F445226

General Info

Members Datasets Scaffolds Average Seq Length
444 256 888 157

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100011649|Ga0070680_1000116494
Length 185
Sequence MMMSRAAGGPSVMCGAASWMPGTSPGMTPNVWVAQSRKPRLEPVSTHSHDIEEGTALTPRFDAAGLVTAVVTDAASGEVLMVAHMNAEALQKTIESGEAWYFSRSRKALWKKGETSGHGQRVVELRVDCDQDAVWLRVEQAGGGACHTGRRSCFYRAVPLGKTGAVKLEFTGEKTFDPNKVYGKS

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
108 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
109 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
110 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
111 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
112 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
113 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
114 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
115 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
116 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
117 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
118 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
119 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
120 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
122 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
123 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
124 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
125 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
126 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
127 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
128 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
129 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
130 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
131 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
145 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
155 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
158 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
159 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
160 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
163 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
167 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
173 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
180 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
187 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
188 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
194 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
195 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
196 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
225 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
233 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
234 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
238 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
245 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
246 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
247 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
248 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
249 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
250 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
251 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
252 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
253 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
254 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
255 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
256 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.95
Nodule 0
Rhizoplane 13.74
Rhizosphere 80.41
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100011649 3300005336 Bacteria 6814
2 Ga0070690_100044634 3300005330 Bacteria 2814
3 Ga0070690_100748635 3300005330 Bacteria 754
4 Ga0068869_100371080 3300005334 Bacteria 1171
5 Ga0068868_100273769 3300005338 Bacteria 1427
6 Ga0070689_100970383 3300005340 Bacteria 755
7 Ga0070691_10058394 3300005341 Bacteria 1852
8 Ga0070687_100476782 3300005343 Bacteria 835
9 Ga0070675_100483788 3300005354 Bacteria 1114
10 Ga0070675_100770624 3300005354 Bacteria 878
11 Ga0070671_100003913 3300005355 Bacteria 11715
12 Ga0070673_100016863 3300005364 Bacteria 5178
13 Ga0070673_100723963 3300005364 Bacteria 915
14 Ga0070688_100133607 3300005365 Bacteria 1677
15 Ga0070667_100519417 3300005367 Bacteria 1093
16 Ga0070709_10286719 3300005434 Bacteria 1198
17 Ga0070705_100104900 3300005440 Bacteria 1793
18 Ga0070700_100556185 3300005441 Bacteria 892
19 Ga0070708_100275301 3300005445 Bacteria 1583
20 Ga0070681_10031525 3300005458 Bacteria 5322
21 Ga0070681_10047836 3300005458 Bacteria 4275
22 Ga0070699_101008292 3300005518 Bacteria 763
23 Ga0070679_100141575 3300005530 Bacteria 2384
24 Ga0070684_100063219 3300005535 Bacteria 3244
25 Ga0068853_100205965 3300005539 Bacteria 1791
26 Ga0068853_100269961 3300005539 Bacteria 1566
27 Ga0070672_100734356 3300005543 Bacteria 866
28 Ga0070686_100802499 3300005544 Bacteria 759
29 Ga0070686_100913887 3300005544 Bacteria 715
30 Ga0070693_100110582 3300005547 Bacteria 1690
31 Ga0070665_100116636 3300005548 Bacteria 2673
32 Ga0070704_100053435 3300005549 Bacteria 2855
33 Ga0070704_100865467 3300005549 Bacteria 811
34 Ga0068855_100227362 3300005563 Bacteria 2090
35 Ga0068855_100433672 3300005563 Bacteria 1436
36 Ga0068855_100532411 3300005563 Bacteria 1274
37 Ga0070664_100973672 3300005564 Bacteria 797
38 Ga0070664_101310746 3300005564 Bacteria 684
39 Ga0068864_101425167 3300005618 Bacteria 695
40 Ga0068863_100726369 3300005841 Bacteria 988
41 Ga0068858_100127963 3300005842 Bacteria 2380
42 Ga0081455_10125037 3300005937 Bacteria 2020
43 Ga0081455_10163381 3300005937 Bacteria 1704
44 Ga0070717_10404677 3300006028 Bacteria 1226
45 Ga0070717_10675685 3300006028 Bacteria 938
46 Ga0075365_10007599 3300006038 Bacteria 6089
47 Ga0075365_10136032 3300006038 Bacteria 1703
48 Ga0075363_100135246 3300006048 Bacteria 1385
49 Ga0075364_10958237 3300006051 Bacteria 582
50 Ga0070712_100026375 3300006175 Bacteria 3870
51 Ga0070712_100197599 3300006175 Bacteria 1578
52 Ga0070712_100457137 3300006175 Bacteria 1064
53 Ga0075367_10130299 3300006178 Bacteria 1554
54 Ga0075367_10349211 3300006178 Bacteria 933
55 Ga0075366_10447381 3300006195 Bacteria 797
56 Ga0097621_100494816 3300006237 Bacteria 1107
57 Ga0097621_101056241 3300006237 Bacteria 761
58 Ga0075370_10292757 3300006353 Bacteria 967
59 Ga0075370_10407529 3300006353 Bacteria 816
60 Ga0068871_100172551 3300006358 Bacteria 1855
61 Ga0068871_100781439 3300006358 Bacteria 879
62 Ga0075428_100251029 3300006844 Bacteria 1907
63 Ga0075428_100502046 3300006844 Bacteria 1298
64 Ga0075428_101631211 3300006844 Bacteria 674
65 Ga0075430_100182001 3300006846 Bacteria 1748
66 Ga0075431_100023682 3300006847 Bacteria 6285
67 Ga0075431_100030764 3300006847 Bacteria 5530
68 Ga0075431_100174013 3300006847 Bacteria 2211
69 Ga0075431_100310773 3300006847 Bacteria 1591
70 Ga0075434_100100687 3300006871 Bacteria 2895
71 Ga0075435_100246330 3300007076 Bacteria 1521
72 Ga0099795_10000347 3300007788 Bacteria 8366
73 Ga0099795_10041687 3300007788 Bacteria 1635
74 Ga0111539_10095645 3300009094 Bacteria 3489
75 Ga0111539_10152653 3300009094 Bacteria 2703
76 Ga0105245_10021349 3300009098 Bacteria 5679
77 Ga0105245_10289647 3300009098 Bacteria 1603
78 Ga0105247_10007100 3300009101 Bacteria 6879
79 Ga0105247_11197341 3300009101 Bacteria 605
80 Ga0114129_10002765 3300009147 Bacteria 24439
81 Ga0114129_10153195 3300009147 Bacteria 3154
82 Ga0114129_11247362 3300009147 Bacteria 924
83 Ga0114129_11494202 3300009147 Bacteria 830
84 Ga0105243_10009530 3300009148 Bacteria 7393
85 Ga0105243_10413319 3300009148 Bacteria 1256
86 Ga0105243_11524852 3300009148 Bacteria 693
87 Ga0105242_10032354 3300009176 Bacteria 4182
88 Ga0105242_10104917 3300009176 Bacteria 2400
89 Ga0105248_10126950 3300009177 Bacteria 2877
90 Ga0105237_10416242 3300009545 Bacteria 1349
91 Ga0105237_11715173 3300009545 Bacteria 635
92 Ga0105238_10099551 3300009551 Bacteria 2890
93 Ga0105238_10111782 3300009551 Bacteria 2712
94 Ga0105238_10940975 3300009551 Bacteria 883
95 Ga0105239_10880029 3300010375 Bacteria 1028
96 Ga0105239_11529999 3300010375 Bacteria 771
97 Ga0105239_12499142 3300010375 Bacteria 602
98 Ga0105246_10145315 3300011119 Bacteria 1789
99 Ga0157373_10008982 3300013100 Bacteria 7394
100 Ga0157371_10166439 3300013102 Bacteria 1574
101 Ga0157374_11257797 3300013296 Bacteria 762
102 Ga0163162_10331019 3300013306 Bacteria 1655
103 Ga0157375_10102336 3300013308 Bacteria 2949
104 Ga0157375_10318907 3300013308 Bacteria 1719
105 Ga0157375_11874973 3300013308 Bacteria 711
106 Ga0163163_10054146 3300014325 Bacteria 3963
107 Ga0163163_10275608 3300014325 Bacteria 1733
108 Ga0157380_10097277 3300014326 Bacteria 2442
109 Ga0157380_11460718 3300014326 Bacteria 736
110 Ga0157377_10063300 3300014745 Bacteria 2119
111 Ga0157377_10747952 3300014745 Bacteria 715
112 Ga0157379_10044374 3300014968 Bacteria 3969
113 Ga0157379_10391265 3300014968 Bacteria 1277
114 Ga0157376_10166053 3300014969 Bacteria 2006
115 Ga0157376_10208706 3300014969 Bacteria 1802
116 Ga0157376_11469812 3300014969 Bacteria 714
117 Ga0206354_10850429 3300020081 Bacteria 4458
118 Ga0207692_10289525 3300025898 Bacteria 993
119 Ga0207647_10078270 3300025904 Bacteria 1986
120 Ga0207699_10177070 3300025906 Bacteria 1431
121 Ga0207654_10550863 3300025911 Bacteria 819
122 Ga0207707_10031374 3300025912 Bacteria 4650
123 Ga0207707_10655763 3300025912 Bacteria 884
124 Ga0207693_10058759 3300025915 Bacteria 3013
125 Ga0207663_10411038 3300025916 Bacteria 1037
126 Ga0207663_11331749 3300025916 Bacteria 578
127 Ga0207660_10165209 3300025917 Bacteria 1710
128 Ga0207660_10352529 3300025917 Bacteria 1179
129 Ga0207660_10513541 3300025917 Bacteria 973
130 Ga0207662_10419636 3300025918 Bacteria 910
131 Ga0207657_10016279 3300025919 Bacteria 7176
132 Ga0207657_10021822 3300025919 Bacteria 6015
133 Ga0207652_10290841 3300025921 Bacteria 1474
134 Ga0207652_10424957 3300025921 Bacteria 1198
135 Ga0207694_10371327 3300025924 Bacteria 1186
136 Ga0207659_10081392 3300025926 Bacteria 2394
137 Ga0207659_10363072 3300025926 Bacteria 1204
138 Ga0207687_10014053 3300025927 Bacteria 5234
139 Ga0207700_10307888 3300025928 Bacteria 1369
140 Ga0207700_10672602 3300025928 Bacteria 923
141 Ga0207644_10018235 3300025931 Bacteria 4746
142 Ga0207709_10509460 3300025935 Bacteria 940
143 Ga0207704_10157380 3300025938 Bacteria 1612
144 Ga0207665_10045309 3300025939 Bacteria 2945
145 Ga0207691_10589930 3300025940 Bacteria 941
146 Ga0207711_10130228 3300025941 Bacteria 2255
147 Ga0207689_10563992 3300025942 Bacteria 957
148 Ga0207679_10201398 3300025945 Bacteria 1663
149 Ga0207667_10317618 3300025949 Bacteria 1591
150 Ga0207667_10656811 3300025949 Bacteria 1054
151 Ga0207651_10224627 3300025960 Bacteria 1520
152 Ga0207651_10594841 3300025960 Bacteria 966
153 Ga0207639_10190624 3300026041 Bacteria 1751
154 Ga0207639_10481538 3300026041 Bacteria 1131
155 Ga0207708_10174997 3300026075 Bacteria 1702
156 Ga0207702_10237127 3300026078 Bacteria 1707
157 Ga0207641_10676220 3300026088 Bacteria 1015
158 Ga0207674_10617996 3300026116 Bacteria 1047
159 Ga0207675_100806685 3300026118 Bacteria 952
160 Ga0207675_101074712 3300026118 Bacteria 824
161 Ga0207698_10450606 3300026142 Bacteria 1242
162 Ga0209179_1001563 3300027512 Bacteria 2847
163 Ga0207428_10040275 3300027907 Bacteria 3791
164 Ga0207428_10355216 3300027907 Bacteria 1078
165 Ga0268266_10378505 3300028379 Bacteria 1335
166 Ga0268266_10445422 3300028379 Bacteria 1230
167 Ga0265770_1018305 3300030878 Bacteria 1090
168 Ga0265332_10015185 3300031238 Bacteria 3401
169 Ga0265325_10031721 3300031241 Bacteria 2825
170 Ga0265329_10025976 3300031242 Bacteria 1933
171 Ga0265340_10003243 3300031247 Bacteria 9222
172 Ga0265339_10003948 3300031249 Bacteria 10254
173 Ga0265331_10052582 3300031250 Bacteria 1945
174 Ga0265316_10130212 3300031344 Bacteria 1895
175 Ga0265313_10000041 3300031595 Bacteria 119119
176 Ga0265313_10038166 3300031595 Bacteria 2394
177 Ga0265313_10054765 3300031595 Bacteria 1893
178 Ga0316579_10105521 3300031691 Bacteria 1351
179 Ga0265342_10000146 3300031712 Bacteria 80151
180 Ga0265342_10000806 3300031712 Bacteria 31484
181 Ga0373950_0040402 3300034818 Bacteria 891
182 Ga0373926_0359930 3300035083 Bacteria 572
183 Ga0373929_0064775 3300035085 Bacteria 863
184 Ga0373923_0000154 3300035111 Bacteria 13383
185 Ga0373939_0111170 3300035114 Bacteria 954
186 Ga0373945_0064859 3300035116 Bacteria 1370
187 Ga0373945_0120013 3300035116 Bacteria 1045
188 Ga0373945_0518564 3300035116 Bacteria 532
189 Ga0373953_0012690 3300035117 Bacteria 2991
190 Ga0373954_0004019 3300035118 Bacteria 6286
191 Ga0373954_0034395 3300035118 Bacteria 2347
192 Ga0373956_0046337 3300035119 Bacteria 1942
193 Ga0373957_0062743 3300035120 Bacteria 1442
194 Ga0373943_0002736 3300035170 Bacteria 8018
195 Ga0373946_0015404 3300035171 Bacteria 2899
196 Ga0373955_0002748 3300035172 Bacteria 7718
197 Ga0373955_0805078 3300035172 Bacteria 578
198 Ga0373962_0173429 3300035242 Bacteria 717
199 Ga0373924_0000313 3300035410 Bacteria 14908
200 Ga0373935_0000756 3300035692 Bacteria 17208
201 Ga0373935_0220373 3300035692 Bacteria 1318
202 Ga0373935_1088095 3300035692 Bacteria 595
203 Ga0373927_0004769 3300035695 Bacteria 9441
204 Ga0373927_0017010 3300035695 Bacteria 4792
205 Ga0373927_0150361 3300035695 Bacteria 1525
206 Ga0373933_0001466 3300035724 Bacteria 13812
207 Ga0373933_0080667 3300035724 Bacteria 1995
208 Ga0373947_0001822 3300035725 Bacteria 13045
209 Ga0373947_0012963 3300035725 Bacteria 4780
210 Ga0373947_0635899 3300035725 Bacteria 727
211 Ga0373937_0000271 3300036401 Bacteria 49749
212 Ga0373937_0104968 3300036401 Bacteria 2625
213 Ga0373937_0560529 3300036401 Bacteria 1085
214 Ga0373937_0707740 3300036401 Bacteria 954
215 Ga0373925_0000557 3300037068 Bacteria 36526
216 Ga0373925_0006777 3300037068 Bacteria 8395
217 Ga0373925_0107387 3300037068 Bacteria 2153
218 Ga0373925_0229915 3300037068 Bacteria 1483
219 Ga0395900_0002667 3300037418 Bacteria 19511
220 Ga0395898_0008441 3300037466 Bacteria 10888
221 Ga0395898_0083582 3300037466 Bacteria 3077
222 Ga0395898_0605426 3300037466 Bacteria 1038
223 Ga0395905_0175682 3300037471 Bacteria 2011
224 Ga0436364_1026543 3300037853 Bacteria 893
225 Ga0395901_0053502 3300038443 Bacteria 4194
226 Ga0395901_0100354 3300038443 Bacteria 3036
227 Ga0436365_1793039 3300039437 Bacteria 2160
228 Ga0436361_0639384 3300039447 Bacteria 11225
229 Ga0436361_0807259 3300039447 Bacteria 601
230 Ga0436363_0000062 3300039450 Bacteria 950
231 Ga0466966_0608905 3300044684 Bacteria 658
232 Ga0466963_0034745 3300044694 Bacteria 3281
233 Ga0466959_0452964 3300045049 Bacteria 870
234 Ga0495592_0000001 3300046454 Bacteria 305819
235 Ga0495603_0169188 3300046455 Bacteria 1266
236 Ga0495629_0040556 3300046459 Bacteria 3275
237 Ga0495629_0087310 3300046459 Bacteria 2176
238 Ga0495629_0125041 3300046459 Bacteria 1792
239 Ga0495629_0356485 3300046459 Bacteria 997
240 Ga0495651_0000596 3300046462 Bacteria 27994
241 Ga0495653_0000092 3300046463 Bacteria 74868
242 Ga0495605_0053421 3300046474 Bacteria 1960
243 Ga0495662_0145569 3300046476 Bacteria 1167
244 Ga0495664_0000001 3300046477 Bacteria 757730
245 Ga0495584_0432988 3300046491 Bacteria 669
246 Ga0495585_0134212 3300046492 Bacteria 1300
247 Ga0495585_0213031 3300046492 Bacteria 978
248 Ga0495596_0189329 3300046500 Bacteria 800
249 Ga0495607_0145930 3300046501 Bacteria 1216
250 Ga0495608_0000109 3300046511 Bacteria 59207
251 Ga0495608_0147340 3300046511 Bacteria 1501
252 Ga0495618_0000064 3300046514 Bacteria 77194
253 Ga0495618_0803126 3300046514 Bacteria 548
254 Ga0495620_0124088 3300046515 Bacteria 1016
255 Ga0495628_0000003 3300046516 Bacteria 470339
256 Ga0495628_0703050 3300046516 Bacteria 714
257 Ga0495630_0130090 3300046517 Bacteria 1912
258 Ga0495630_0621840 3300046517 Bacteria 828
259 Ga0495663_0029476 3300046525 Bacteria 1621
260 Ga0495666_0112223 3300046526 Bacteria 1280
261 Ga0495652_0000001 3300046529 Bacteria 1045081
262 Ga0495665_0494609 3300046531 Bacteria 616
263 Ga0495640_0000012 3300046533 Bacteria 194692
264 Ga0495640_0046939 3300046533 Bacteria 2990
265 Ga0495640_0518747 3300046533 Bacteria 724
266 Ga0495587_0000028 3300046536 Bacteria 138663
267 Ga0495598_0016142 3300046537 Bacteria 1900
268 Ga0495621_0160525 3300046539 Bacteria 889
269 Ga0495645_0000004 3300046543 Bacteria 532661
270 Ga0495667_0000001 3300046559 Bacteria 834831
271 Ga0495667_0034087 3300046559 Bacteria 3404
272 Ga0495667_0045956 3300046559 Bacteria 2888
273 Ga0495634_0000075 3300046642 Bacteria 77824
274 Ga0495634_0118553 3300046642 Bacteria 1696
275 Ga0495611_0063897 3300046648 Bacteria 1676
276 Ga0495635_0000015 3300046663 Bacteria 215468
277 Ga0495635_0031462 3300046663 Bacteria 3684
278 Ga0495635_0682108 3300046663 Bacteria 667
279 Ga0495661_0115526 3300046665 Bacteria 1490
280 Ga0495657_0000155 3300046675 Bacteria 62116
281 Ga0495657_0124619 3300046675 Bacteria 1620
282 Ga0495599_0000029 3300046678 Bacteria 113803
283 Ga0495623_0000012 3300046679 Bacteria 120267
284 Ga0495646_0000006 3300046680 Bacteria 258496
285 Ga0495646_0189739 3300046680 Bacteria 1124
286 Ga0495658_0004449 3300046683 Bacteria 6898
287 Ga0495658_0008036 3300046683 Bacteria 5223
288 Ga0495658_0143487 3300046683 Bacteria 1462
289 Ga0495613_0032590 3300046689 Bacteria 3872
290 Ga0495613_0322401 3300046689 Bacteria 1066
291 Ga0495613_0508561 3300046689 Bacteria 810
292 Ga0495624_0122312 3300046690 Bacteria 1598
293 Ga0495670_0062646 3300046691 Bacteria 1872
294 Ga0495589_0258755 3300046794 Bacteria 812
295 Ga0495600_0000081 3300046809 Bacteria 52285
296 Ga0495581_0082386 3300047315 Bacteria 1863
297 Ga0495581_0204549 3300047315 Bacteria 1155
298 Ga0495581_0306638 3300047315 Bacteria 928
299 Ga0495604_0000091 3300047317 Bacteria 77216
300 Ga0495604_0222199 3300047317 Bacteria 1300
301 Ga0495604_0940025 3300047317 Bacteria 538
302 Ga0495674_0000001 3300047319 Bacteria 778665
303 Ga0495674_0245666 3300047319 Bacteria 1474
304 Ga0495674_0298849 3300047319 Bacteria 1315
305 Ga0495680_0000489 3300047322 Bacteria 44631
306 Ga0495680_0025207 3300047322 Bacteria 4925
307 Ga0495675_0000113 3300047444 Bacteria 58250
308 Ga0495679_126064 3300047446 Bacteria 697
309 Ga0495685_119444 3300047447 Bacteria 866
310 Ga0495684_0000055 3300047471 Bacteria 79796
311 Ga0495684_0137266 3300047471 Bacteria 1835
312 Ga0495684_0775775 3300047471 Bacteria 628
313 Ga0495593_0000990 3300047673 Bacteria 16699
314 Ga0495593_0076026 3300047673 Bacteria 1741
315 Ga0495602_0000002 3300048088 Bacteria 422216
316 Ga0496100_0001366 3300048903 Bacteria 11965
317 Ga0496100_0343071 3300048903 Bacteria 1126
318 Ga0496101_0002268 3300048904 Bacteria 11747
319 Ga0496101_0005076 3300048904 Bacteria 8373
320 Ga0496101_0264557 3300048904 Bacteria 1342
321 Ga0496102_0123698 3300048905 Bacteria 2417
322 Ga0496102_0171790 3300048905 Bacteria 2040
323 Ga0496102_0240667 3300048905 Bacteria 1706
324 Ga0496102_1018862 3300048905 Bacteria 748
325 Ga0496103_0021428 3300048906 Bacteria 3887
326 Ga0496103_0508602 3300048906 Bacteria 770
327 Ga0496104_0003261 3300048907 Bacteria 13993
328 Ga0496104_0068112 3300048907 Bacteria 3382
329 Ga0496104_0129319 3300048907 Bacteria 2425
330 Ga0496104_0175973 3300048907 Bacteria 2050
331 Ga0496104_0344309 3300048907 Bacteria 1403
332 Ga0496105_0008454 3300048908 Bacteria 7998
333 Ga0496105_0032029 3300048908 Bacteria 4312
334 Ga0496105_0092821 3300048908 Bacteria 2492
335 Ga0496105_0206193 3300048908 Bacteria 1603
336 Ga0496105_0297024 3300048908 Bacteria 1299
337 Ga0496106_0002882 3300048909 Bacteria 12784
338 Ga0496106_0068912 3300048909 Bacteria 2699
339 Ga0496106_0087219 3300048909 Bacteria 2404
340 Ga0496106_0181081 3300048909 Bacteria 1673
341 Ga0496106_0330293 3300048909 Bacteria 1224
342 Ga0496106_0597345 3300048909 Bacteria 884
343 Ga0496107_0024536 3300048910 Bacteria 4266
344 Ga0496107_0221434 3300048910 Bacteria 1408
345 Ga0496107_0265787 3300048910 Bacteria 1276
346 Ga0496107_0402063 3300048910 Bacteria 1018
347 Ga0496108_0084003 3300048911 Bacteria 2701
348 Ga0496108_0097992 3300048911 Bacteria 2498
349 Ga0496108_0147423 3300048911 Bacteria 2029
350 Ga0496109_0010593 3300048912 Bacteria 7886
351 Ga0496109_0013886 3300048912 Bacteria 7001
352 Ga0496109_0043035 3300048912 Bacteria 4093
353 Ga0496109_0366643 3300048912 Bacteria 1360
354 Ga0496109_0562975 3300048912 Bacteria 1075
355 Ga0496109_1267132 3300048912 Bacteria 673
356 Ga0496110_0010321 3300048913 Bacteria 7590
357 Ga0496110_0014714 3300048913 Bacteria 6502
358 Ga0496110_0739767 3300048913 Bacteria 886
359 Ga0496110_0748117 3300048913 Bacteria 880
360 Ga0496110_1304302 3300048913 Bacteria 635
361 Ga0496111_0080458 3300048914 Bacteria 2377
362 Ga0496111_0143206 3300048914 Bacteria 1771
363 Ga0496112_0008906 3300048915 Bacteria 9007
364 Ga0496112_0012320 3300048915 Bacteria 7855
365 Ga0496112_0017192 3300048915 Bacteria 6792
366 Ga0496112_0078416 3300048915 Bacteria 3266
367 Ga0496112_0164047 3300048915 Bacteria 2188
368 Ga0496113_0050283 3300048916 Bacteria 3107
369 Ga0496113_0119928 3300048916 Bacteria 2055
370 Ga0496113_0448669 3300048916 Bacteria 1036
371 Ga0496113_0648536 3300048916 Bacteria 844
372 Ga0496114_0107766 3300048917 Bacteria 2384
373 Ga0496115_0010512 3300048918 Bacteria 6920
374 Ga0496115_0035011 3300048918 Bacteria 3971
375 Ga0496115_0053316 3300048918 Bacteria 3245
376 Ga0496115_0891487 3300048918 Bacteria 686
377 Ga0496126_0403101 3300048929 Bacteria 1109
378 Ga0501032_0598410 3300049569 Bacteria 701
379 Ga0501033_0210760 3300049570 Bacteria 1385
380 Ga0501033_0505636 3300049570 Bacteria 835
381 Ga0501034_0367803 3300049571 Bacteria 1364
382 Ga0501036_0614911 3300049572 Bacteria 901
383 Ga0501038_0536431 3300049574 Bacteria 891
384 Ga0501043_0028042 3300049579 Bacteria 4419
385 Ga0501048_1169010 3300049582 Bacteria 553
386 Ga0501067_0401434 3300049583 Bacteria 764
387 Ga0501069_0396352 3300049585 Bacteria 816
388 Ga0501070_0071953 3300049586 Bacteria 2862
389 Ga0501070_0134745 3300049586 Bacteria 2039
390 Ga0501075_1383580 3300049591 Bacteria 533
391 Ga0501080_0013586 3300049742 Bacteria 7497
392 Ga0501083_0833457 3300049744 Bacteria 600
393 Ga0501035_0001840 3300049822 Bacteria 21365
394 Ga0501035_0334253 3300049822 Bacteria 1270
395 Ga0501035_0351432 3300049822 Bacteria 1233
396 Ga0501044_0088416 3300049823 Bacteria 3127
397 nmdc:mga00v17_732045_c1 3300050491 Bacteria 633
398 nmdc:mga0yw44_10632_c1 3300050492 Bacteria 4711
399 nmdc:mga0yw44_236796_c1 3300050492 Bacteria 1213
400 nmdc:mga0yw44_747917_c1 3300050492 Bacteria 664
401 nmdc:mga06z11_120547_c1 3300050494 Bacteria 1463
402 nmdc:mga05p37_24629_c1 3300050507 Bacteria 7315
403 nmdc:mga05p37_37114_c1 3300050507 Bacteria 5977
404 nmdc:mga05p37_399768_c1 3300050507 Bacteria 1604
405 nmdc:mga05p37_5764_c1 3300050507 Bacteria 14572
406 nmdc:mga05p37_949574_c1 3300050507 Bacteria 920
407 nmdc:mga09592_33273_c1 3300050508 Bacteria 4302
408 nmdc:mga0qj67_671235_c1 3300050509 Bacteria 826
409 nmdc:mga0qj67_8214_c1 3300050509 Bacteria 7736
410 nmdc:mga06r32_225892_c1 3300050510 Bacteria 1560
411 nmdc:mga06r32_300611_c1 3300050510 Bacteria 1591
412 nmdc:mga06r32_91034_c1 3300050510 Bacteria 2980
413 nmdc:mga08y16_125006_c1 3300050511 Bacteria 2676
414 nmdc:mga08y16_365419_c1 3300050511 Bacteria 1481
415 nmdc:mga0n895_1093676_c1 3300050512 Bacteria 775
416 nmdc:mga0n895_1289665_c1 3300050512 Bacteria 702
417 nmdc:mga0n895_59040_c1 3300050512 Bacteria 3785
418 nmdc:mga0rr50_283902_c1 3300050513 Bacteria 1382
419 nmdc:mga08x19_7372_c1 3300050514 Bacteria 6534
420 nmdc:mga0a205_1062114_c1 3300050515 Bacteria 657
421 Ga0495601_0000006 3300053077 Bacteria 373770
422 Ga0495601_0079540 3300053077 Bacteria 2102
423 Ga0495601_0099646 3300053077 Bacteria 1876
424 Ga0495601_0143250 3300053077 Bacteria 1559
425 Ga0495601_0341563 3300053077 Bacteria 974
426 Ga0495601_0369256 3300053077 Bacteria 932
427 Ga0495612_0000007 3300053078 Bacteria 253300
428 Ga0495612_0122799 3300053078 Bacteria 1118
429 Ga0495595_0000051 3300053084 Bacteria 60041
430 Ga0495595_0022385 3300053084 Bacteria 2775
431 Ga0495619_0000027 3300053085 Bacteria 165001
432 Ga0495619_0000105 3300053085 Bacteria 62599
433 Ga0495619_0110281 3300053085 Bacteria 1880
434 Ga0495619_0176636 3300053085 Bacteria 1477
435 Ga0500644_0001279 3300053088 Bacteria 6852
436 Ga0500651_0018730 3300053093 Bacteria 4288
437 Ga0500650_0162955 3300053098 Unclassified 1028
438 Ga0500594_0087322 3300053118 Bacteria 942
439 Ga0500595_000351 3300053119 Bacteria 30073
440 Ga0500577_0169872 3300053142 Bacteria 932
441 Ga0500616_0000006 3300053153 Bacteria 944738
442 Ga0500645_191013 3300053730 Bacteria 555
443 Ga0530510_0489778 3300061734 Bacteria 932
444 Ga0530510_0521960 3300061734 Bacteria 901
445 Ga0070680_100011649
446 Ga0070690_100044634
447 Ga0070690_100748635
448 Ga0068869_100371080
449 Ga0068868_100273769
450 Ga0070689_100970383
451 Ga0070691_10058394
452 Ga0070687_100476782
453 Ga0070675_100483788
454 Ga0070675_100770624
455 Ga0070671_100003913
456 Ga0070673_100016863
457 Ga0070673_100723963
458 Ga0070688_100133607
459 Ga0070667_100519417
460 Ga0070709_10286719
461 Ga0070705_100104900
462 Ga0070700_100556185
463 Ga0070708_100275301
464 Ga0070681_10031525
465 Ga0070681_10047836
466 Ga0070699_101008292
467 Ga0070679_100141575
468 Ga0070684_100063219
469 Ga0068853_100205965
470 Ga0068853_100269961
471 Ga0070672_100734356
472 Ga0070686_100802499
473 Ga0070686_100913887
474 Ga0070693_100110582
475 Ga0070665_100116636
476 Ga0070704_100053435
477 Ga0070704_100865467
478 Ga0068855_100227362
479 Ga0068855_100433672
480 Ga0068855_100532411
481 Ga0070664_100973672
482 Ga0070664_101310746
483 Ga0068864_101425167
484 Ga0068863_100726369
485 Ga0068858_100127963
486 Ga0081455_10125037
487 Ga0081455_10163381
488 Ga0070717_10404677
489 Ga0070717_10675685
490 Ga0075365_10007599
491 Ga0075365_10136032
492 Ga0075363_100135246
493 Ga0075364_10958237
494 Ga0070712_100026375
495 Ga0070712_100197599
496 Ga0070712_100457137
497 Ga0075367_10130299
498 Ga0075367_10349211
499 Ga0075366_10447381
500 Ga0097621_100494816
501 Ga0097621_101056241
502 Ga0075370_10292757
503 Ga0075370_10407529
504 Ga0068871_100172551
505 Ga0068871_100781439
506 Ga0075428_100251029
507 Ga0075428_100502046
508 Ga0075428_101631211
509 Ga0075430_100182001
510 Ga0075431_100023682
511 Ga0075431_100030764
512 Ga0075431_100174013
513 Ga0075431_100310773
514 Ga0075434_100100687
515 Ga0075435_100246330
516 Ga0099795_10000347
517 Ga0099795_10041687
518 Ga0111539_10095645
519 Ga0111539_10152653
520 Ga0105245_10021349
521 Ga0105245_10289647
522 Ga0105247_10007100
523 Ga0105247_11197341
524 Ga0114129_10002765
525 Ga0114129_10153195
526 Ga0114129_11247362
527 Ga0114129_11494202
528 Ga0105243_10009530
529 Ga0105243_10413319
530 Ga0105243_11524852
531 Ga0105242_10032354
532 Ga0105242_10104917
533 Ga0105248_10126950
534 Ga0105237_10416242
535 Ga0105237_11715173
536 Ga0105238_10099551
537 Ga0105238_10111782
538 Ga0105238_10940975
539 Ga0105239_10880029
540 Ga0105239_11529999
541 Ga0105239_12499142
542 Ga0105246_10145315
543 Ga0157373_10008982
544 Ga0157371_10166439
545 Ga0157374_11257797
546 Ga0163162_10331019
547 Ga0157375_10102336
548 Ga0157375_10318907
549 Ga0157375_11874973
550 Ga0163163_10054146
551 Ga0163163_10275608
552 Ga0157380_10097277
553 Ga0157380_11460718
554 Ga0157377_10063300
555 Ga0157377_10747952
556 Ga0157379_10044374
557 Ga0157379_10391265
558 Ga0157376_10166053
559 Ga0157376_10208706
560 Ga0157376_11469812
561 Ga0206354_10850429
562 Ga0207692_10289525
563 Ga0207647_10078270
564 Ga0207699_10177070
565 Ga0207654_10550863
566 Ga0207707_10031374
567 Ga0207707_10655763
568 Ga0207693_10058759
569 Ga0207663_10411038
570 Ga0207663_11331749
571 Ga0207660_10165209
572 Ga0207660_10352529
573 Ga0207660_10513541
574 Ga0207662_10419636
575 Ga0207657_10016279
576 Ga0207657_10021822
577 Ga0207652_10290841
578 Ga0207652_10424957
579 Ga0207694_10371327
580 Ga0207659_10081392
581 Ga0207659_10363072
582 Ga0207687_10014053
583 Ga0207700_10307888
584 Ga0207700_10672602
585 Ga0207644_10018235
586 Ga0207709_10509460
587 Ga0207704_10157380
588 Ga0207665_10045309
589 Ga0207691_10589930
590 Ga0207711_10130228
591 Ga0207689_10563992
592 Ga0207679_10201398
593 Ga0207667_10317618
594 Ga0207667_10656811
595 Ga0207651_10224627
596 Ga0207651_10594841
597 Ga0207639_10190624
598 Ga0207639_10481538
599 Ga0207708_10174997
600 Ga0207702_10237127
601 Ga0207641_10676220
602 Ga0207674_10617996
603 Ga0207675_100806685
604 Ga0207675_101074712
605 Ga0207698_10450606
606 Ga0209179_1001563
607 Ga0207428_10040275
608 Ga0207428_10355216
609 Ga0268266_10378505
610 Ga0268266_10445422
611 Ga0265770_1018305
612 Ga0265332_10015185
613 Ga0265325_10031721
614 Ga0265329_10025976
615 Ga0265340_10003243
616 Ga0265339_10003948
617 Ga0265331_10052582
618 Ga0265316_10130212
619 Ga0265313_10000041
620 Ga0265313_10038166
621 Ga0265313_10054765
622 Ga0316579_10105521
623 Ga0265342_10000146
624 Ga0265342_10000806
625 Ga0373950_0040402
626 Ga0373926_0359930
627 Ga0373929_0064775
628 Ga0373923_0000154
629 Ga0373939_0111170
630 Ga0373945_0064859
631 Ga0373945_0120013
632 Ga0373945_0518564
633 Ga0373953_0012690
634 Ga0373954_0004019
635 Ga0373954_0034395
636 Ga0373956_0046337
637 Ga0373957_0062743
638 Ga0373943_0002736
639 Ga0373946_0015404
640 Ga0373955_0002748
641 Ga0373955_0805078
642 Ga0373962_0173429
643 Ga0373924_0000313
644 Ga0373935_0000756
645 Ga0373935_0220373
646 Ga0373935_1088095
647 Ga0373927_0004769
648 Ga0373927_0017010
649 Ga0373927_0150361
650 Ga0373933_0001466
651 Ga0373933_0080667
652 Ga0373947_0001822
653 Ga0373947_0012963
654 Ga0373947_0635899
655 Ga0373937_0000271
656 Ga0373937_0104968
657 Ga0373937_0560529
658 Ga0373937_0707740
659 Ga0373925_0000557
660 Ga0373925_0006777
661 Ga0373925_0107387
662 Ga0373925_0229915
663 Ga0395900_0002667
664 Ga0395898_0008441
665 Ga0395898_0083582
666 Ga0395898_0605426
667 Ga0395905_0175682
668 Ga0436364_1026543
669 Ga0395901_0053502
670 Ga0395901_0100354
671 Ga0436365_1793039
672 Ga0436361_0639384
673 Ga0436361_0807259
674 Ga0436363_0000062
675 Ga0466966_0608905
676 Ga0466963_0034745
677 Ga0466959_0452964
678 Ga0495592_0000001
679 Ga0495603_0169188
680 Ga0495629_0040556
681 Ga0495629_0087310
682 Ga0495629_0125041
683 Ga0495629_0356485
684 Ga0495651_0000596
685 Ga0495653_0000092
686 Ga0495605_0053421
687 Ga0495662_0145569
688 Ga0495664_0000001
689 Ga0495584_0432988
690 Ga0495585_0134212
691 Ga0495585_0213031
692 Ga0495596_0189329
693 Ga0495607_0145930
694 Ga0495608_0000109
695 Ga0495608_0147340
696 Ga0495618_0000064
697 Ga0495618_0803126
698 Ga0495620_0124088
699 Ga0495628_0000003
700 Ga0495628_0703050
701 Ga0495630_0130090
702 Ga0495630_0621840
703 Ga0495663_0029476
704 Ga0495666_0112223
705 Ga0495652_0000001
706 Ga0495665_0494609
707 Ga0495640_0000012
708 Ga0495640_0046939
709 Ga0495640_0518747
710 Ga0495587_0000028
711 Ga0495598_0016142
712 Ga0495621_0160525
713 Ga0495645_0000004
714 Ga0495667_0000001
715 Ga0495667_0034087
716 Ga0495667_0045956
717 Ga0495634_0000075
718 Ga0495634_0118553
719 Ga0495611_0063897
720 Ga0495635_0000015
721 Ga0495635_0031462
722 Ga0495635_0682108
723 Ga0495661_0115526
724 Ga0495657_0000155
725 Ga0495657_0124619
726 Ga0495599_0000029
727 Ga0495623_0000012
728 Ga0495646_0000006
729 Ga0495646_0189739
730 Ga0495658_0004449
731 Ga0495658_0008036
732 Ga0495658_0143487
733 Ga0495613_0032590
734 Ga0495613_0322401
735 Ga0495613_0508561
736 Ga0495624_0122312
737 Ga0495670_0062646
738 Ga0495589_0258755
739 Ga0495600_0000081
740 Ga0495581_0082386
741 Ga0495581_0204549
742 Ga0495581_0306638
743 Ga0495604_0000091
744 Ga0495604_0222199
745 Ga0495604_0940025
746 Ga0495674_0000001
747 Ga0495674_0245666
748 Ga0495674_0298849
749 Ga0495680_0000489
750 Ga0495680_0025207
751 Ga0495675_0000113
752 Ga0495679_126064
753 Ga0495685_119444
754 Ga0495684_0000055
755 Ga0495684_0137266
756 Ga0495684_0775775
757 Ga0495593_0000990
758 Ga0495593_0076026
759 Ga0495602_0000002
760 Ga0496100_0001366
761 Ga0496100_0343071
762 Ga0496101_0002268
763 Ga0496101_0005076
764 Ga0496101_0264557
765 Ga0496102_0123698
766 Ga0496102_0171790
767 Ga0496102_0240667
768 Ga0496102_1018862
769 Ga0496103_0021428
770 Ga0496103_0508602
771 Ga0496104_0003261
772 Ga0496104_0068112
773 Ga0496104_0129319
774 Ga0496104_0175973
775 Ga0496104_0344309
776 Ga0496105_0008454
777 Ga0496105_0032029
778 Ga0496105_0092821
779 Ga0496105_0206193
780 Ga0496105_0297024
781 Ga0496106_0002882
782 Ga0496106_0068912
783 Ga0496106_0087219
784 Ga0496106_0181081
785 Ga0496106_0330293
786 Ga0496106_0597345
787 Ga0496107_0024536
788 Ga0496107_0221434
789 Ga0496107_0265787
790 Ga0496107_0402063
791 Ga0496108_0084003
792 Ga0496108_0097992
793 Ga0496108_0147423
794 Ga0496109_0010593
795 Ga0496109_0013886
796 Ga0496109_0043035
797 Ga0496109_0366643
798 Ga0496109_0562975
799 Ga0496109_1267132
800 Ga0496110_0010321
801 Ga0496110_0014714
802 Ga0496110_0739767
803 Ga0496110_0748117
804 Ga0496110_1304302
805 Ga0496111_0080458
806 Ga0496111_0143206
807 Ga0496112_0008906
808 Ga0496112_0012320
809 Ga0496112_0017192
810 Ga0496112_0078416
811 Ga0496112_0164047
812 Ga0496113_0050283
813 Ga0496113_0119928
814 Ga0496113_0448669
815 Ga0496113_0648536
816 Ga0496114_0107766
817 Ga0496115_0010512
818 Ga0496115_0035011
819 Ga0496115_0053316
820 Ga0496115_0891487
821 Ga0496126_0403101
822 Ga0501032_0598410
823 Ga0501033_0210760
824 Ga0501033_0505636
825 Ga0501034_0367803
826 Ga0501036_0614911
827 Ga0501038_0536431
828 Ga0501043_0028042
829 Ga0501048_1169010
830 Ga0501067_0401434
831 Ga0501069_0396352
832 Ga0501070_0071953
833 Ga0501070_0134745
834 Ga0501075_1383580
835 Ga0501080_0013586
836 Ga0501083_0833457
837 Ga0501035_0001840
838 Ga0501035_0334253
839 Ga0501035_0351432
840 Ga0501044_0088416
841 nmdc:mga00v17_732045_c1
842 nmdc:mga0yw44_10632_c1
843 nmdc:mga0yw44_236796_c1
844 nmdc:mga0yw44_747917_c1
845 nmdc:mga06z11_120547_c1
846 nmdc:mga05p37_24629_c1
847 nmdc:mga05p37_37114_c1
848 nmdc:mga05p37_399768_c1
849 nmdc:mga05p37_5764_c1
850 nmdc:mga05p37_949574_c1
851 nmdc:mga09592_33273_c1
852 nmdc:mga0qj67_671235_c1
853 nmdc:mga0qj67_8214_c1
854 nmdc:mga06r32_225892_c1
855 nmdc:mga06r32_300611_c1
856 nmdc:mga06r32_91034_c1
857 nmdc:mga08y16_125006_c1
858 nmdc:mga08y16_365419_c1
859 nmdc:mga0n895_1093676_c1
860 nmdc:mga0n895_1289665_c1
861 nmdc:mga0n895_59040_c1
862 nmdc:mga0rr50_283902_c1
863 nmdc:mga08x19_7372_c1
864 nmdc:mga0a205_1062114_c1
865 Ga0495601_0000006
866 Ga0495601_0079540
867 Ga0495601_0099646
868 Ga0495601_0143250
869 Ga0495601_0341563
870 Ga0495601_0369256
871 Ga0495612_0000007
872 Ga0495612_0122799
873 Ga0495595_0000051
874 Ga0495595_0022385
875 Ga0495619_0000027
876 Ga0495619_0000105
877 Ga0495619_0110281
878 Ga0495619_0176636
879 Ga0500644_0001279
880 Ga0500651_0018730
881 Ga0500650_0162955
882 Ga0500594_0087322
883 Ga0500595_000351
884 Ga0500577_0169872
885 Ga0500616_0000006
886 Ga0500645_191013
887 Ga0530510_0489778
888 Ga0530510_0521960

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01502

PRA-CH

Phosphoribosyl-AMP cyclohydrolase

81

155

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bgn-assembly2.cif.gz_C crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway 0.9628 33 129
7bgn-assembly3.cif.gz_E crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway 0.9626 33 129
7bgn-assembly2.cif.gz_D crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway 0.9622 33 129
7bgn-assembly3.cif.gz_F crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway 0.9563 33 129
7bgn-assembly1.cif.gz_B crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway 0.9512 33 129
ID Description Score Start End Superfamily
af_P9WMM7_1_97_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9811 33 120 3.10.20.810
af_A0A1D8PKY7_169_272_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9233 33 120 3.10.20.810
af_Q2FUU3_250_343_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9164 34 120 3.10.20.810
1zpsA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9066 28 120 3.10.20.810
af_O59667_194_289_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.8935 33 120 3.10.20.810
ID Description Score Start End GO Terms
AF-A0A1A2YJH0-F1-model_v4 Phosphoribosyl-AMP cyclohydrolase (PRA-CH) (EC 3.5.4.19) 0.9797 33 128 GO:0000105
GO:0000287
GO:0004635
GO:0005737
GO:0008270
AF-A0A0X8WR30-F1-model_v4 deleted 0.9784 34 135
AF-A0A1A3SPY5-F1-model_v4 Phosphoribosyl-AMP cyclohydrolase (PRA-CH) (EC 3.5.4.19) 0.9782 33 128 GO:0000105
GO:0000287
GO:0004635
GO:0005737
GO:0008270
AF-A0A1F4Q4A6-F1-model_v4 Phosphoribosyl-AMP cyclohydrolase (PRA-CH) (EC 3.5.4.19) 0.9781 33 129 GO:0000105
GO:0000287
GO:0004635
GO:0005737
GO:0008270
AF-A0A382FE17-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9764 16 113 GO:0000105
GO:0004635

Map