F445240

General Info

Members Datasets Scaffolds Average Seq Length
444 305 888 84

Family's Representative Sequence

Representative Sequence 3300005457|Ga0070662_100650978|Ga0070662_1006509782
Length 93
Sequence MMGGVEQGGEIAGYTVPVHRALTEPILLGGAPRGLAILNGTLAGAVGLGLRLWLIGXXXWAIGHVVAVWAAKRDPLFVDVVRRHLRIPGHLSV

Samples

Sample ID Description Type Environment
1 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
46 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
47 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
67 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
114 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
115 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
116 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
117 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
118 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
119 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
120 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
123 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
124 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
125 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
130 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
131 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
133 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
134 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
150 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
151 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
152 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
153 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
154 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
155 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
156 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
165 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
174 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
175 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
176 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
177 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
178 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
179 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
180 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
181 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
182 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
183 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
186 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
187 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
188 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
189 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
190 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
191 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
194 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
195 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
196 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
200 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
203 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
204 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
205 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
208 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
209 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
210 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
211 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
212 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
213 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
216 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
217 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
220 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
221 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
222 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
223 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
224 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
225 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
233 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
234 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
235 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
238 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
239 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
249 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
250 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
251 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
252 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
255 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
259 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
260 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
261 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
262 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
263 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
264 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
265 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
266 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
267 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
268 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
269 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
270 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
271 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
272 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
273 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
274 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
275 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
278 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
279 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
280 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
281 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
282 2643221736 Bosea sp. Root483D1 Isolate Unclassified
283 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
284 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
285 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
286 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
287 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
288 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
289 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
290 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
291 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
292 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
293 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
294 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
295 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
296 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
297 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
298 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
299 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
300 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
301 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
302 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
303 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
304 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
305 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.24
Metatranscriptomes 0
Isolates 6.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.18
Nodule 4.95
Rhizoplane 2.25
Rhizosphere 80.86
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070662_100650978 3300005457 Bacteria 889
2 JGI25165J46597_1000006 3300003214 Bacteria 529784
3 JGI25160J50197_1047490 3300003354 Bacteria 934
4 Ga0055525_1000035 3300003759 Bacteria 300887
5 Ga0070660_100278708 3300005339 Bacteria 1368
6 Ga0070691_10616818 3300005341 Bacteria 642
7 Ga0070687_101205694 3300005343 Bacteria 558
8 Ga0070675_100460823 3300005354 Bacteria 1141
9 Ga0070674_100162798 3300005356 Bacteria 1694
10 Ga0070674_100548238 3300005356 Bacteria 970
11 Ga0070674_101094931 3300005356 Bacteria 703
12 Ga0070688_101397773 3300005365 Bacteria 567
13 Ga0070659_100339104 3300005366 Bacteria 1259
14 Ga0070709_10001426 3300005434 Bacteria 12925
15 Ga0070709_10002689 3300005434 Bacteria 9601
16 Ga0070709_11566942 3300005434 Bacteria 536
17 Ga0070709_11754270 3300005434 Bacteria 507
18 Ga0070714_100322051 3300005435 Bacteria 1446
19 Ga0070714_100500704 3300005435 Bacteria 1158
20 Ga0070713_100017236 3300005436 Bacteria 5457
21 Ga0070713_100452103 3300005436 Bacteria 1206
22 Ga0070713_100968599 3300005436 Bacteria 820
23 Ga0070710_10001964 3300005437 Bacteria 9746
24 Ga0070710_10003785 3300005437 Bacteria 7147
25 Ga0070710_10159477 3300005437 Bacteria 1398
26 Ga0070710_10231890 3300005437 Bacteria 1179
27 Ga0070711_100011707 3300005439 Bacteria 5453
28 Ga0070711_100031224 3300005439 Bacteria 3534
29 Ga0070711_100230290 3300005439 Bacteria 1444
30 Ga0070711_100255121 3300005439 Bacteria 1377
31 Ga0070711_100626639 3300005439 Bacteria 899
32 Ga0070705_100781034 3300005440 Bacteria 758
33 Ga0070708_101795993 3300005445 Bacteria 569
34 Ga0070678_101062030 3300005456 Bacteria 746
35 Ga0070681_10060046 3300005458 Bacteria 3781
36 Ga0070681_10150638 3300005458 Bacteria 2252
37 Ga0070681_10167788 3300005458 Bacteria 2117
38 Ga0070681_10517783 3300005458 Bacteria 1106
39 Ga0070681_10520510 3300005458 Bacteria 1103
40 Ga0068867_100805002 3300005459 Bacteria 838
41 Ga0070706_100055685 3300005467 Bacteria 3650
42 Ga0070706_100566272 3300005467 Bacteria 1056
43 Ga0070706_100987806 3300005467 Bacteria 776
44 Ga0070707_100110266 3300005468 Bacteria 2669
45 Ga0070707_101107979 3300005468 Bacteria 758
46 Ga0070707_101315606 3300005468 Bacteria 689
47 Ga0070698_100311305 3300005471 Bacteria 1505
48 Ga0070698_100409761 3300005471 Bacteria 1289
49 Ga0070699_100691539 3300005518 Bacteria 932
50 Ga0070699_101567201 3300005518 Bacteria 604
51 Ga0070679_100559963 3300005530 Bacteria 1087
52 Ga0070679_101633238 3300005530 Bacteria 592
53 Ga0070684_100357620 3300005535 Bacteria 1344
54 Ga0070697_100725448 3300005536 Bacteria 878
55 Ga0070697_100745063 3300005536 Bacteria 866
56 Ga0070697_101172030 3300005536 Bacteria 685
57 Ga0068853_100002801 3300005539 Bacteria 13191
58 Ga0068853_100010537 3300005539 Bacteria 7475
59 Ga0070665_101049202 3300005548 Bacteria 827
60 Ga0068855_102617427 3300005563 Bacteria 500
61 Ga0068857_100010210 3300005577 Bacteria 8164
62 Ga0068852_100128879 3300005616 Bacteria 2327
63 Ga0068861_102689332 3300005719 Bacteria 502
64 Ga0068862_100075141 3300005844 Bacteria 2922
65 Ga0081455_10400491 3300005937 Bacteria 952
66 Ga0081540_1021917 3300005983 Bacteria 3785
67 Ga0081540_1026680 3300005983 Bacteria 3290
68 Ga0081540_1237099 3300005983 Bacteria 641
69 Ga0070717_10254414 3300006028 Bacteria 1552
70 Ga0070717_10665079 3300006028 Bacteria 946
71 Ga0070715_10119456 3300006163 Bacteria 1255
72 Ga0070715_10415880 3300006163 Bacteria 751
73 Ga0070716_100092006 3300006173 Bacteria 1838
74 Ga0070716_100477390 3300006173 Bacteria 915
75 Ga0070712_100077132 3300006175 Bacteria 2401
76 Ga0070712_100112975 3300006175 Bacteria 2030
77 Ga0070712_101801714 3300006175 Bacteria 536
78 Ga0075367_10495985 3300006178 Bacteria 774
79 Ga0097621_100885160 3300006237 Bacteria 831
80 Ga0068865_101137370 3300006881 Bacteria 689
81 Ga0099825_1032259 3300006941 Bacteria 2141
82 Ga0099824_1005593 3300006942 Bacteria 17633
83 Ga0079104_1074915 3300006946 Bacteria 704
84 Ga0099794_10000295 3300007265 Bacteria 17188
85 Ga0099795_10001530 3300007788 Bacteria 5064
86 Ga0099795_10002423 3300007788 Bacteria 4387
87 Ga0099795_10055790 3300007788 Bacteria 1451
88 Ga0105240_10179268 3300009093 Bacteria 2502
89 Ga0105240_10930590 3300009093 Bacteria 933
90 Ga0105240_12249293 3300009093 Bacteria 565
91 Ga0105240_12567866 3300009093 Bacteria 526
92 Ga0105243_10350868 3300009148 Bacteria 1355
93 Ga0105243_10621924 3300009148 Bacteria 1043
94 Ga0105242_10443946 3300009176 Bacteria 1221
95 Ga0105242_10728123 3300009176 Bacteria 974
96 Ga0105237_10055611 3300009545 Bacteria 3963
97 Ga0105237_10310566 3300009545 Bacteria 1580
98 Ga0105238_10009276 3300009551 Bacteria 9848
99 Ga0105249_10170282 3300009553 Bacteria 2111
100 Ga0099796_10017044 3300010159 Bacteria 2156
101 Ga0099796_10050250 3300010159 Bacteria 1445
102 Ga0105239_10979850 3300010375 Bacteria 972
103 Ga0105239_13095335 3300010375 Bacteria 542
104 Ga0157373_10840761 3300013100 Bacteria 679
105 Ga0157371_10040556 3300013102 Bacteria 3324
106 Ga0157370_10006168 3300013104 Bacteria 13298
107 Ga0157369_10007094 3300013105 Bacteria 12922
108 Ga0157372_10002242 3300013307 Bacteria 20986
109 Ga0157372_11518971 3300013307 Bacteria 771
110 Ga0157372_12086697 3300013307 Bacteria 651
111 Ga0157379_10658528 3300014968 Bacteria 981
112 Ga0157376_11587315 3300014969 Bacteria 688
113 Ga0157376_12091764 3300014969 Bacteria 604
114 Ga0163161_10535394 3300017792 Bacteria 958
115 Ga0213873_10222946 3300021358 Bacteria 591
116 Ga0213872_10182762 3300021361 Bacteria 905
117 Ga0213876_10000534 3300021384 Bacteria 28772
118 Ga0213875_10204200 3300021388 Bacteria 930
119 Ga0209563_100047 3300025230 Bacteria 366620
120 Ga0209233_1000010 3300025261 Bacteria 1194329
121 Ga0209130_1002111 3300025284 Bacteria 10598
122 Ga0209676_1036019 3300025292 Bacteria 1445
123 Ga0207426_1000361 3300025302 Bacteria 81889
124 Ga0207692_10057618 3300025898 Bacteria 1999
125 Ga0207692_10058373 3300025898 Bacteria 1988
126 Ga0207692_10163859 3300025898 Bacteria 1283
127 Ga0207692_10181730 3300025898 Bacteria 1226
128 Ga0207642_10641876 3300025899 Bacteria 664
129 Ga0207647_10217666 3300025904 Bacteria 1101
130 Ga0207685_10048081 3300025905 Bacteria 1632
131 Ga0207685_10210665 3300025905 Bacteria 919
132 Ga0207685_10330905 3300025905 Bacteria 762
133 Ga0207699_10002420 3300025906 Bacteria 8817
134 Ga0207699_10010115 3300025906 Bacteria 4721
135 Ga0207699_10225831 3300025906 Bacteria 1280
136 Ga0207699_10909434 3300025906 Bacteria 649
137 Ga0207699_11452165 3300025906 Bacteria 507
138 Ga0207684_10112062 3300025910 Bacteria 2335
139 Ga0207684_10428968 3300025910 Bacteria 1135
140 Ga0207654_11432667 3300025911 Bacteria 504
141 Ga0207707_10215222 3300025912 Bacteria 1673
142 Ga0207707_10419318 3300025912 Bacteria 1148
143 Ga0207707_11044121 3300025912 Bacteria 668
144 Ga0207707_11646980 3300025912 Bacteria 504
145 Ga0207695_10286417 3300025913 Bacteria 1540
146 Ga0207695_10408291 3300025913 Bacteria 1242
147 Ga0207671_10097099 3300025914 Bacteria 2227
148 Ga0207693_10018518 3300025915 Bacteria 5545
149 Ga0207693_10024050 3300025915 Bacteria 4836
150 Ga0207693_10093939 3300025915 Bacteria 2351
151 Ga0207693_10380136 3300025915 Bacteria 1104
152 Ga0207693_10404329 3300025915 Bacteria 1067
153 Ga0207663_10003384 3300025916 Bacteria 7794
154 Ga0207663_10011370 3300025916 Bacteria 4778
155 Ga0207663_10320022 3300025916 Bacteria 1165
156 Ga0207663_10602671 3300025916 Bacteria 863
157 Ga0207663_10878480 3300025916 Bacteria 716
158 Ga0207660_10176028 3300025917 Bacteria 1659
159 Ga0207657_10193338 3300025919 Bacteria 1640
160 Ga0207652_11825515 3300025921 Bacteria 513
161 Ga0207646_10247230 3300025922 Bacteria 1611
162 Ga0207681_11872138 3300025923 Bacteria 500
163 Ga0207694_10002066 3300025924 Bacteria 16586
164 Ga0207659_10436854 3300025926 Bacteria 1100
165 Ga0207700_10167881 3300025928 Bacteria 1828
166 Ga0207700_10450436 3300025928 Bacteria 1134
167 Ga0207700_11723939 3300025928 Bacteria 552
168 Ga0207664_11888156 3300025929 Bacteria 520
169 Ga0207690_10949658 3300025932 Bacteria 714
170 Ga0207706_10461751 3300025933 Bacteria 1098
171 Ga0207686_10790732 3300025934 Bacteria 760
172 Ga0207669_11316468 3300025937 Bacteria 614
173 Ga0207669_11694391 3300025937 Bacteria 540
174 Ga0207665_10056031 3300025939 Bacteria 2661
175 Ga0207665_10228123 3300025939 Bacteria 1368
176 Ga0207665_10384812 3300025939 Bacteria 1065
177 Ga0207712_10738108 3300025961 Bacteria 862
178 Ga0207639_10005959 3300026041 Bacteria 8269
179 Ga0207639_10008392 3300026041 Bacteria 7082
180 Ga0207678_10530227 3300026067 Bacteria 1028
181 Ga0207641_10046520 3300026088 Bacteria 3658
182 Ga0207641_11870338 3300026088 Bacteria 602
183 Ga0207648_10748913 3300026089 Bacteria 907
184 Ga0207674_10008186 3300026116 Bacteria 12120
185 Ga0207674_11060902 3300026116 Bacteria 779
186 Ga0207675_101904295 3300026118 Bacteria 613
187 Ga0207683_10270472 3300026121 Bacteria 1552
188 Ga0207698_10040518 3300026142 Bacteria 3462
189 Ga0209588_1006494 3300027671 Bacteria 3401
190 Ga0268266_11049852 3300028379 Bacteria 788
191 Ga0268265_10006671 3300028380 Bacteria 7813
192 Ga0265337_1001390 3300028556 Bacteria 11879
193 Ga0265326_10000352 3300028558 Bacteria 19508
194 Ga0265319_1001943 3300028563 Bacteria 11708
195 Ga0265334_10002049 3300028573 Bacteria 9536
196 Ga0265318_10002935 3300028577 Bacteria 8848
197 Ga0265318_10103289 3300028577 Bacteria 1048
198 Ga0265323_10000035 3300028653 Bacteria 72657
199 Ga0265323_10054828 3300028653 Bacteria 1403
200 Ga0265322_10012111 3300028654 Bacteria 2494
201 Ga0265336_10000201 3300028666 Bacteria 41891
202 Ga0265336_10003340 3300028666 Bacteria 6307
203 Ga0265338_10000018 3300028800 Bacteria 338910
204 Ga0265338_10000572 3300028800 Bacteria 64902
205 Ga0265324_10000236 3300029957 Bacteria 41791
206 Ga0265331_10082856 3300031250 Bacteria 1488
207 Ga0265331_10479326 3300031250 Bacteria 559
208 Ga0307509_10225680 3300031507 Bacteria 1681
209 Ga0307509_10803579 3300031507 Bacteria 605
210 Ga0307508_10364515 3300031616 Bacteria 1036
211 Ga0265314_10030774 3300031711 Bacteria 3970
212 Ga0307412_10121014 3300031911 Bacteria 1884
213 Ga0307412_10194907 3300031911 Bacteria 1534
214 Ga0307414_10000674 3300032004 Bacteria 17500
215 Ga0307510_10330479 3300033180 Bacteria 979
216 Ga0373926_0206527 3300035083 Bacteria 757
217 Ga0373936_0341722 3300035113 Bacteria 681
218 Ga0373945_0354032 3300035116 Bacteria 637
219 Ga0373953_0235917 3300035117 Bacteria 793
220 Ga0373954_0045138 3300035118 Bacteria 2058
221 Ga0373943_0646650 3300035170 Bacteria 625
222 Ga0373943_0699161 3300035170 Bacteria 601
223 Ga0373955_0081338 3300035172 Bacteria 1831
224 Ga0373935_0198676 3300035692 Bacteria 1385
225 Ga0373935_0339656 3300035692 Bacteria 1069
226 Ga0373935_0474751 3300035692 Bacteria 906
227 Ga0373927_0103707 3300035695 Bacteria 1851
228 Ga0373927_0337067 3300035695 Bacteria 993
229 Ga0373933_0017339 3300035724 Bacteria 4040
230 Ga0373947_0367230 3300035725 Bacteria 967
231 Ga0373937_0004074 3300036401 Bacteria 12396
232 Ga0373925_0103874 3300037068 Bacteria 2188
233 Ga0373925_0123792 3300037068 Bacteria 2010
234 Ga0373925_1161781 3300037068 Bacteria 635
235 Ga0395900_0876903 3300037418 Bacteria 822
236 Ga0395898_0077544 3300037466 Bacteria 3208
237 Ga0395905_0053150 3300037471 Bacteria 3792
238 Ga0436364_0304108 3300037853 Bacteria 697
239 Ga0395901_1855334 3300038443 Bacteria 551
240 Ga0436365_0316876 3300039437 Bacteria 563
241 Ga0436365_0915242 3300039437 Bacteria 771
242 Ga0436365_1262966 3300039437 Bacteria 2109
243 Ga0436365_1869782 3300039437 Bacteria 4722
244 Ga0436360_0575863 3300039438 Bacteria 1857
245 Ga0436360_1302090 3300039438 Bacteria 712
246 Ga0436361_0293023 3300039447 Bacteria 1770
247 Ga0436361_0563642 3300039447 Bacteria 703
248 Ga0436361_1006063 3300039447 Bacteria 540
249 Ga0436363_0114580 3300039450 Bacteria 1821
250 Ga0436363_0902215 3300039450 Bacteria 969
251 Ga0436363_1459244 3300039450 Bacteria 1716
252 Ga0436362_0988361 3300039453 Bacteria 792
253 Ga0436362_1280182 3300039453 Bacteria 975
254 Ga0451787_461119 3300041441 Bacteria 1253
255 Ga0466972_0603843 3300044658 Bacteria 519
256 Ga0466964_0352829 3300044706 Bacteria 756
257 Ga0466968_0090820 3300044735 Bacteria 1353
258 Ga0466970_0472219 3300044765 Bacteria 720
259 Ga0466970_0618769 3300044765 Bacteria 629
260 Ga0466959_0217180 3300045049 Bacteria 1327
261 Ga0451576_0241726 3300045051 Bacteria 1886
262 Ga0451576_2729755 3300045051 Bacteria 502
263 Ga0466958_0001512 3300045836 Bacteria 11127
264 Ga0466967_0004334 3300045976 Bacteria 9545
265 Ga0495617_033917 3300046452 Bacteria 1713
266 Ga0495592_0400340 3300046454 Bacteria 870
267 Ga0495592_0914155 3300046454 Bacteria 515
268 Ga0495603_0046741 3300046455 Bacteria 2578
269 Ga0495603_0657503 3300046455 Bacteria 600
270 Ga0495590_0031614 3300046457 Bacteria 1853
271 Ga0495629_0132812 3300046459 Bacteria 1734
272 Ga0495638_0045651 3300046460 Bacteria 2755
273 Ga0495651_0008937 3300046462 Bacteria 7692
274 Ga0495653_0358879 3300046463 Bacteria 935
275 Ga0495650_0002433 3300046471 Bacteria 15084
276 Ga0495650_0163374 3300046471 Bacteria 792
277 Ga0495580_0167046 3300046472 Bacteria 1522
278 Ga0495580_0834437 3300046472 Bacteria 596
279 Ga0495582_0815034 3300046473 Bacteria 540
280 Ga0495639_0078437 3300046475 Bacteria 1535
281 Ga0495639_0553121 3300046475 Bacteria 590
282 Ga0495639_0644700 3300046475 Bacteria 546
283 Ga0495584_0060590 3300046491 Bacteria 1903
284 Ga0495585_0311143 3300046492 Bacteria 772
285 Ga0495585_0593347 3300046492 Bacteria 521
286 Ga0495594_0113906 3300046499 Bacteria 1526
287 Ga0495596_0000171 3300046500 Bacteria 45024
288 Ga0495607_0229720 3300046501 Bacteria 903
289 Ga0495583_0376312 3300046506 Bacteria 559
290 Ga0495606_0243565 3300046507 Bacteria 1001
291 Ga0495608_0014258 3300046511 Bacteria 5515
292 Ga0495618_0129657 3300046514 Bacteria 1614
293 Ga0495620_0002150 3300046515 Bacteria 11452
294 Ga0495628_1049962 3300046516 Bacteria 558
295 Ga0495631_0030236 3300046518 Bacteria 2458
296 Ga0495632_0029051 3300046519 Bacteria 2882
297 Ga0495643_0001609 3300046522 Bacteria 19996
298 Ga0495652_0003657 3300046529 Bacteria 15059
299 Ga0495665_0461368 3300046531 Bacteria 642
300 Ga0495640_0595416 3300046533 Bacteria 668
301 Ga0495587_0007784 3300046536 Bacteria 6922
302 Ga0495645_0526977 3300046543 Bacteria 735
303 Ga0495622_0235910 3300046557 Bacteria 807
304 Ga0495633_0295914 3300046558 Bacteria 735
305 Ga0495667_0000267 3300046559 Bacteria 33933
306 Ga0495656_0141751 3300046615 Bacteria 1153
307 Ga0495668_0004073 3300046616 Bacteria 10601
308 Ga0495634_0291459 3300046642 Bacteria 989
309 Ga0495634_0301141 3300046642 Bacteria 969
310 Ga0495634_0532167 3300046642 Bacteria 687
311 Ga0495611_0167478 3300046648 Bacteria 1027
312 Ga0495625_0019072 3300046660 Bacteria 5336
313 Ga0495635_0036018 3300046663 Bacteria 3431
314 Ga0495588_0028119 3300046674 Bacteria 2813
315 Ga0495588_0653536 3300046674 Bacteria 550
316 Ga0495657_0004443 3300046675 Bacteria 11202
317 Ga0495623_0000216 3300046679 Bacteria 36827
318 Ga0495646_0238781 3300046680 Bacteria 977
319 Ga0495658_0317811 3300046683 Bacteria 987
320 Ga0495669_0144653 3300046684 Bacteria 1123
321 Ga0495624_0799088 3300046690 Bacteria 558
322 Ga0495670_0512332 3300046691 Bacteria 652
323 Ga0495589_0031147 3300046794 Bacteria 2686
324 Ga0495600_0002526 3300046809 Bacteria 10525
325 Ga0495581_0024103 3300047315 Bacteria 3526
326 Ga0495604_0001204 3300047317 Bacteria 21379
327 Ga0495674_0274038 3300047319 Bacteria 1384
328 Ga0495676_0343174 3300047321 Bacteria 999
329 Ga0495680_0003008 3300047322 Bacteria 16811
330 Ga0495683_0121306 3300047323 Bacteria 1240
331 Ga0495683_0225824 3300047323 Bacteria 833
332 Ga0495675_0000122 3300047444 Bacteria 56354
333 Ga0495677_0133559 3300047445 Bacteria 951
334 Ga0495673_0000025 3300047469 Bacteria 512352
335 Ga0495681_0000209 3300047470 Bacteria 48667
336 Ga0495684_0034950 3300047471 Bacteria 3856
337 Ga0495593_0059077 3300047673 Bacteria 2010
338 Ga0495593_0493523 3300047673 Bacteria 614
339 Ga0495602_0003180 3300048088 Bacteria 16937
340 Ga0495614_0331781 3300048089 Bacteria 707
341 Ga0496100_0318275 3300048903 Bacteria 1168
342 Ga0496100_0333774 3300048903 Bacteria 1142
343 Ga0496100_0785286 3300048903 Bacteria 746
344 Ga0496101_0459547 3300048904 Bacteria 1005
345 Ga0496102_0526188 3300048905 Bacteria 1105
346 Ga0496102_1207941 3300048905 Bacteria 676
347 Ga0496106_1249646 3300048909 Bacteria 578
348 Ga0496109_1117893 3300048912 Bacteria 725
349 Ga0496113_1053730 3300048916 Bacteria 639
350 Ga0496118_0042470 3300048921 Bacteria 3586
351 Ga0496120_0000502 3300048923 Bacteria 61039
352 Ga0496121_0293484 3300048924 Bacteria 1106
353 Ga0496125_0351243 3300048928 Bacteria 881
354 Ga0496126_0029620 3300048929 Bacteria 5199
355 Ga0496126_0189323 3300048929 Bacteria 1744
356 Ga0496126_0208371 3300048929 Bacteria 1647
357 Ga0496126_0429596 3300048929 Bacteria 1066
358 Ga0496126_0934745 3300048929 Bacteria 655
359 Ga0495682_0015256 3300049460 Bacteria 2912
360 Ga0495682_0125617 3300049460 Bacteria 918
361 Ga0495682_0294804 3300049460 Bacteria 572
362 Ga0501290_078485 3300049513 Bacteria 559
363 Ga0501032_0032722 3300049569 Bacteria 3563
364 Ga0501033_0000180 3300049570 Bacteria 60526
365 Ga0501033_0003190 3300049570 Bacteria 13598
366 Ga0501033_0991766 3300049570 Bacteria 562
367 Ga0501034_0661017 3300049571 Bacteria 946
368 Ga0501034_0687909 3300049571 Bacteria 922
369 Ga0501037_0161167 3300049573 Bacteria 1599
370 Ga0501037_0590158 3300049573 Bacteria 747
371 Ga0501038_0002115 3300049574 Bacteria 18425
372 Ga0501042_1266550 3300049578 Bacteria 538
373 Ga0501043_0177935 3300049579 Bacteria 1658
374 Ga0501043_0822508 3300049579 Bacteria 671
375 Ga0501046_0112933 3300049580 Bacteria 2074
376 Ga0501047_0071547 3300049581 Bacteria 3338
377 Ga0501047_0165274 3300049581 Bacteria 2083
378 Ga0501047_0363183 3300049581 Bacteria 1283
379 Ga0501069_0166902 3300049585 Bacteria 1269
380 Ga0501070_0152269 3300049586 Bacteria 1908
381 Ga0501074_0357371 3300049590 Bacteria 1037
382 Ga0501249_000034 3300049679 Bacteria 72400
383 Ga0501259_110781 3300049688 Bacteria 641
384 Ga0501080_0267743 3300049742 Bacteria 1556
385 Ga0501080_0279622 3300049742 Bacteria 1518
386 Ga0501081_1287536 3300049743 Bacteria 554
387 Ga0501083_0450065 3300049744 Bacteria 838
388 Ga0501035_0002894 3300049822 Bacteria 16541
389 Ga0501035_0558131 3300049822 Bacteria 937
390 Ga0501044_0000058 3300049823 Bacteria 135713
391 Ga0501044_0007189 3300049823 Bacteria 12241
392 Ga0501044_0079435 3300049823 Bacteria 3324
393 Ga0501044_0319226 3300049823 Bacteria 1478
394 Ga0501044_0417647 3300049823 Bacteria 1252
395 Ga0501044_0823473 3300049823 Bacteria 806
396 Ga0501204_000529 3300049850 Bacteria 3318
397 nmdc:mga06z11_445514_c1 3300050494 Bacteria 782
398 Ga0495601_0488927 3300053077 Bacteria 795
399 Ga0495595_0116431 3300053084 Bacteria 1299
400 Ga0495619_0004043 3300053085 Bacteria 9395
401 Ga0500578_0331662 3300053086 Bacteria 894
402 Ga0500583_0418219 3300053092 Bacteria 641
403 Ga0500566_0345271 3300053094 Bacteria 684
404 Ga0500562_037185 3300053108 Bacteria 1292
405 Ga0500595_024977 3300053119 Bacteria 2079
406 Ga0500608_000742 3300053122 Bacteria 11917
407 Ga0500658_0002194 3300053134 Bacteria 7582
408 Ga0500568_0168791 3300053139 Bacteria 806
409 Ga0500589_108304 3300053147 Bacteria 1196
410 Ga0500603_079608 3300053150 Bacteria 947
411 Ga0500616_0000170 3300053153 Bacteria 108126
412 Ga0500639_088136 3300053163 Bacteria 1551
413 Ga0500636_0290265 3300053177 Bacteria 811
414 Ga0501082_1210324 3300060353 Bacteria 660
415 2508540353 2508501009 Bacteria 7784016
416 2509118904 2508501123 Bacteria 6283661
417 2513613027 2513237090 Bacteria 7096802
418 2513643948 2513237094 Bacteria 8789602
419 2643985673 2643221595 Bacteria 6565519
420 2644746997 2643221736 Bacteria 6608466
421 2728749643 2728368998 Bacteria 8720350
422 2745081893 2744054633 Bacteria 8678936
423 2824734173 2824732956 Bacteria 7810675
424 2852655672 2852653556 Bacteria 4050083
425 2876761505 2876761206 Bacteria 10111113
426 2876763585 2876761206 Bacteria 10111113
427 2885382053 2885374607 Bacteria 8927485
428 2903769896 2903768456 Bacteria 9749579
429 2919454285 2919450847 Bacteria 5631160
430 2920766716 2920760137 Bacteria 7427611
431 2932824997 2932818245 Bacteria 9955613
432 2935636771 2935630451 Bacteria 8169952
433 2935827733 2935819856 Bacteria 8261050
434 2935855036 2935847175 Bacteria 8228321
435 2935988687 2935984226 Bacteria 8302647
436 2936063305 2936055302 Bacteria 8785755
437 2941513408 2941507105 Bacteria 8166816
438 2941521371 2941515067 Bacteria 8166720
439 2941529125 2941523033 Bacteria 8169134
440 3000867909 3000865235 Bacteria 3106258
441 8019560509 8019555841 Bacteria 9642137
442 8019570605 8019565922 Bacteria 9639779
443 8019651009 8019648815 Bacteria 10014479
444 8057104598 8057101203 Bacteria 5034064
445 Ga0070662_100650978
446 JGI25165J46597_1000006
447 JGI25160J50197_1047490
448 Ga0055525_1000035
449 Ga0070660_100278708
450 Ga0070691_10616818
451 Ga0070687_101205694
452 Ga0070675_100460823
453 Ga0070674_100162798
454 Ga0070674_100548238
455 Ga0070674_101094931
456 Ga0070688_101397773
457 Ga0070659_100339104
458 Ga0070709_10001426
459 Ga0070709_10002689
460 Ga0070709_11566942
461 Ga0070709_11754270
462 Ga0070714_100322051
463 Ga0070714_100500704
464 Ga0070713_100017236
465 Ga0070713_100452103
466 Ga0070713_100968599
467 Ga0070710_10001964
468 Ga0070710_10003785
469 Ga0070710_10159477
470 Ga0070710_10231890
471 Ga0070711_100011707
472 Ga0070711_100031224
473 Ga0070711_100230290
474 Ga0070711_100255121
475 Ga0070711_100626639
476 Ga0070705_100781034
477 Ga0070708_101795993
478 Ga0070678_101062030
479 Ga0070681_10060046
480 Ga0070681_10150638
481 Ga0070681_10167788
482 Ga0070681_10517783
483 Ga0070681_10520510
484 Ga0068867_100805002
485 Ga0070706_100055685
486 Ga0070706_100566272
487 Ga0070706_100987806
488 Ga0070707_100110266
489 Ga0070707_101107979
490 Ga0070707_101315606
491 Ga0070698_100311305
492 Ga0070698_100409761
493 Ga0070699_100691539
494 Ga0070699_101567201
495 Ga0070679_100559963
496 Ga0070679_101633238
497 Ga0070684_100357620
498 Ga0070697_100725448
499 Ga0070697_100745063
500 Ga0070697_101172030
501 Ga0068853_100002801
502 Ga0068853_100010537
503 Ga0070665_101049202
504 Ga0068855_102617427
505 Ga0068857_100010210
506 Ga0068852_100128879
507 Ga0068861_102689332
508 Ga0068862_100075141
509 Ga0081455_10400491
510 Ga0081540_1021917
511 Ga0081540_1026680
512 Ga0081540_1237099
513 Ga0070717_10254414
514 Ga0070717_10665079
515 Ga0070715_10119456
516 Ga0070715_10415880
517 Ga0070716_100092006
518 Ga0070716_100477390
519 Ga0070712_100077132
520 Ga0070712_100112975
521 Ga0070712_101801714
522 Ga0075367_10495985
523 Ga0097621_100885160
524 Ga0068865_101137370
525 Ga0099825_1032259
526 Ga0099824_1005593
527 Ga0079104_1074915
528 Ga0099794_10000295
529 Ga0099795_10001530
530 Ga0099795_10002423
531 Ga0099795_10055790
532 Ga0105240_10179268
533 Ga0105240_10930590
534 Ga0105240_12249293
535 Ga0105240_12567866
536 Ga0105243_10350868
537 Ga0105243_10621924
538 Ga0105242_10443946
539 Ga0105242_10728123
540 Ga0105237_10055611
541 Ga0105237_10310566
542 Ga0105238_10009276
543 Ga0105249_10170282
544 Ga0099796_10017044
545 Ga0099796_10050250
546 Ga0105239_10979850
547 Ga0105239_13095335
548 Ga0157373_10840761
549 Ga0157371_10040556
550 Ga0157370_10006168
551 Ga0157369_10007094
552 Ga0157372_10002242
553 Ga0157372_11518971
554 Ga0157372_12086697
555 Ga0157379_10658528
556 Ga0157376_11587315
557 Ga0157376_12091764
558 Ga0163161_10535394
559 Ga0213873_10222946
560 Ga0213872_10182762
561 Ga0213876_10000534
562 Ga0213875_10204200
563 Ga0209563_100047
564 Ga0209233_1000010
565 Ga0209130_1002111
566 Ga0209676_1036019
567 Ga0207426_1000361
568 Ga0207692_10057618
569 Ga0207692_10058373
570 Ga0207692_10163859
571 Ga0207692_10181730
572 Ga0207642_10641876
573 Ga0207647_10217666
574 Ga0207685_10048081
575 Ga0207685_10210665
576 Ga0207685_10330905
577 Ga0207699_10002420
578 Ga0207699_10010115
579 Ga0207699_10225831
580 Ga0207699_10909434
581 Ga0207699_11452165
582 Ga0207684_10112062
583 Ga0207684_10428968
584 Ga0207654_11432667
585 Ga0207707_10215222
586 Ga0207707_10419318
587 Ga0207707_11044121
588 Ga0207707_11646980
589 Ga0207695_10286417
590 Ga0207695_10408291
591 Ga0207671_10097099
592 Ga0207693_10018518
593 Ga0207693_10024050
594 Ga0207693_10093939
595 Ga0207693_10380136
596 Ga0207693_10404329
597 Ga0207663_10003384
598 Ga0207663_10011370
599 Ga0207663_10320022
600 Ga0207663_10602671
601 Ga0207663_10878480
602 Ga0207660_10176028
603 Ga0207657_10193338
604 Ga0207652_11825515
605 Ga0207646_10247230
606 Ga0207681_11872138
607 Ga0207694_10002066
608 Ga0207659_10436854
609 Ga0207700_10167881
610 Ga0207700_10450436
611 Ga0207700_11723939
612 Ga0207664_11888156
613 Ga0207690_10949658
614 Ga0207706_10461751
615 Ga0207686_10790732
616 Ga0207669_11316468
617 Ga0207669_11694391
618 Ga0207665_10056031
619 Ga0207665_10228123
620 Ga0207665_10384812
621 Ga0207712_10738108
622 Ga0207639_10005959
623 Ga0207639_10008392
624 Ga0207678_10530227
625 Ga0207641_10046520
626 Ga0207641_11870338
627 Ga0207648_10748913
628 Ga0207674_10008186
629 Ga0207674_11060902
630 Ga0207675_101904295
631 Ga0207683_10270472
632 Ga0207698_10040518
633 Ga0209588_1006494
634 Ga0268266_11049852
635 Ga0268265_10006671
636 Ga0265337_1001390
637 Ga0265326_10000352
638 Ga0265319_1001943
639 Ga0265334_10002049
640 Ga0265318_10002935
641 Ga0265318_10103289
642 Ga0265323_10000035
643 Ga0265323_10054828
644 Ga0265322_10012111
645 Ga0265336_10000201
646 Ga0265336_10003340
647 Ga0265338_10000018
648 Ga0265338_10000572
649 Ga0265324_10000236
650 Ga0265331_10082856
651 Ga0265331_10479326
652 Ga0307509_10225680
653 Ga0307509_10803579
654 Ga0307508_10364515
655 Ga0265314_10030774
656 Ga0307412_10121014
657 Ga0307412_10194907
658 Ga0307414_10000674
659 Ga0307510_10330479
660 Ga0373926_0206527
661 Ga0373936_0341722
662 Ga0373945_0354032
663 Ga0373953_0235917
664 Ga0373954_0045138
665 Ga0373943_0646650
666 Ga0373943_0699161
667 Ga0373955_0081338
668 Ga0373935_0198676
669 Ga0373935_0339656
670 Ga0373935_0474751
671 Ga0373927_0103707
672 Ga0373927_0337067
673 Ga0373933_0017339
674 Ga0373947_0367230
675 Ga0373937_0004074
676 Ga0373925_0103874
677 Ga0373925_0123792
678 Ga0373925_1161781
679 Ga0395900_0876903
680 Ga0395898_0077544
681 Ga0395905_0053150
682 Ga0436364_0304108
683 Ga0395901_1855334
684 Ga0436365_0316876
685 Ga0436365_0915242
686 Ga0436365_1262966
687 Ga0436365_1869782
688 Ga0436360_0575863
689 Ga0436360_1302090
690 Ga0436361_0293023
691 Ga0436361_0563642
692 Ga0436361_1006063
693 Ga0436363_0114580
694 Ga0436363_0902215
695 Ga0436363_1459244
696 Ga0436362_0988361
697 Ga0436362_1280182
698 Ga0451787_461119
699 Ga0466972_0603843
700 Ga0466964_0352829
701 Ga0466968_0090820
702 Ga0466970_0472219
703 Ga0466970_0618769
704 Ga0466959_0217180
705 Ga0451576_0241726
706 Ga0451576_2729755
707 Ga0466958_0001512
708 Ga0466967_0004334
709 Ga0495617_033917
710 Ga0495592_0400340
711 Ga0495592_0914155
712 Ga0495603_0046741
713 Ga0495603_0657503
714 Ga0495590_0031614
715 Ga0495629_0132812
716 Ga0495638_0045651
717 Ga0495651_0008937
718 Ga0495653_0358879
719 Ga0495650_0002433
720 Ga0495650_0163374
721 Ga0495580_0167046
722 Ga0495580_0834437
723 Ga0495582_0815034
724 Ga0495639_0078437
725 Ga0495639_0553121
726 Ga0495639_0644700
727 Ga0495584_0060590
728 Ga0495585_0311143
729 Ga0495585_0593347
730 Ga0495594_0113906
731 Ga0495596_0000171
732 Ga0495607_0229720
733 Ga0495583_0376312
734 Ga0495606_0243565
735 Ga0495608_0014258
736 Ga0495618_0129657
737 Ga0495620_0002150
738 Ga0495628_1049962
739 Ga0495631_0030236
740 Ga0495632_0029051
741 Ga0495643_0001609
742 Ga0495652_0003657
743 Ga0495665_0461368
744 Ga0495640_0595416
745 Ga0495587_0007784
746 Ga0495645_0526977
747 Ga0495622_0235910
748 Ga0495633_0295914
749 Ga0495667_0000267
750 Ga0495656_0141751
751 Ga0495668_0004073
752 Ga0495634_0291459
753 Ga0495634_0301141
754 Ga0495634_0532167
755 Ga0495611_0167478
756 Ga0495625_0019072
757 Ga0495635_0036018
758 Ga0495588_0028119
759 Ga0495588_0653536
760 Ga0495657_0004443
761 Ga0495623_0000216
762 Ga0495646_0238781
763 Ga0495658_0317811
764 Ga0495669_0144653
765 Ga0495624_0799088
766 Ga0495670_0512332
767 Ga0495589_0031147
768 Ga0495600_0002526
769 Ga0495581_0024103
770 Ga0495604_0001204
771 Ga0495674_0274038
772 Ga0495676_0343174
773 Ga0495680_0003008
774 Ga0495683_0121306
775 Ga0495683_0225824
776 Ga0495675_0000122
777 Ga0495677_0133559
778 Ga0495673_0000025
779 Ga0495681_0000209
780 Ga0495684_0034950
781 Ga0495593_0059077
782 Ga0495593_0493523
783 Ga0495602_0003180
784 Ga0495614_0331781
785 Ga0496100_0318275
786 Ga0496100_0333774
787 Ga0496100_0785286
788 Ga0496101_0459547
789 Ga0496102_0526188
790 Ga0496102_1207941
791 Ga0496106_1249646
792 Ga0496109_1117893
793 Ga0496113_1053730
794 Ga0496118_0042470
795 Ga0496120_0000502
796 Ga0496121_0293484
797 Ga0496125_0351243
798 Ga0496126_0029620
799 Ga0496126_0189323
800 Ga0496126_0208371
801 Ga0496126_0429596
802 Ga0496126_0934745
803 Ga0495682_0015256
804 Ga0495682_0125617
805 Ga0495682_0294804
806 Ga0501290_078485
807 Ga0501032_0032722
808 Ga0501033_0000180
809 Ga0501033_0003190
810 Ga0501033_0991766
811 Ga0501034_0661017
812 Ga0501034_0687909
813 Ga0501037_0161167
814 Ga0501037_0590158
815 Ga0501038_0002115
816 Ga0501042_1266550
817 Ga0501043_0177935
818 Ga0501043_0822508
819 Ga0501046_0112933
820 Ga0501047_0071547
821 Ga0501047_0165274
822 Ga0501047_0363183
823 Ga0501069_0166902
824 Ga0501070_0152269
825 Ga0501074_0357371
826 Ga0501249_000034
827 Ga0501259_110781
828 Ga0501080_0267743
829 Ga0501080_0279622
830 Ga0501081_1287536
831 Ga0501083_0450065
832 Ga0501035_0002894
833 Ga0501035_0558131
834 Ga0501044_0000058
835 Ga0501044_0007189
836 Ga0501044_0079435
837 Ga0501044_0319226
838 Ga0501044_0417647
839 Ga0501044_0823473
840 Ga0501204_000529
841 nmdc:mga06z11_445514_c1
842 Ga0495601_0488927
843 Ga0495595_0116431
844 Ga0495619_0004043
845 Ga0500578_0331662
846 Ga0500583_0418219
847 Ga0500566_0345271
848 Ga0500562_037185
849 Ga0500595_024977
850 Ga0500608_000742
851 Ga0500658_0002194
852 Ga0500568_0168791
853 Ga0500589_108304
854 Ga0500603_079608
855 Ga0500616_0000170
856 Ga0500639_088136
857 Ga0500636_0290265
858 Ga0501082_1210324
859 2508540353
860 2509118904
861 2513613027
862 2513643948
863 2643985673
864 2644746997
865 2728749643
866 2745081893
867 2824734173
868 2852655672
869 2876761505
870 2876763585
871 2885382053
872 2903769896
873 2919454285
874 2920766716
875 2932824997
876 2935636771
877 2935827733
878 2935855036
879 2935988687
880 2936063305
881 2941513408
882 2941521371
883 2941529125
884 3000867909
885 8019560509
886 8019570605
887 8019651009
888 8057104598

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05101

VirB3

Type IV secretory pathway, VirB3-like protein

14

90

0.88

Map