306 Bacteria 1859
218 Ga0163162_10442769 3300013306 Bacteria 1431
219 Ga0157372_10047231 3300013307 Bacteria 4783
220 Ga0157372_10118053 3300013307 Unclassified 3043
221 Ga0157375_10173970 3300013308 Bacteria 2302
222 Ga0157375_10292614 3300013308 Bacteria 1792
223 Ga0157375_10296919 3300013308 Bacteria 1779
224 Ga0157375_10314184 3300013308 Unclassified 1731
225 Ga0157375_10831199 3300013308 Bacteria 1071
226 Ga0163163_10006096 3300014325 Bacteria 10496
227 Ga0163163_10022596 3300014325 Bacteria 5960
228 Ga0163163_10034548 3300014325 Bacteria 4898
229 Ga0163163_10094290 3300014325 Unclassified 3011
230 Ga0163163_10102318 3300014325 Unclassified 2888
231 Ga0163163_10432850 3300014325 Bacteria 1375
232 Ga0157380_10000692 3300014326 Bacteria 20969
233 Ga0157380_10044593 3300014326 Bacteria 3476
234 Ga0157380_10064505 3300014326 Unclassified 2941
235 Ga0157377_10045098 3300014745 Bacteria 2461
236 Ga0157379_10010897 3300014968 Bacteria 7925
237 Ga0157379_10167695 3300014968 Bacteria 1982
238 Ga0157379_10212701 3300014968 Bacteria 1751
239 Ga0157376_10122606 3300014969 Bacteria 2306
240 Ga0157376_10540900 3300014969 Bacteria 1151
241 Ga0157376_10756344 3300014969 Bacteria 981
242 Ga0163161_10121774 3300017792 Bacteria 1961
243 Ga0163161_10219763 3300017792 Bacteria 1471
244 Ga0206352_11071442 3300020078 Bacteria 1659
245 Ga0207682_10001377 3300025893 Bacteria 11222
246 Ga0207682_10018403 3300025893 Bacteria 2731
247 Ga0207682_10171041 3300025893 Bacteria 988
248 Ga0207642_10228408 3300025899 Bacteria 1044
249 Ga0207688_10011723 3300025901 Bacteria 4769
250 Ga0207680_10087809 3300025903 Bacteria 1970
251 Ga0207699_10012804 3300025906 Bacteria 4272
252 Ga0207645_10002151 3300025907 Bacteria 15755
253 Ga0207643_10000847 3300025908 Bacteria 18546
254 Ga0207643_10023569 3300025908 Bacteria 3394
255 Ga0207643_10055669 3300025908 Bacteria 2249
256 Ga0207654_10118865 3300025911 Bacteria 1656
257 Ga0207693_10087934 3300025915 Bacteria 2435
258 Ga0207663_10180127 3300025916 Unclassified 1508
259 Ga0207662_10129513 3300025918 Unclassified 1590
260 Ga0207657_10223636 3300025919 Bacteria 1507
261 Ga0207649_10061847 3300025920 Unclassified 2358
262 Ga0207649_10354153 3300025920 Unclassified 1087
263 Ga0207681_10023999 3300025923 Bacteria 3908
264 Ga0207681_10026441 3300025923 Bacteria 3743
265 Ga0207681_10105065 3300025923 Bacteria 2044
266 Ga0207681_10113733 3300025923 Bacteria 1973
267 Ga0207681_10200385 3300025923 Unclassified 1532
268 Ga0207694_10033257 3300025924 Bacteria 3950
269 Ga0207694_10081414 3300025924 Unclassified 2543
270 Ga0207650_10060208 3300025925 Bacteria 2833
271 Ga0207650_10109144 3300025925 Bacteria 2139
272 Ga0207650_10144131 3300025925 Unclassified 1875
273 Ga0207659_10000507 3300025926 Bacteria 23364
274 Ga0207659_10000821 3300025926 Bacteria 18397
275 Ga0207659_10000904 3300025926 Bacteria 17666
276 Ga0207659_10009088 3300025926 Bacteria 6201
277 Ga0207659_10013636 3300025926 Bacteria 5213
278 Ga0207659_10084712 3300025926 Bacteria 2353
279 Ga0207659_10104660 3300025926 Unclassified 2140
280 Ga0207687_10001565 3300025927 Bacteria 15722
281 Ga0207687_10005605 3300025927 Bacteria 8297
282 Ga0207687_10074103 3300025927 Bacteria 2439
283 Ga0207687_10418356 3300025927 Bacteria 1105
284 Ga0207706_10016778 3300025933 Bacteria 6609
285 Ga0207709_10095731 3300025935 Unclassified 1951
286 Ga0207704_10077954 3300025938 Unclassified 2129
287 Ga0207704_10085665 3300025938 Unclassified 2052
288 Ga0207691_10003859 3300025940 Bacteria 14545
289 Ga0207691_10447038 3300025940 Bacteria 1100
290 Ga0207711_10001600 3300025941 Bacteria 20931
291 Ga0207711_10067053 3300025941 Bacteria 3106
292 Ga0207689_10003934 3300025942 Bacteria 13528
293 Ga0207689_10020504 3300025942 Bacteria 5563
294 Ga0207689_10357824 3300025942 Bacteria 1214
295 Ga0207661_10026464 3300025944 Bacteria 4420
296 Ga0207661_10174852 3300025944 Bacteria 1871
297 Ga0207679_10050883 3300025945 Unclassified 3030
298 Ga0207667_10046841 3300025949 Unclassified 4579
299 Ga0207651_10021314 3300025960 Unclassified 3936
300 Ga0207651_10037684 3300025960 Bacteria 3169
301 Ga0207651_10064274 3300025960 Unclassified 2567
302 Ga0207651_10212150 3300025960 Bacteria 1559
303 Ga0207651_10344358 3300025960 Bacteria 1253
304 Ga0207712_10006439 3300025961 Bacteria 7404
305 Ga0207712_10012851 3300025961 Bacteria 5356
306 Ga0207712_10153718 3300025961 Bacteria 1780
307 Ga0207658_10028472 3300025986 Bacteria 3934
308 Ga0207658_10078673 3300025986 Bacteria 2520
309 Ga0207677_10003388 3300026023 Bacteria 8438
310 Ga0207677_10257739 3300026023 Unclassified 1420
311 Ga0207703_10016826 3300026035 Bacteria 5704
312 Ga0207703_10174762 3300026035 Unclassified 1892
313 Ga0207678_10045152 3300026067 Bacteria 3810
314 Ga0207708_10085702 3300026075 Bacteria 2424
315 Ga0207702_10156521 3300026078 Bacteria 2078
316 Ga0207641_10000541 3300026088 Bacteria 42410
317 Ga0207641_10112769 3300026088 Bacteria 2413
318 Ga0207641_10355595 3300026088 Bacteria 1397
319 Ga0207641_10574887 3300026088 Bacteria 1101
320 Ga0207648_10017189 3300026089 Bacteria 6591
321 Ga0207648_10141189 3300026089 Unclassified 2122
322 Ga0207676_10626027 3300026095 Bacteria 1036
323 Ga0207674_10006132 3300026116 Bacteria 14208
324 Ga0207674_10149199 3300026116 Bacteria 2296
325 Ga0207674_10431471 3300026116 Unclassified 1274
326 Ga0207675_100041704 3300026118 Bacteria 4285
327 Ga0207675_100091533 3300026118 Bacteria 2860
328 Ga0207428_10000756 3300027907 Bacteria 36837
329 Ga0207428_10001149 3300027907 Bacteria 28662
330 Ga0207428_10016180 3300027907 Bacteria 6423
331 Ga0207428_10065231 3300027907 Bacteria 2873
332 Ga0268265_10160659 3300028380 Bacteria 1908
333 Ga0268265_10178526 3300028380 Bacteria 1822
334 Ga0268264_10007066 3300028381 Bacteria 9410
335 Ga0268264_10234011 3300028381 Bacteria 1698
336 Ga0265314_10081000 3300031711 Bacteria 2141
337 Ga0307410_10036090 3300031852 Bacteria 3216
338 Ga0307411_10173239 3300032005 Bacteria 1630
339 Ga0373934_0003538 3300035086 Bacteria 5743
340 Ga0373940_0028403 3300035088 Bacteria 1476
341 Ga0373939_0024903 3300035114 Bacteria 1672
342 Ga0373939_0095716 3300035114 Unclassified 1011
343 Ga0373941_0038919 3300035115 Bacteria 1459
344 Ga0373956_0160408 3300035119 Bacteria 1060
345 Ga0373956_0190137 3300035119 Bacteria 972
346 Ga0373957_0081219 3300035120 Unclassified 1280
347 Ga0373955_0105325 3300035172 Bacteria 1624
348 Ga0373955_0249734 3300035172 Bacteria 1063
349 Ga0373962_0164845 3300035242 Unclassified 733
350 Ga0373931_0154755 3300035691 Bacteria 1339
351 Ga0373933_0083485 3300035724 Bacteria 1962
352 Ga0373937_0002681 3300036401 Bacteria 14847
353 Ga0373937_0045851 3300036401 Unclassified 3996
354 Ga0373937_0062113 3300036401 Bacteria 3434
355 Ga0373937_0064375 3300036401 Bacteria 3372
356 Ga0373937_0090558 3300036401 Bacteria 2833
357 Ga0373937_0358496 3300036401 Bacteria 1382
358 Ga0373937_0467474 3300036401 Bacteria 1198
359 Ga0450923_020370 3300042125 Bacteria 1285
360 Ga0450896_038473 3300042133 Bacteria 740
361 Ga0495592_0071605 3300046454 Bacteria 2523
362 Ga0495582_0008218 3300046473 Bacteria 5759
363 Ga0495639_0025854 3300046475 Unclassified 2591
364 Ga0495639_0078675 3300046475 Bacteria 1533
365 Ga0495639_0122348 3300046475 Unclassified 1242
366 Ga0495664_0143573 3300046477 Unclassified 1447
367 Ga0495608_0036808 3300046511 Bacteria 3292
368 Ga0495618_0026697 3300046514 Bacteria 3593
369 Ga0495618_0257712 3300046514 Unclassified 1093
370 Ga0495586_0044856 3300046535 Bacteria 2382
371 Ga0495586_0136663 3300046535 Unclassified 1374
372 Ga0495621_0093406 3300046539 Bacteria 1137
373 Ga0495633_0058439 3300046558 Bacteria 1810
374 Ga0495667_0054962 3300046559 Bacteria 2618
375 Ga0495659_0081375 3300046664 Bacteria 1230
376 Ga0495657_0028902 3300046675 Bacteria 3892
377 Ga0495657_0221221 3300046675 Bacteria 1147
378 Ga0495599_0228644 3300046678 Unclassified 1136
379 Ga0495647_0033858 3300046681 Unclassified 1911
380 Ga0495658_0241346 3300046683 Unclassified 1135
381 Ga0495658_0265122 3300046683 Unclassified 1082
382 Ga0495613_0021067 3300046689 Bacteria 4860
383 Ga0495613_0255004 3300046689 Bacteria 1223
384 Ga0495670_0170709 3300046691 Bacteria 1145
385 Ga0495581_0248266 3300047315 Unclassified 1041
386 Ga0495674_0446134 3300047319 Unclassified 1040
387 Ga0495675_0059788 3300047444 Bacteria 2416
388 Ga0495684_0023880 3300047471 Bacteria 4701
389 Ga0495684_0117034 3300047471 Bacteria 2009
390 Ga0496100_0003342 3300048903 Bacteria 8357
391 Ga0496101_0000660 3300048904 Bacteria 20776
392 Ga0496112_0049816 3300048915 Unclassified 4106
393 Ga0496114_0000409 3300048917 Bacteria 31807
394 Ga0496115_0250106 3300048918 Bacteria 1459
395 Ga0501039_0286626 3300049575 Bacteria 1295
396 Ga0501040_0342545 3300049576 Bacteria 1070
397 Ga0501042_0027107 3300049578 Bacteria 4028
398 Ga0501046_0033909 3300049580 Bacteria 4123
399 Ga0501048_0045530 3300049582 Bacteria 3134
400 Ga0501072_0054943 3300049588 Bacteria 3139
401 Ga0501075_0220042 3300049591 Bacteria 1448
402 Ga0501075_0307101 3300049591 Unclassified 1209
403 Ga0501079_0154645 3300049741 Bacteria 1788
404 Ga0501081_0155335 3300049743 Bacteria 1646
405 nmdc:mga05p37_149594_c1 3300050507 Bacteria 2857
406 nmdc:mga05p37_24583_c1 3300050507 Bacteria 7323
407 nmdc:mga05p37_273135_c1 3300050507 Bacteria 2019
408 nmdc:mga05p37_35230_c1 3300050507 Bacteria 6135
409 nmdc:mga05p37_376909_c1 3300050507 Unclassified 1663
410 nmdc:mga05p37_55582_c1 3300050507 Bacteria 4872
411 nmdc:mga09592_110693_c1 3300050508 Unclassified 2356
412 nmdc:mga09592_142133_c1 3300050508 Bacteria 2069
413 nmdc:mga09592_17587_c1 3300050508 Bacteria 5858
414 nmdc:mga09592_317153_c1 3300050508 Bacteria 1351
415 nmdc:mga09592_53417_c1 3300050508 Unclassified 3412
416 nmdc:mga09592_846_c1 3300050508 Bacteria 23790
417 nmdc:mga0qj67_11051_c1 3300050509 Bacteria 6759
418 nmdc:mga0qj67_131699_c1 3300050509 Unclassified 2025
419 nmdc:mga0qj67_27309_c1 3300050509 Bacteria 4422
420 nmdc:mga0qj67_376925_c1 3300050509 Unclassified 1146
421 nmdc:mga0qj67_9598_c1 3300050509 Bacteria 7213
422 nmdc:mga06r32_2905_c1 3300050510 Bacteria 15383
423 nmdc:mga06r32_407305_c1 3300050510 Unclassified 1342
424 nmdc:mga06r32_5278_c1 3300050510 Bacteria 11623
425 nmdc:mga06r32_55789_c1 3300050510 Bacteria 3791
426 nmdc:mga06r32_68787_c1 3300050510 Bacteria 3421
427 nmdc:mga06r32_89625_c1 3300050510 Bacteria 3003
428 nmdc:mga08y16_18003_c1 3300050511 Bacteria 7441
429 nmdc:mga08y16_390530_c1 3300050511 Bacteria 1426
430 nmdc:mga08y16_395667_c1 3300050511 Bacteria 1415
431 nmdc:mga08y16_40972_c1 3300050511 Bacteria 4852
432 nmdc:mga08y16_715_c1 3300050511 Bacteria 31535
433 nmdc:mga0n895_128632_c1 3300050512 Bacteria 2557
434 nmdc:mga0n895_51419_c1 3300050512 Bacteria 4042
435 nmdc:mga0n895_7151_c1 3300050512 Bacteria 9548
436 nmdc:mga0n895_81936_c1 3300050512 Bacteria 3216
437 nmdc:mga0n895_82286_c1 3300050512 Unclassified 3209
438 nmdc:mga0n895_845479_c1 3300050512 Bacteria 903
439 nmdc:mga0n895_9156_c1 3300050512 Bacteria 8645
440 nmdc:mga0rr50_93606_c1 3300050513 Bacteria 2345
441 nmdc:mga08x19_11155_c1 3300050514 Bacteria 5408
442 nmdc:mga0a205_2753_c1 3300050515 Bacteria 15530
443 nmdc:mga0a205_774_c1 3300050515 Bacteria 25869
444 nmdc:mga0a205_9233_c1 3300050515 Bacteria 9004
445 Ga0070670_100000626
446 JGI24746J21847_1001312
447 JGI25406J46586_10000914
448 Ga0058863_11596308
449 Ga0065704_10118302
450 Ga0065715_10093285
451 Ga0065707_10211703
452 Ga0070658_10084488
453 Ga0070676_10112612
454 Ga0070676_10191674
455 Ga0070683_100006371
456 Ga0070683_100013274
457 Ga0070690_100008275
458 Ga0070690_100034739
459 Ga0070690_100253747
460 Ga0070670_100001818
461 Ga0070670_100003462
462 Ga0070670_100029452
463 Ga0070670_100290395
464 Ga0070670_100472383
465 Ga0070677_10002043
466 Ga0070677_10047306
467 Ga0068869_100050780
468 Ga0068869_100146078
469 Ga0070666_10001605
470 Ga0070666_10022675
471 Ga0070682_100191852
472 Ga0068868_100001940
473 Ga0068868_100133924
474 Ga0068868_100203403
475 Ga0070689_100011003
476 Ga0070687_100010039
477 Ga0070687_100028660
478 Ga0070661_100049848
479 Ga0070692_10041240
480 Ga0070668_100021463
481 Ga0070669_100031720
482 Ga0070669_100034057
483 Ga0070669_100043507
484 Ga0070669_100103330
485 Ga0070669_100228057
486 Ga0070675_100000586
487 Ga0070675_100001215
488 Ga0070675_100018469
489 Ga0070675_100027439
490 Ga0070675_100107786
491 Ga0070675_100110505
492 Ga0070675_100149134
493 Ga0070675_100325918
494 Ga0070671_100149501
495 Ga0070671_100175289
496 Ga0070674_100050640
497 Ga0070674_100220868
498 Ga0070673_100000410
499 Ga0070673_100004440
500 Ga0070673_100028015
501 Ga0070673_100033322
502 Ga0070673_100038369
503 Ga0070673_100577771
504 Ga0070688_100019655
505 Ga0070688_100027984
506 Ga0070667_100007130
507 Ga0070667_100015497
508 Ga0070667_100114115
509 Ga0070709_10008166
510 Ga0070713_100094435
511 Ga0070710_10042452
512 Ga0070710_10243463
513 Ga0070701_10193856
514 Ga0070700_100025700
515 Ga0070663_100009017
516 Ga0070678_100295204
517 Ga0070662_100033661
518 Ga0070662_100184877
519 Ga0068867_100087411
520 Ga0068867_100120346
521 Ga0068867_100304192
522 Ga0070685_10009649
523 Ga0070685_10134803
524 Ga0070698_100332451
525 Ga0070684_100009191
526 Ga0070684_100132060
527 Ga0070697_100477667
528 Ga0070672_100383360
529 Ga0070686_100002629
530 Ga0070686_100119532
531 Ga0070686_100480815
532 Ga0070665_100026135
533 Ga0068855_100045807
534 Ga0070664_100001356
535 Ga0070664_100038646
536 Ga0070664_100084160
537 Ga0068857_100001054
538 Ga0068856_100121946
539 Ga0068856_100137898
540 Ga0068859_100058679
541 Ga0068859_100076318
542 Ga0068859_100116484
543 Ga0068859_100286292
544 Ga0068859_100339492
545 Ga0068859_100645131
546 Ga0068864_100050161
547 Ga0068864_100699306
548 Ga0068861_100031929
549 Ga0068861_100044561
550 Ga0068870_10010727
551 Ga0068870_10034575
552 Ga0068870_10146241
553 Ga0068863_100001585
554 Ga0068863_100023617
555 Ga0068863_100081971
556 Ga0068863_100330976
557 Ga0068858_100021954
558 Ga0068858_100022603
559 Ga0068860_100062605
560 Ga0068860_100071370
561 Ga0068862_100071031
562 Ga0068862_100107284
563 Ga0068862_100130890
564 Ga0081539_10012142
565 Ga0097621_100010076
566 Ga0097621_100018791
567 Ga0097621_100087272
568 Ga0068871_100014321
569 Ga0068871_100018419
570 Ga0068871_100085829
571 Ga0075428_100021690
572 Ga0075428_100023978
573 Ga0075428_100033856
574 Ga0075428_100090522
575 Ga0075428_100174917
576 Ga0075428_100194697
577 Ga0075428_100315081
578 Ga0075430_100003261
579 Ga0075430_100042963
580 Ga0075430_100091690
581 Ga0075431_100003341
582 Ga0075431_100011346
583 Ga0075431_100042083
584 Ga0075431_100053454
585 Ga0075431_100119399
586 Ga0075431_100218554
587 Ga0075433_10000251
588 Ga0075433_10023216
589 Ga0075433_10096965
590 Ga0075434_100005488
591 Ga0075434_100006717
592 Ga0075434_100025739
593 Ga0075434_100082350
594 Ga0075434_100114875
595 Ga0075434_100138246
596 Ga0075434_100217435
597 Ga0075429_100030098
598 Ga0075429_100040847
599 Ga0075429_100052557
600 Ga0075429_100091378
601 Ga0075429_100122128
602 Ga0075429_100250568
603 Ga0068865_100322327
604 Ga0075436_100015371
605 Ga0097620_100058680
606 Ga0097620_100076315
607 Ga0097620_100116481
608 Ga0097620_100286285
609 Ga0097620_100339486
610 Ga0097620_100645105
611 Ga0075435_100005384
612 Ga0075435_100062348
613 Ga0105240_10372803
614 Ga0111539_10007388
615 Ga0111539_10038964
616 Ga0111539_10060539
617 Ga0111539_10123588
618 Ga0111539_10313316
619 Ga0105245_10001610
620 Ga0105245_10005955
621 Ga0105245_10011788
622 Ga0105245_10688222
623 Ga0114129_10008757
624 Ga0114129_10020870
625 Ga0114129_10023863
626 Ga0114129_10045968
627 Ga0114129_10048163
628 Ga0114129_10059767
629 Ga0114129_10111614
630 Ga0114129_10197044
631 Ga0114129_10268356
632 Ga0114129_10512817
633 Ga0114129_10602878
634 Ga0114129_10739364
635 Ga0105243_10075064
636 Ga0105243_10194651
637 Ga0105243_10473189
638 Ga0105242_10025873
639 Ga0105242_10147876
640 Ga0105248_10003628
641 Ga0105248_10025687
642 Ga0105248_10067368
643 Ga0105248_10670082
644 Ga0105248_10910747
645 Ga0105238_10003839
646 Ga0105238_10012721
647 Ga0105249_10012368
648 Ga0105249_10019650
649 Ga0105249_10032113
650 Ga0105239_10021227
651 Ga0105246_10022345
652 Ga0157371_10161517
653 Ga0157369_10007628
654 Ga0157374_10205650
655 Ga0157374_10503299
656 Ga0157378_10016522
657 Ga0157378_10138754
658 Ga0157378_10202756
659 Ga0163162_10000713
660 Ga0163162_10011337
661 Ga0163162_10262477
662 Ga0163162_10442769
663 Ga0157372_10047231
664 Ga0157372_10118053
665 Ga0157375_10173970
666 Ga0157375_10292614
667 Ga0157375_10296919
668 Ga0157375_10314184
669 Ga0157375_10831199
670 Ga0163163_10006096
671 Ga0163163_10022596
672 Ga0163163_10034548
673 Ga0163163_10094290
674 Ga0163163_10102318
675 Ga0163163_10432850
676 Ga0157380_10000692
677 Ga0157380_10044593
678 Ga0157380_10064505
679 Ga0157377_10045098
680 Ga0157379_10010897
681 Ga0157379_10167695
682 Ga0157379_10212701
683 Ga0157376_10122606
684 Ga0157376_10540900
685 Ga0157376_10756344
686 Ga0163161_10121774
687 Ga0163161_10219763
688 Ga0206352_11071442
689 Ga0207682_10001377
690 Ga0207682_10018403
691 Ga0207682_10171041
692 Ga0207642_10228408
693 Ga0207688_10011723
694 Ga0207680_10087809
695 Ga0207699_10012804
696 Ga0207645_10002151
697 Ga0207643_10000847
698 Ga0207643_10023569
699 Ga0207643_10055669
700 Ga0207654_10118865
701 Ga0207693_10087934
702 Ga0207663_10180127
703 Ga0207662_10129513
704 Ga0207657_10223636
705 Ga0207649_10061847
706 Ga0207649_10354153
707 Ga0207681_10023999
708 Ga0207681_10026441
709 Ga0207681_10105065
710 Ga0207681_10113733
711 Ga0207681_10200385
712 Ga0207694_10033257
713 Ga0207694_10081414
714 Ga0207650_10060208
715 Ga0207650_10109144
716 Ga0207650_10144131
717 Ga0207659_10000507
718 Ga0207659_10000821
719 Ga0207659_10000904
720 Ga0207659_10009088
721 Ga0207659_10013636
722 Ga0207659_10084712
723 Ga0207659_10104660
724 Ga0207687_10001565
725 Ga0207687_10005605
726 Ga0207687_10074103
727 Ga0207687_10418356
728 Ga0207706_10016778
729 Ga0207709_10095731
730 Ga0207704_10077954
731 Ga0207704_10085665
732 Ga0207691_10003859
733 Ga0207691_10447038
734 Ga0207711_10001600
735 Ga0207711_10067053
736 Ga0207689_10003934
737 Ga0207689_10020504
738 Ga0207689_10357824
739 Ga0207661_10026464
740 Ga0207661_10174852
741 Ga0207679_10050883
742 Ga0207667_10046841
743 Ga0207651_10021314
744 Ga0207651_10037684
745 Ga0207651_10064274
746 Ga0207651_10212150
747 Ga0207651_10344358
748 Ga0207712_10006439
749 Ga0207712_10012851
750 Ga0207712_10153718
751 Ga0207658_10028472
752 Ga0207658_10078673
753 Ga0207677_10003388
754 Ga0207677_10257739
755 Ga0207703_10016826
756 Ga0207703_10174762
757 Ga0207678_10045152
758 Ga0207708_10085702
759 Ga0207702_10156521
760 Ga0207641_10000541
761 Ga0207641_10112769
762 Ga0207641_10355595
763 Ga0207641_10574887
764 Ga0207648_10017189
765 Ga0207648_10141189
766 Ga0207676_10626027
767 Ga0207674_10006132
768 Ga0207674_10149199
769 Ga0207674_10431471
770 Ga0207675_100041704
771 Ga0207675_100091533
772 Ga0207428_10000756
773 Ga0207428_10001149
774 Ga0207428_10016180
775 Ga0207428_10065231
776 Ga0268265_10160659
777 Ga0268265_10178526
778 Ga0268264_10007066
779 Ga0268264_10234011
780 Ga0265314_10081000
781 Ga0307410_10036090
782 Ga0307411_10173239
783 Ga0373934_0003538
784 Ga0373940_0028403
785 Ga0373939_0024903
786 Ga0373939_0095716
787 Ga0373941_0038919
788 Ga0373956_0160408
789 Ga0373956_0190137
790 Ga0373957_0081219
791 Ga0373955_0105325
792 Ga0373955_0249734
793 Ga0373962_0164845
794 Ga0373931_0154755
795 Ga0373933_0083485
796 Ga0373937_0002681
797 Ga0373937_0045851
798 Ga0373937_0062113
799 Ga0373937_0064375
800 Ga0373937_0090558
801 Ga0373937_0358496
802 Ga0373937_0467474
803 Ga0450923_020370
804 Ga0450896_038473
805 Ga0495592_0071605
806 Ga0495582_0008218
807 Ga0495639_0025854
808 Ga0495639_0078675
809 Ga0495639_0122348
810 Ga0495664_0143573
811 Ga0495608_0036808
812 Ga0495618_0026697
813 Ga0495618_0257712
814 Ga0495586_0044856
815 Ga0495586_0136663
816 Ga0495621_0093406
817 Ga0495633_0058439
818 Ga0495667_0054962
819 Ga0495659_0081375
820 Ga0495657_0028902
821 Ga0495657_0221221
822 Ga0495599_0228644
823 Ga0495647_0033858
824 Ga0495658_0241346
825 Ga0495658_0265122
826 Ga0495613_0021067
827 Ga0495613_0255004
828 Ga0495670_0170709
829 Ga0495581_0248266
830 Ga0495674_0446134
831 Ga0495675_0059788
832 Ga0495684_0023880
833 Ga0495684_0117034
834 Ga0496100_0003342
835 Ga0496101_0000660
836 Ga0496112_0049816
837 Ga0496114_0000409
838 Ga0496115_0250106
839 Ga0501039_0286626
840 Ga0501040_0342545
841 Ga0501042_0027107
842 Ga0501046_0033909
843 Ga0501048_0045530
844 Ga0501072_0054943
845 Ga0501075_0220042
846 Ga0501075_0307101
847 Ga0501079_0154645
848 Ga0501081_0155335
849 nmdc:mga05p37_149594_c1
850 nmdc:mga05p37_24583_c1
851 nmdc:mga05p37_273135_c1
852 nmdc:mga05p37_35230_c1
853 nmdc:mga05p37_376909_c1
854 nmdc:mga05p37_55582_c1
855 nmdc:mga09592_110693_c1
856 nmdc:mga09592_142133_c1
857 nmdc:mga09592_17587_c1
858 nmdc:mga09592_317153_c1
859 nmdc:mga09592_53417_c1
860 nmdc:mga09592_846_c1
861 nmdc:mga0qj67_11051_c1
862 nmdc:mga0qj67_131699_c1
863 nmdc:mga0qj67_27309_c1
864 nmdc:mga0qj67_376925_c1
865 nmdc:mga0qj67_9598_c1
866 nmdc:mga06r32_2905_c1
867 nmdc:mga06r32_407305_c1
868 nmdc:mga06r32_5278_c1
869 nmdc:mga06r32_55789_c1
870 nmdc:mga06r32_68787_c1
871 nmdc:mga06r32_89625_c1
872 nmdc:mga08y16_18003_c1
873 nmdc:mga08y16_390530_c1
874 nmdc:mga08y16_395667_c1
875 nmdc:mga08y16_40972_c1
876 nmdc:mga08y16_715_c1
877 nmdc:mga0n895_128632_c1
878 nmdc:mga0n895_51419_c1
879 nmdc:mga0n895_7151_c1
880 nmdc:mga0n895_81936_c1
881 nmdc:mga0n895_82286_c1
882 nmdc:mga0n895_845479_c1
883 nmdc:mga0n895_9156_c1
884 nmdc:mga0rr50_93606_c1
885 nmdc:mga08x19_11155_c1
886 nmdc:mga0a205_2753_c1
887 nmdc:mga0a205_774_c1
888 nmdc:mga0a205_9233_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gf6-assembly2.cif.gz_C crystal structure of a putative thioesterase (sso2295) from sulfolobus solfataricus at 1.91 a resolution 0.7897 175 216
3gvz-assembly2.cif.gz_B crystal structure of the protein cv2077 from chromobacterium violaceum. northeast structural genomics consortium target cvr62 0.7661 177 210
2e46-assembly1.cif.gz_A crystal structure analysis of the clock protein ea4 0.7427 172 197
2q78-assembly1.cif.gz_B crystal structure of a thioesterase-like protein (tm0581) from thermotoga maritima msb8 at 2.20 a resolution 0.7208 175 216
3sao-assembly1.cif.gz_A the siderocalin ex-fabp functions through dual ligand specificities 0.7194 176 216
ID Description Score Start End Superfamily
af_Q7XTY9_163_289_2.60.40.200 Mainly Beta;Sandwich;Immunoglobulin-like;Superoxide dismutase, copper/zinc binding domain 0.8202 174 197 2.60.40.200
af_E9PTR6_25_177_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7895 173 217 2.40.128.20
af_Q9P7J2_2_131_2.170.210.10 Mainly Beta;Beta Complex;Dna Repair Protein Xrcc4; Chain: A, domain 1;DNA double-strand break repair and VJ recombination XRCC4, N-terminal 0.7829 177 214 2.170.210.10
3gvzB00 Alpha Beta;4-Layer Sandwich;Penicillin V Acylase; Chain A;Penicillin V Acylase; Chain A 0.7661 177 210 3.60.60.10
3saoA01 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7194 176 216 2.40.128.20
ID Description Score Start End GO Terms
AF-A0A2V8KPN4-F1-model_v4 Uncharacterized protein 0.9595 118 218
AF-A0A2V8GP46-F1-model_v4 Uncharacterized protein 0.9355 125 224
AF-A0A2V8KPN4-F1-model_v4 Uncharacterized protein 0.9326 118 218
AF-A0A2V8J0E3-F1-model_v4 Uncharacterized protein 0.9257 107 224
AF-A0A2V8I2K0-F1-model_v4 Uncharacterized protein 0.9223 62 221

Map