F445262

General Info

Members Datasets Scaffolds Average Seq Length
444 246 444 296

Family's Representative Sequence

Representative Sequence 3300007788|Ga0099795_10016312|Ga0099795_100163123
Length 333
Sequence MPRSLLWSRQGLAMQTKNSLARRTFLKGAAAFTAGALAFDETRAQQAVPNSAGSERPKLAAPANACDCHMHIYDAARFPPVRPESRMQANATVSDYRLLQQRNGTSRVVIVTPAVYVTDNRVTLDAIGQLGANARGVAVIHPTITDAELKALADAGIRGIRFTQFDPATATTTIDMIEPLSRRVNELGWHVQIHMRGDQIVEAESLWRRLPSPIVFDHIGRLPHPAGTDFPAFGIIRRLIDQGRTWVKISGAYLDTKVGPPGYSDVTKVAQAFVKAAPERMVWGSDWPHPTEKEKPNDAVLFDLLSEWAPDAATRHRVLVTNPETLYGFARSS

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
137 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
138 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
139 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
140 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
141 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
142 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
143 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
144 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
145 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
150 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
151 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
152 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
155 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
156 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
157 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
158 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
183 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
184 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
185 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
186 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
187 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
188 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
194 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
195 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
196 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
197 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
198 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
199 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
202 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
203 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
204 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
205 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
206 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
207 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
210 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
211 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
212 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
213 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
216 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
217 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
220 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
231 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
238 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
239 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
240 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
241 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
242 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
243 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
246 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.68
Nodule 0
Rhizoplane 2.7
Rhizosphere 95.27
Stem 0
Stem Tuber 0
Unclassified 1.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10007032 3300005327 Bacteria 9081
2 Ga0070683_100293647 3300005329 Bacteria 1546
3 Ga0070690_100015884 3300005330 Bacteria 4498
4 Ga0068869_100008983 3300005334 Bacteria 6470
5 Ga0068869_100047429 3300005334 Bacteria 3103
6 Ga0068869_100110267 3300005334 Bacteria 2093
7 Ga0070666_10001448 3300005335 Bacteria 14393
8 Ga0070666_10085375 3300005335 Bacteria 2162
9 Ga0070680_100022478 3300005336 Bacteria 5024
10 Ga0070682_100025574 3300005337 Bacteria 3524
11 Ga0068868_100016580 3300005338 Bacteria 5476
12 Ga0068868_100027322 3300005338 Bacteria 4354
13 Ga0068868_100042116 3300005338 Bacteria 3561
14 Ga0070660_100038084 3300005339 Bacteria 3648
15 Ga0070660_100134659 3300005339 Bacteria 1979
16 Ga0070689_100047807 3300005340 Bacteria 3299
17 Ga0070689_100136951 3300005340 Bacteria 1967
18 Ga0070687_100054885 3300005343 Bacteria 2078
19 Ga0070692_10035142 3300005345 Bacteria 2536
20 Ga0070692_10035563 3300005345 Bacteria 2523
21 Ga0070675_100007193 3300005354 Bacteria 8577
22 Ga0070675_100067903 3300005354 Bacteria 2951
23 Ga0070671_100020942 3300005355 Bacteria 5335
24 Ga0070671_100045176 3300005355 Bacteria 3662
25 Ga0070688_100013650 3300005365 Bacteria 4587
26 Ga0070667_100002784 3300005367 Bacteria 15104
27 Ga0070667_100050165 3300005367 Bacteria 3516
28 Ga0070667_100088781 3300005367 Bacteria 2655
29 Ga0070667_100186251 3300005367 Bacteria 1837
30 Ga0070709_10029660 3300005434 Bacteria 3275
31 Ga0070709_10234178 3300005434 Bacteria 1315
32 Ga0070714_100065054 3300005435 Bacteria 3140
33 Ga0070714_100268157 3300005435 Bacteria 1582
34 Ga0070713_100013746 3300005436 Bacteria 5986
35 Ga0070713_100118346 3300005436 Bacteria 2319
36 Ga0070710_10018778 3300005437 Bacteria 3563
37 Ga0070710_10056243 3300005437 Bacteria 2226
38 Ga0070701_10001401 3300005438 Bacteria 8926
39 Ga0070711_100325903 3300005439 Bacteria 1228
40 Ga0070705_100000815 3300005440 Bacteria 17531
41 Ga0070705_100064669 3300005440 Bacteria 2187
42 Ga0070705_100092764 3300005440 Bacteria 1886
43 Ga0070694_100031388 3300005444 Unclassified 3483
44 Ga0070694_100227530 3300005444 Bacteria 1402
45 Ga0070708_100013694 3300005445 Bacteria 6652
46 Ga0070708_100023502 3300005445 Bacteria 5244
47 Ga0070678_100001460 3300005456 Bacteria 12592
48 Ga0070662_100037444 3300005457 Bacteria 3440
49 Ga0070662_100416246 3300005457 Bacteria 1111
50 Ga0070681_10077182 3300005458 Bacteria 3289
51 Ga0070681_10382812 3300005458 Bacteria 1317
52 Ga0070685_10013334 3300005466 Bacteria 4332
53 Ga0070706_100027193 3300005467 Bacteria 5263
54 Ga0070707_100022206 3300005468 Bacteria 5998
55 Ga0070707_100178133 3300005468 Bacteria 2072
56 Ga0070698_100017927 3300005471 Bacteria 7456
57 Ga0070698_100162559 3300005471 Unclassified 2176
58 Ga0070698_100288342 3300005471 Bacteria 1573
59 Ga0070699_100000432 3300005518 Bacteria 40124
60 Ga0070699_100018599 3300005518 Bacteria 5968
61 Ga0070699_100060193 3300005518 Bacteria 3290
62 Ga0070699_100074620 3300005518 Unclassified 2951
63 Ga0070679_100020967 3300005530 Bacteria 6376
64 Ga0070679_100099357 3300005530 Unclassified 2897
65 Ga0070697_100008259 3300005536 Bacteria 8124
66 Ga0070697_100097828 3300005536 Bacteria 2435
67 Ga0068853_100040263 3300005539 Bacteria 3987
68 Ga0070686_100041419 3300005544 Bacteria 2879
69 Ga0070695_100000165 3300005545 Bacteria 31530
70 Ga0070695_100041951 3300005545 Bacteria 2902
71 Ga0070695_100356639 3300005545 Bacteria 1097
72 Ga0070696_100002625 3300005546 Bacteria 11921
73 Ga0070696_100274753 3300005546 Bacteria 1282
74 Ga0070693_100003460 3300005547 Bacteria 7367
75 Ga0070665_100065042 3300005548 Bacteria 3658
76 Ga0070704_100101876 3300005549 Unclassified 2165
77 Ga0070664_100151886 3300005564 Bacteria 2045
78 Ga0068857_100072470 3300005577 Bacteria 3069
79 Ga0068854_100035025 3300005578 Bacteria 3512
80 Ga0068856_100073560 3300005614 Bacteria 3384
81 Ga0070702_100003808 3300005615 Bacteria 6817
82 Ga0070702_100015847 3300005615 Bacteria 3857
83 Ga0070702_100189187 3300005615 Bacteria 1353
84 Ga0070702_100514827 3300005615 Bacteria 881
85 Ga0068852_100062225 3300005616 Bacteria 3246
86 Ga0068859_100018752 3300005617 Bacteria 6952
87 Ga0068859_100028735 3300005617 Bacteria 5575
88 Ga0068864_100062074 3300005618 Bacteria 3237
89 Ga0068864_100765293 3300005618 Bacteria 947
90 Ga0068866_10001586 3300005718 Bacteria 9647
91 Ga0068861_100137626 3300005719 Unclassified 1989
92 Ga0068863_100000860 3300005841 Bacteria 30345
93 Ga0068858_100009375 3300005842 Bacteria 9340
94 Ga0068858_100169341 3300005842 Unclassified 2059
95 Ga0068858_100350349 3300005842 Unclassified 1414
96 Ga0068858_100460563 3300005842 Bacteria 1226
97 Ga0068860_100020565 3300005843 Bacteria 6394
98 Ga0068860_100057579 3300005843 Bacteria 3695
99 Ga0068860_100058191 3300005843 Bacteria 3674
100 Ga0070716_100041002 3300006173 Bacteria 2577
101 Ga0070712_100025196 3300006175 Bacteria 3951
102 Ga0097621_100010944 3300006237 Bacteria 6661
103 Ga0097621_100015907 3300006237 Bacteria 5674
104 Ga0097621_100020480 3300006237 Bacteria 5096
105 Ga0097621_100227472 3300006237 Bacteria 1628
106 Ga0068871_100024692 3300006358 Bacteria 4664
107 Ga0068871_100079989 3300006358 Bacteria 2705
108 Ga0075428_100002079 3300006844 Bacteria 21593
109 Ga0075428_100014398 3300006844 Bacteria 8789
110 Ga0075428_100101437 3300006844 Bacteria 3137
111 Ga0075431_100005914 3300006847 Bacteria 12102
112 Ga0075433_10034485 3300006852 Bacteria 4347
113 Ga0075433_10096371 3300006852 Unclassified 2618
114 Ga0075434_100029751 3300006871 Bacteria 5376
115 Ga0075434_100043265 3300006871 Bacteria 4466
116 Ga0075434_100237050 3300006871 Bacteria 1844
117 Ga0075429_100002897 3300006880 Bacteria 14546
118 Ga0075436_100003236 3300006914 Bacteria 11162
119 Ga0097620_100018752 3300006931 Bacteria 6952
120 Ga0097620_100028735 3300006931 Bacteria 5575
121 Ga0075435_100016100 3300007076 Bacteria 5633
122 Ga0099795_10016312 3300007788 Bacteria 2347
123 Ga0111539_10621670 3300009094 Bacteria 1258
124 Ga0105245_10004857 3300009098 Bacteria 11838
125 Ga0105245_10005651 3300009098 Bacteria 10991
126 Ga0105245_10007146 3300009098 Bacteria 9793
127 Ga0105245_10087889 3300009098 Bacteria 2854
128 Ga0105245_10251628 3300009098 Unclassified 1717
129 Ga0114129_10000636 3300009147 Bacteria 43766
130 Ga0114129_10013818 3300009147 Bacteria 11504
131 Ga0114129_10014251 3300009147 Bacteria 11328
132 Ga0114129_10039522 3300009147 Bacteria 6652
133 Ga0114129_10141802 3300009147 Unclassified 3293
134 Ga0114129_10304541 3300009147 Bacteria 2123
135 Ga0105241_10001852 3300009174 Bacteria 16037
136 Ga0105241_10006464 3300009174 Bacteria 8641
137 Ga0105241_10008926 3300009174 Bacteria 7371
138 Ga0105241_10137117 3300009174 Bacteria 1988
139 Ga0105241_10154728 3300009174 Bacteria 1879
140 Ga0105241_10754197 3300009174 Bacteria 893
141 Ga0105242_10015069 3300009176 Bacteria 5997
142 Ga0105242_10067896 3300009176 Bacteria 2948
143 Ga0105242_10070376 3300009176 Bacteria 2901
144 Ga0105242_10394772 3300009176 Bacteria 1289
145 Ga0105242_10572224 3300009176 Bacteria 1086
146 Ga0105248_10353578 3300009177 Bacteria 1654
147 Ga0105248_10444049 3300009177 Unclassified 1461
148 Ga0105237_10015330 3300009545 Bacteria 7982
149 Ga0105237_10043899 3300009545 Bacteria 4502
150 Ga0105237_10064698 3300009545 Bacteria 3652
151 Ga0105237_10169733 3300009545 Bacteria 2181
152 Ga0105238_10008064 3300009551 Bacteria 10532
153 Ga0105238_10090124 3300009551 Bacteria 3054
154 Ga0105238_10149311 3300009551 Bacteria 2313
155 Ga0099796_10014376 3300010159 Bacteria 2285
156 Ga0105239_10045923 3300010375 Bacteria 4787
157 Ga0105239_10442727 3300010375 Bacteria 1473
158 Ga0157370_10356350 3300013104 Bacteria 1348
159 Ga0157369_10051366 3300013105 Bacteria 4461
160 Ga0157374_10006597 3300013296 Bacteria 9856
161 Ga0157374_10649734 3300013296 Bacteria 1067
162 Ga0157378_10008628 3300013297 Bacteria 8869
163 Ga0157378_10032211 3300013297 Bacteria 4631
164 Ga0157378_10286260 3300013297 Unclassified 1590
165 Ga0163162_10003126 3300013306 Bacteria 15812
166 Ga0163162_10007540 3300013306 Bacteria 10596
167 Ga0163162_10008969 3300013306 Bacteria 9725
168 Ga0163162_10185007 3300013306 Bacteria 2210
169 Ga0157375_10166609 3300013308 Bacteria 2348
170 Ga0163163_10004794 3300014325 Bacteria 11607
171 Ga0163163_10088079 3300014325 Bacteria 3116
172 Ga0157377_10013921 3300014745 Bacteria 4082
173 Ga0157379_10015353 3300014968 Bacteria 6719
174 Ga0157376_10013344 3300014969 Bacteria 6128
175 Ga0157376_10027196 3300014969 Bacteria 4531
176 Ga0213876_10001415 3300021384 Bacteria 14934
177 Ga0207692_10048111 3300025898 Bacteria 2145
178 Ga0207692_10206339 3300025898 Bacteria 1158
179 Ga0207710_10044755 3300025900 Bacteria 1972
180 Ga0207680_10007536 3300025903 Bacteria 5315
181 Ga0207680_10200539 3300025903 Bacteria 1359
182 Ga0207699_10020377 3300025906 Bacteria 3553
183 Ga0207699_10047477 3300025906 Bacteria 2518
184 Ga0207684_10003214 3300025910 Bacteria 16038
185 Ga0207684_10229636 3300025910 Bacteria 1601
186 Ga0207654_10059393 3300025911 Bacteria 2230
187 Ga0207654_10198469 3300025911 Bacteria 1320
188 Ga0207707_10046577 3300025912 Bacteria 3777
189 Ga0207695_10018113 3300025913 Bacteria 8151
190 Ga0207671_10251253 3300025914 Bacteria 1390
191 Ga0207693_10000253 3300025915 Bacteria 49482
192 Ga0207693_10373511 3300025915 Bacteria 1115
193 Ga0207663_10068894 3300025916 Bacteria 2274
194 Ga0207663_10425241 3300025916 Bacteria 1020
195 Ga0207660_10308017 3300025917 Bacteria 1262
196 Ga0207662_10037075 3300025918 Bacteria 2852
197 Ga0207657_10002542 3300025919 Bacteria 19724
198 Ga0207657_10010361 3300025919 Bacteria 9302
199 Ga0207649_10157582 3300025920 Bacteria 1570
200 Ga0207694_10043075 3300025924 Bacteria 3483
201 Ga0207694_10114285 3300025924 Bacteria 2150
202 Ga0207694_10228794 3300025924 Bacteria 1518
203 Ga0207659_10004140 3300025926 Bacteria 8754
204 Ga0207659_10041300 3300025926 Bacteria 3230
205 Ga0207687_10000926 3300025927 Bacteria 19985
206 Ga0207687_10020616 3300025927 Bacteria 4375
207 Ga0207687_10101590 3300025927 Bacteria 2117
208 Ga0207687_10445235 3300025927 Unclassified 1073
209 Ga0207664_10004251 3300025929 Bacteria 9688
210 Ga0207644_10057511 3300025931 Bacteria 2808
211 Ga0207706_10007903 3300025933 Bacteria 9818
212 Ga0207706_10037681 3300025933 Bacteria 4292
213 Ga0207686_10000919 3300025934 Bacteria 17652
214 Ga0207686_10010553 3300025934 Bacteria 5032
215 Ga0207686_10056759 3300025934 Unclassified 2463
216 Ga0207686_10123240 3300025934 Bacteria 1767
217 Ga0207670_10073379 3300025936 Bacteria 2373
218 Ga0207669_10025796 3300025937 Bacteria 3184
219 Ga0207704_10007967 3300025938 Bacteria 5038
220 Ga0207704_10034655 3300025938 Bacteria 2883
221 Ga0207665_10005166 3300025939 Bacteria 8717
222 Ga0207665_10021390 3300025939 Bacteria 4253
223 Ga0207665_10037822 3300025939 Bacteria 3212
224 Ga0207711_10001413 3300025941 Bacteria 22482
225 Ga0207711_10046246 3300025941 Unclassified 3719
226 Ga0207689_10023065 3300025942 Bacteria 5226
227 Ga0207689_10048395 3300025942 Bacteria 3506
228 Ga0207661_10242945 3300025944 Bacteria 1598
229 Ga0207667_10175721 3300025949 Bacteria 2200
230 Ga0207651_10047980 3300025960 Bacteria 2883
231 Ga0207640_10010089 3300025981 Bacteria 5309
232 Ga0207640_10044685 3300025981 Bacteria 2840
233 Ga0207658_10012538 3300025986 Bacteria 5789
234 Ga0207658_10234095 3300025986 Bacteria 1552
235 Ga0207658_10253001 3300025986 Bacteria 1498
236 Ga0207677_10000292 3300026023 Bacteria 37411
237 Ga0207677_10003404 3300026023 Bacteria 8428
238 Ga0207677_10056841 3300026023 Bacteria 2683
239 Ga0207677_10145564 3300026023 Bacteria 1820
240 Ga0207677_10306134 3300026023 Unclassified 1315
241 Ga0207703_10001507 3300026035 Bacteria 21251
242 Ga0207703_10001604 3300026035 Bacteria 20477
243 Ga0207703_10171012 3300026035 Bacteria 1911
244 Ga0207639_10152579 3300026041 Bacteria 1937
245 Ga0207639_10285410 3300026041 Bacteria 1453
246 Ga0207678_10147834 3300026067 Bacteria 2006
247 Ga0207708_10130635 3300026075 Bacteria 1963
248 Ga0207702_10084062 3300026078 Bacteria 2770
249 Ga0207702_10291104 3300026078 Bacteria 1547
250 Ga0207641_10111719 3300026088 Bacteria 2423
251 Ga0207648_10052457 3300026089 Bacteria 3566
252 Ga0207676_10006967 3300026095 Bacteria 8011
253 Ga0207676_10543362 3300026095 Bacteria 1109
254 Ga0207674_10004655 3300026116 Bacteria 16467
255 Ga0207674_10035381 3300026116 Bacteria 5212
256 Ga0207683_10000314 3300026121 Bacteria 44039
257 Ga0268266_10021421 3300028379 Bacteria 5505
258 Ga0268266_10022823 3300028379 Bacteria 5327
259 Ga0268264_10003602 3300028381 Bacteria 13338
260 Ga0268264_10080379 3300028381 Bacteria 2784
261 Ga0265319_1003876 3300028563 Bacteria 7636
262 Ga0265318_10000536 3300028577 Bacteria 27120
263 Ga0265318_10000780 3300028577 Bacteria 21154
264 Ga0265332_10077214 3300031238 Unclassified 1415
265 Ga0265320_10000598 3300031240 Bacteria 27696
266 Ga0265320_10000606 3300031240 Bacteria 27476
267 Ga0265325_10009149 3300031241 Bacteria 5801
268 Ga0265325_10094063 3300031241 Unclassified 1474
269 Ga0265329_10000677 3300031242 Bacteria 17400
270 Ga0265329_10002472 3300031242 Bacteria 8344
271 Ga0265340_10016258 3300031247 Plasmid 3856
272 Ga0265339_10005556 3300031249 Bacteria 8382
273 Ga0265339_10035633 3300031249 Unclassified 2790
274 Ga0265331_10000094 3300031250 Bacteria 122448
275 Ga0265331_10000740 3300031250 Bacteria 27459
276 Ga0265316_10002478 3300031344 Bacteria 19130
277 Ga0265316_10017739 3300031344 Bacteria 6139
278 Ga0265316_10163375 3300031344 Bacteria 1664
279 Ga0307513_10129530 3300031456 Bacteria 2472
280 Ga0265313_10148240 3300031595 Unclassified 1004
281 Ga0265314_10027043 3300031711 Unclassified 4300
282 Ga0265314_10102863 3300031711 Unclassified 1832
283 Ga0265342_10000685 3300031712 Bacteria 35416
284 Ga0265342_10000911 3300031712 Bacteria 29362
285 Ga0373926_0032528 3300035083 Bacteria 1840
286 Ga0373944_0008629 3300035089 Bacteria 2753
287 Ga0373923_0015498 3300035111 Bacteria 2879
288 Ga0373936_0011417 3300035113 Bacteria 3361
289 Ga0373936_0018271 3300035113 Bacteria 2706
290 Ga0373945_0006308 3300035116 Bacteria 3819
291 Ga0373945_0091074 3300035116 Bacteria 1181
292 Ga0373953_0005809 3300035117 Bacteria 4034
293 Ga0373953_0006486 3300035117 Bacteria 3857
294 Ga0373953_0022890 3300035117 Bacteria 2362
295 Ga0373954_0046369 3300035118 Bacteria 2031
296 Ga0373956_0004677 3300035119 Bacteria 5471
297 Ga0373956_0087437 3300035119 Bacteria 1435
298 Ga0373957_0004928 3300035120 Bacteria 4106
299 Ga0373943_0021699 3300035170 Bacteria 2967
300 Ga0373943_0054788 3300035170 Bacteria 1973
301 Ga0373943_0190076 3300035170 Bacteria 1132
302 Ga0373946_0000442 3300035171 Bacteria 13617
303 Ga0373946_0010894 3300035171 Bacteria 3379
304 Ga0373946_0025003 3300035171 Bacteria 2346
305 Ga0373946_0033278 3300035171 Bacteria 2074
306 Ga0373955_0000166 3300035172 Bacteria 26797
307 Ga0373924_0000432 3300035410 Bacteria 12866
308 Ga0373935_0000370 3300035692 Bacteria 23018
309 Ga0373935_0027185 3300035692 Bacteria 3537
310 Ga0373935_0055012 3300035692 Bacteria 2535
311 Ga0373935_0372360 3300035692 Bacteria 1021
312 Ga0373927_0040086 3300035695 Bacteria 3039
313 Ga0373927_0066284 3300035695 Bacteria 2335
314 Ga0373927_0124155 3300035695 Bacteria 1685
315 Ga0373933_0004813 3300035724 Bacteria 7379
316 Ga0373933_0023862 3300035724 Bacteria 3498
317 Ga0373933_0111177 3300035724 Bacteria 1709
318 Ga0373947_0000476 3300035725 Bacteria 22980
319 Ga0373947_0010161 3300035725 Bacteria 5404
320 Ga0373947_0027470 3300035725 Bacteria 3330
321 Ga0373947_0086602 3300035725 Bacteria 1947
322 Ga0373947_0146808 3300035725 Bacteria 1517
323 Ga0373947_0237347 3300035725 Bacteria 1202
324 Ga0373937_0000009 3300036401 Bacteria 169521
325 Ga0373937_0003330 3300036401 Bacteria 13489
326 Ga0373937_0005759 3300036401 Bacteria 10649
327 Ga0373937_0023903 3300036401 Bacteria 5510
328 Ga0373925_0000194 3300037068 Bacteria 66124
329 Ga0373925_0005613 3300037068 Bacteria 9339
330 Ga0373925_0008239 3300037068 Bacteria 7587
331 Ga0395905_0026581 3300037471 Bacteria 5457
332 Ga0436364_0462828 3300037853 Bacteria 1284
333 Ga0436365_0687883 3300039437 Bacteria 6665
334 Ga0436365_1268687 3300039437 Bacteria 27308
335 Ga0436363_1357641 3300039450 Unclassified 1389
336 Ga0436362_0236558 3300039453 Bacteria 2087
337 Ga0466967_0058292 3300045976 Bacteria 3413
338 Ga0495592_0000018 3300046454 Bacteria 140962
339 Ga0495629_0225654 3300046459 Bacteria 1291
340 Ga0495638_0026849 3300046460 Bacteria 3730
341 Ga0495651_0000776 3300046462 Bacteria 24711
342 Ga0495651_0001122 3300046462 Bacteria 20711
343 Ga0495653_0000032 3300046463 Bacteria 132763
344 Ga0495580_0033577 3300046472 Bacteria 3696
345 Ga0495580_0059585 3300046472 Bacteria 2683
346 Ga0495582_0113828 3300046473 Bacteria 1520
347 Ga0495639_0003944 3300046475 Bacteria 6377
348 Ga0495662_0019809 3300046476 Bacteria 3254
349 Ga0495662_0020235 3300046476 Bacteria 3218
350 Ga0495662_0116704 3300046476 Bacteria 1309
351 Ga0495664_0000010 3300046477 Bacteria 268381
352 Ga0495664_0374997 3300046477 Bacteria 856
353 Ga0495584_0065830 3300046491 Bacteria 1823
354 Ga0495594_0095669 3300046499 Unclassified 1668
355 Ga0495608_0000008 3300046511 Bacteria 268629
356 Ga0495618_0000002 3300046514 Bacteria 271353
357 Ga0495628_0000009 3300046516 Bacteria 237611
358 Ga0495628_0137931 3300046516 Bacteria 1863
359 Ga0495630_0001850 3300046517 Bacteria 14780
360 Ga0495630_0166156 3300046517 Bacteria 1680
361 Ga0495644_0047006 3300046523 Bacteria 1622
362 Ga0495652_0000011 3300046529 Bacteria 255329
363 Ga0495665_0031765 3300046531 Bacteria 2825
364 Ga0495665_0035206 3300046531 Bacteria 2675
365 Ga0495665_0046368 3300046531 Bacteria 2307
366 Ga0495640_0000009 3300046533 Bacteria 217086
367 Ga0495587_0000006 3300046536 Bacteria 310070
368 Ga0495621_0002192 3300046539 Bacteria 5200
369 Ga0495645_0000010 3300046543 Bacteria 238337
370 Ga0495667_0000005 3300046559 Bacteria 268252
371 Ga0495667_0075453 3300046559 Unclassified 2194
372 Ga0495634_0000223 3300046642 Bacteria 53103
373 Ga0495635_0000008 3300046663 Bacteria 268349
374 Ga0495635_0104646 3300046663 Bacteria 1934
375 Ga0495659_0018363 3300046664 Unclassified 2329
376 Ga0495588_0198652 3300046674 Bacteria 1059
377 Ga0495657_0000058 3300046675 Bacteria 97827
378 Ga0495599_0000007 3300046678 Bacteria 236638
379 Ga0495623_0005790 3300046679 Bacteria 8063
380 Ga0495646_0000021 3300046680 Bacteria 115358
381 Ga0495647_0014311 3300046681 Bacteria 2762
382 Ga0495658_0073514 3300046683 Bacteria 1990
383 Ga0495613_0015024 3300046689 Bacteria 5748
384 Ga0495613_0074473 3300046689 Bacteria 2472
385 Ga0495670_0046872 3300046691 Bacteria 2160
386 Ga0495670_0199000 3300046691 Bacteria 1061
387 Ga0495600_0000001 3300046809 Bacteria 214870
388 Ga0495600_0021262 3300046809 Bacteria 4153
389 Ga0495600_0107963 3300046809 Unclassified 1813
390 Ga0495581_0033062 3300047315 Bacteria 2994
391 Ga0495604_0000012 3300047317 Bacteria 268341
392 Ga0495674_0000011 3300047319 Bacteria 270911
393 Ga0495680_0000879 3300047322 Bacteria 33399
394 Ga0495680_0001281 3300047322 Bacteria 27427
395 Ga0495675_0000096 3300047444 Bacteria 62617
396 Ga0495675_0082571 3300047444 Unclassified 2023
397 Ga0495685_040622 3300047447 Unclassified 1591
398 Ga0495684_0000084 3300047471 Bacteria 65600
399 Ga0495684_0028126 3300047471 Bacteria 4317
400 Ga0495593_0000727 3300047673 Bacteria 19074
401 Ga0495602_0000073 3300048088 Bacteria 98745
402 Ga0496101_0074882 3300048904 Bacteria 2491
403 Ga0496101_0078319 3300048904 Bacteria 2438
404 Ga0496104_0024024 3300048907 Bacteria 5608
405 Ga0496104_0074426 3300048907 Bacteria 3233
406 Ga0496105_0274946 3300048908 Bacteria 1359
407 Ga0496106_0570327 3300048909 Bacteria 908
408 Ga0496107_0218037 3300048910 Bacteria 1419
409 Ga0496107_0287861 3300048910 Bacteria 1223
410 Ga0496108_0068236 3300048911 Bacteria 3000
411 Ga0496109_0040591 3300048912 Bacteria 4215
412 Ga0496109_0425347 3300048912 Bacteria 1255
413 Ga0496112_0000168 3300048915 Bacteria 41695
414 Ga0501072_0004994 3300049588 Bacteria 10092
415 Ga0501083_0134212 3300049744 Bacteria 1622
416 nmdc:mga07m45_134741_c1 3300050496 Bacteria 1429
417 nmdc:mga05p37_3933_c1 3300050507 Bacteria 17401
418 nmdc:mga05p37_4105_c1 3300050507 Bacteria 17022
419 nmdc:mga0qj67_120532_c1 3300050509 Bacteria 2122
420 nmdc:mga06r32_81074_c1 3300050510 Bacteria 3160
421 nmdc:mga08y16_517071_c1 3300050511 Bacteria 1211
422 nmdc:mga0n895_40451_c1 3300050512 Bacteria 4528
423 nmdc:mga0n895_451323_c1 3300050512 Bacteria 1298
424 nmdc:mga0n895_4580_c1 3300050512 Bacteria 11389
425 nmdc:mga0n895_72497_c1 3300050512 Unclassified 3417
426 nmdc:mga0rr50_138568_c1 3300050513 Bacteria 1955
427 nmdc:mga0rr50_2759_c1 3300050513 Bacteria 9979
428 nmdc:mga0rr50_694870_c1 3300050513 Bacteria 868
429 nmdc:mga08x19_2437_c1 3300050514 Bacteria 11296
430 nmdc:mga0a205_123355_c1 3300050515 Bacteria 2490
431 nmdc:mga0a205_151111_c1 3300050515 Bacteria 2222
432 nmdc:mga0a205_52830_c1 3300050515 Unclassified 3922
433 nmdc:mga0a205_570_c1 3300050515 Bacteria 29248
434 Ga0495601_0000009 3300053077 Bacteria 270622
435 Ga0495601_0363383 3300053077 Bacteria 940
436 Ga0495612_0000019 3300053078 Bacteria 137844
437 Ga0495612_0122848 3300053078 Bacteria 1118
438 Ga0500610_0088091 3300053079 Bacteria 1614
439 Ga0495595_0000015 3300053084 Bacteria 144946
440 Ga0495595_0187074 3300053084 Bacteria 1028
441 Ga0495619_0000012 3300053085 Bacteria 268349
442 Ga0495619_0024294 3300053085 Bacteria 3886
443 Ga0500644_0097082 3300053088 Bacteria 1114
444 Ga0501084_0121681 3300054114 Bacteria 2194

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046477 Ga0495664_0374997 Ga0495664_0374997_125_820 230
2 3300026023 Ga0207677_10056841 Ga0207677_100568413 235
3 3300005843 Ga0068860_100058191 Ga0068860_1000581913 255
4 3300009098 Ga0105245_10005651 Ga0105245_100056514 255
5 3300009174 Ga0105241_10754197 Ga0105241_107541971 255
6 3300013296 Ga0157374_10006597 Ga0157374_100065972 255
7 3300013297 Ga0157378_10008628 Ga0157378_100086282 255
8 3300025898 Ga0207692_10206339 Ga0207692_102063391 255
9 3300025903 Ga0207680_10007536 Ga0207680_100075362 255
10 3300025906 Ga0207699_10047477 Ga0207699_100474772 255
11 3300025916 Ga0207663_10068894 Ga0207663_100688942 255
12 3300025918 Ga0207662_10037075 Ga0207662_100370753 255
13 3300025926 Ga0207659_10041300 Ga0207659_100413002 255
14 3300025934 Ga0207686_10123240 Ga0207686_101232402 255
15 3300025941 Ga0207711_10001413 Ga0207711_1000141321 255
16 3300025942 Ga0207689_10023065 Ga0207689_100230655 255
17 3300026023 Ga0207677_10000292 Ga0207677_1000029237 255
18 3300026088 Ga0207641_10111719 Ga0207641_101117192 255
19 3300028379 Ga0268266_10022823 Ga0268266_100228233 255
20 3300035083 Ga0373926_0032528 Ga0373926_0032528_1054_1827 255
21 3300035113 Ga0373936_0018271 Ga0373936_0018271_413_1186 255
22 3300035117 Ga0373953_0005809 Ga0373953_0005809_1890_2663 255
23 3300035118 Ga0373954_0046369 Ga0373954_0046369_37_810 255
24 3300035119 Ga0373956_0004677 Ga0373956_0004677_2333_3106 255
25 3300035120 Ga0373957_0004928 Ga0373957_0004928_614_1387 255
26 3300035170 Ga0373943_0021699 Ga0373943_0021699_1439_2212 255
27 3300035170 Ga0373943_0190076 Ga0373943_0190076_177_950 255
28 3300035171 Ga0373946_0033278 Ga0373946_0033278_994_1767 255
29 3300035692 Ga0373935_0372360 Ga0373935_0372360_136_909 255
30 3300035695 Ga0373927_0040086 Ga0373927_0040086_1921_2694 255
31 3300035724 Ga0373933_0023862 Ga0373933_0023862_1071_1844 255
32 3300035725 Ga0373947_0237347 Ga0373947_0237347_249_1022 255
33 3300046539 Ga0495621_0002192 Ga0495621_0002192_3851_4624 255
34 3300048907 Ga0496104_0024024 Ga0496104_0024024_3905_4678 255
35 3300048910 Ga0496107_0218037 Ga0496107_0218037_146_919 255
36 3300048911 Ga0496108_0068236 Ga0496108_0068236_240_1013 255
37 3300048912 Ga0496109_0425347 Ga0496109_0425347_180_953 255
38 3300048915 Ga0496112_0000168 Ga0496112_0000168_11136_11909 255
39 3300053077 Ga0495601_0363383 Ga0495601_0363383_122_895 255
40 3300039450 Ga0436363_1357641 Ga0436363_1357641_390_1187 257
41 3300026067 Ga0207678_10147834 Ga0207678_101478342 259
42 3300048904 Ga0496101_0078319 Ga0496101_0078319_495_1292 263
43 3300048907 Ga0496104_0074426 Ga0496104_0074426_1605_2402 263
44 3300048908 Ga0496105_0274946 Ga0496105_0274946_372_1169 263
45 3300048912 Ga0496109_0040591 Ga0496109_0040591_2150_2947 263
46 3300005334 Ga0068869_100008983 Ga0068869_1000089837 265
47 3300005365 Ga0070688_100013650 Ga0070688_1000136504 265
48 3300005466 Ga0070685_10013334 Ga0070685_100133342 265
49 3300005544 Ga0070686_100041419 Ga0070686_1000414191 265
50 3300009176 Ga0105242_10015069 Ga0105242_100150694 265
51 3300013306 Ga0163162_10003126 Ga0163162_1000312618 265
52 3300014325 Ga0163163_10004794 Ga0163163_100047949 265
53 3300014968 Ga0157379_10015353 Ga0157379_100153535 265
54 3300014969 Ga0157376_10013344 Ga0157376_100133444 265
55 3300025939 Ga0207665_10021390 Ga0207665_100213901 265
56 3300048904 Ga0496101_0074882 Ga0496101_0074882_1415_2218 265
57 3300021384 Ga0213876_10001415 Ga0213876_100014153 269
58 3300039437 Ga0436365_1268687 Ga0436365_1268687_5395_6210 269
59 3300005330 Ga0070690_100015884 Ga0070690_1000158843 272
60 3300005335 Ga0070666_10001448 Ga0070666_100014484 272
61 3300005335 Ga0070666_10085375 Ga0070666_100853752 272
62 3300005336 Ga0070680_100022478 Ga0070680_1000224783 272
63 3300005337 Ga0070682_100025574 Ga0070682_1000255743 272
64 3300005338 Ga0068868_100016580 Ga0068868_1000165803 272
65 3300005338 Ga0068868_100042116 Ga0068868_1000421162 272
66 3300005339 Ga0070660_100038084 Ga0070660_1000380842 272
67 3300005340 Ga0070689_100047807 Ga0070689_1000478073 272
68 3300005343 Ga0070687_100054885 Ga0070687_1000548852 272
69 3300005345 Ga0070692_10035142 Ga0070692_100351421 272
70 3300005354 Ga0070675_100067903 Ga0070675_1000679032 272
71 3300005355 Ga0070671_100020942 Ga0070671_1000209423 272
72 3300005355 Ga0070671_100045176 Ga0070671_1000451762 272
73 3300005367 Ga0070667_100002784 Ga0070667_10000278414 272
74 3300005367 Ga0070667_100050165 Ga0070667_1000501652 272
75 3300005434 Ga0070709_10234178 Ga0070709_102341781 272
76 3300005435 Ga0070714_100065054 Ga0070714_1000650543 272
77 3300005436 Ga0070713_100013746 Ga0070713_1000137462 272
78 3300005436 Ga0070713_100118346 Ga0070713_1001183463 272
79 3300005437 Ga0070710_10018778 Ga0070710_100187783 272
80 3300005437 Ga0070710_10056243 Ga0070710_100562432 272
81 3300005439 Ga0070711_100325903 Ga0070711_1003259031 272
82 3300005440 Ga0070705_100064669 Ga0070705_1000646692 272
83 3300005444 Ga0070694_100227530 Ga0070694_1002275302 272
84 3300005445 Ga0070708_100013694 Ga0070708_1000136947 272
85 3300005456 Ga0070678_100001460 Ga0070678_1000014602 272
86 3300005457 Ga0070662_100037444 Ga0070662_1000374442 272
87 3300005457 Ga0070662_100416246 Ga0070662_1004162461 272
88 3300005458 Ga0070681_10382812 Ga0070681_103828122 272
89 3300005468 Ga0070707_100178133 Ga0070707_1001781332 272
90 3300005518 Ga0070699_100060193 Ga0070699_1000601932 272
91 3300005530 Ga0070679_100020967 Ga0070679_1000209672 272
92 3300005536 Ga0070697_100097828 Ga0070697_1000978282 272
93 3300005545 Ga0070695_100041951 Ga0070695_1000419512 272
94 3300005545 Ga0070695_100356639 Ga0070695_1003566392 272
95 3300005546 Ga0070696_100274753 Ga0070696_1002747531 272
96 3300005547 Ga0070693_100003460 Ga0070693_1000034608 272
97 3300005548 Ga0070665_100065042 Ga0070665_1000650423 272
98 3300005578 Ga0068854_100035025 Ga0068854_1000350252 272
99 3300005614 Ga0068856_100073560 Ga0068856_1000735602 272
100 3300005615 Ga0070702_100003808 Ga0070702_1000038086 272
101 3300005615 Ga0070702_100514827 Ga0070702_1005148271 272
102 3300005618 Ga0068864_100062074 Ga0068864_1000620744 272
103 3300005618 Ga0068864_100765293 Ga0068864_1007652931 272
104 3300005718 Ga0068866_10001586 Ga0068866_100015863 272
105 3300005841 Ga0068863_100000860 Ga0068863_10000086034 272
106 3300005843 Ga0068860_100057579 Ga0068860_1000575792 272
107 3300006173 Ga0070716_100041002 Ga0070716_1000410022 272
108 3300006175 Ga0070712_100025196 Ga0070712_1000251962 272
109 3300006237 Ga0097621_100015907 Ga0097621_1000159074 272
110 3300006237 Ga0097621_100020480 Ga0097621_1000204802 272
111 3300006358 Ga0068871_100024692 Ga0068871_1000246923 272
112 3300006358 Ga0068871_100079989 Ga0068871_1000799892 272
113 3300009098 Ga0105245_10007146 Ga0105245_1000714611 272
114 3300009098 Ga0105245_10087889 Ga0105245_100878892 272
115 3300009174 Ga0105241_10006464 Ga0105241_1000646410 272
116 3300009176 Ga0105242_10070376 Ga0105242_100703762 272
117 3300009177 Ga0105248_10353578 Ga0105248_103535782 272
118 3300009545 Ga0105237_10043899 Ga0105237_100438993 272
119 3300009551 Ga0105238_10090124 Ga0105238_100901241 272
120 3300010375 Ga0105239_10442727 Ga0105239_104427272 272
121 3300013105 Ga0157369_10051366 Ga0157369_100513662 272
122 3300013297 Ga0157378_10032211 Ga0157378_100322113 272
123 3300013306 Ga0163162_10007540 Ga0163162_1000754011 272
124 3300014969 Ga0157376_10027196 Ga0157376_100271963 272
125 3300025903 Ga0207680_10200539 Ga0207680_102005392 272
126 3300025910 Ga0207684_10229636 Ga0207684_102296361 272
127 3300025911 Ga0207654_10198469 Ga0207654_101984691 272
128 3300025915 Ga0207693_10000253 Ga0207693_1000025339 272
129 3300025915 Ga0207693_10373511 Ga0207693_103735111 272
130 3300025917 Ga0207660_10308017 Ga0207660_103080172 272
131 3300025919 Ga0207657_10002542 Ga0207657_100025427 272
132 3300025920 Ga0207649_10157582 Ga0207649_101575822 272
133 3300025927 Ga0207687_10000926 Ga0207687_100009266 272
134 3300025927 Ga0207687_10020616 Ga0207687_100206162 272
135 3300025929 Ga0207664_10004251 Ga0207664_1000425111 272
136 3300025931 Ga0207644_10057511 Ga0207644_100575112 272
137 3300025933 Ga0207706_10007903 Ga0207706_100079034 272
138 3300025933 Ga0207706_10037681 Ga0207706_100376811 272
139 3300025934 Ga0207686_10000919 Ga0207686_1000091915 272
140 3300025937 Ga0207669_10025796 Ga0207669_100257963 272
141 3300025938 Ga0207704_10007967 Ga0207704_100079672 272
142 3300025939 Ga0207665_10005166 Ga0207665_100051662 272
143 3300025942 Ga0207689_10048395 Ga0207689_100483952 272
144 3300025960 Ga0207651_10047980 Ga0207651_100479804 272
145 3300025981 Ga0207640_10010089 Ga0207640_100100893 272
146 3300025981 Ga0207640_10044685 Ga0207640_100446852 272
147 3300025986 Ga0207658_10012538 Ga0207658_100125382 272
148 3300026023 Ga0207677_10003404 Ga0207677_1000340411 272
149 3300026035 Ga0207703_10001604 Ga0207703_1000160415 272
150 3300026041 Ga0207639_10285410 Ga0207639_102854102 272
151 3300026089 Ga0207648_10052457 Ga0207648_100524573 272
152 3300026095 Ga0207676_10006967 Ga0207676_100069674 272
153 3300026116 Ga0207674_10035381 Ga0207674_100353813 272
154 3300026121 Ga0207683_10000314 Ga0207683_100003149 272
155 3300028381 Ga0268264_10003602 Ga0268264_1000360213 272
156 3300035089 Ga0373944_0008629 Ga0373944_0008629_131_955 272
157 3300035116 Ga0373945_0006308 Ga0373945_0006308_1064_1888 272
158 3300035117 Ga0373953_0022890 Ga0373953_0022890_179_1003 272
159 3300035170 Ga0373943_0054788 Ga0373943_0054788_710_1534 272
160 3300035171 Ga0373946_0010894 Ga0373946_0010894_1442_2266 272
161 3300035692 Ga0373935_0055012 Ga0373935_0055012_545_1369 272
162 3300035695 Ga0373927_0066284 Ga0373927_0066284_1318_2142 272
163 3300035724 Ga0373933_0111177 Ga0373933_0111177_714_1538 272
164 3300035725 Ga0373947_0027470 Ga0373947_0027470_1475_2299 272
165 3300036401 Ga0373937_0003330 Ga0373937_0003330_12393_13217 272
166 3300036401 Ga0373937_0023903 Ga0373937_0023903_1872_2696 272
167 3300037068 Ga0373925_0005613 Ga0373925_0005613_4352_5176 272
168 3300037853 Ga0436364_0462828 Ga0436364_0462828_206_1162 272
169 3300046459 Ga0495629_0225654 Ga0495629_0225654_370_1194 272
170 3300046472 Ga0495580_0033577 Ga0495580_0033577_298_1122 272
171 3300046473 Ga0495582_0113828 Ga0495582_0113828_603_1427 272
172 3300046475 Ga0495639_0003944 Ga0495639_0003944_1901_2725 272
173 3300046476 Ga0495662_0019809 Ga0495662_0019809_1958_2782 272
174 3300046516 Ga0495628_0137931 Ga0495628_0137931_374_1198 272
175 3300046517 Ga0495630_0166156 Ga0495630_0166156_194_1018 272
176 3300046531 Ga0495665_0031765 Ga0495665_0031765_1843_2667 272
177 3300046663 Ga0495635_0104646 Ga0495635_0104646_436_1260 272
178 3300046674 Ga0495588_0198652 Ga0495588_0198652_53_877 272
179 3300046681 Ga0495647_0014311 Ga0495647_0014311_640_1464 272
180 3300046689 Ga0495613_0074473 Ga0495613_0074473_1542_2366 272
181 3300046809 Ga0495600_0021262 Ga0495600_0021262_1841_2665 272
182 3300047315 Ga0495581_0033062 Ga0495581_0033062_1735_2559 272
183 3300047471 Ga0495684_0028126 Ga0495684_0028126_1778_2602 272
184 3300048909 Ga0496106_0570327 Ga0496106_0570327_74_898 272
185 3300048910 Ga0496107_0287861 Ga0496107_0287861_289_1113 272
186 3300050513 nmdc:mga0rr50_694870_c1 nmdc:mga0rr50_694870_c1_18_842 272
187 3300053085 Ga0495619_0024294 Ga0495619_0024294_211_1035 272
188 3300009176 Ga0105242_10394772 Ga0105242_103947722 273
189 3300013306 Ga0163162_10185007 Ga0163162_101850072 273
190 3300013296 Ga0157374_10649734 Ga0157374_106497341 275
191 3300049744 Ga0501083_0134212 Ga0501083_0134212_444_1319 275
192 3300005434 Ga0070709_10029660 Ga0070709_100296602 276
193 3300035171 Ga0373946_0025003 Ga0373946_0025003_867_1703 276
194 3300035692 Ga0373935_0027185 Ga0373935_0027185_1531_2367 276
195 3300035725 Ga0373947_0086602 Ga0373947_0086602_1039_1875 276
196 3300005334 Ga0068869_100110267 Ga0068869_1001102671 284
197 3300025906 Ga0207699_10020377 Ga0207699_100203773 284
198 3300006844 Ga0075428_100101437 Ga0075428_1001014374 286
199 3300009147 Ga0114129_10039522 Ga0114129_100395222 286
200 3300039437 Ga0436365_0687883 Ga0436365_0687883_1718_2674 286
201 3300049588 Ga0501072_0004994 Ga0501072_0004994_2741_3616 286
202 3300050509 nmdc:mga0qj67_120532_c1 nmdc:mga0qj67_120532_c1_67_936 286
203 3300054114 Ga0501084_0121681 Ga0501084_0121681_471_1346 286
204 3300046460 Ga0495638_0026849 Ga0495638_0026849_1563_2474 288
205 3300053079 Ga0500610_0088091 Ga0500610_0088091_667_1578 291
206 3300053088 Ga0500644_0097082 Ga0500644_0097082_128_1039 292
207 3300045976 Ga0466967_0058292 Ga0466967_0058292_587_1471 293
208 3300009176 Ga0105242_10067896 Ga0105242_100678962 294
209 3300005329 Ga0070683_100293647 Ga0070683_1002936472 295
210 3300025924 Ga0207694_10228794 Ga0207694_102287942 295
211 3300025944 Ga0207661_10242945 Ga0207661_102429452 295
212 3300046491 Ga0495584_0065830 Ga0495584_0065830_593_1483 295
213 3300031344 Ga0265316_10163375 Ga0265316_101633752 297
214 3300046499 Ga0495594_0095669 Ga0495594_0095669_58_1017 297
215 3300031456 Ga0307513_10129530 Ga0307513_101295303 299
216 3300050496 nmdc:mga07m45_134741_c1 nmdc:mga07m45_134741_c1_485_1396 299
217 3300036401 Ga0373937_0005759 Ga0373937_0005759_7748_8701 300
218 3300053084 Ga0495595_0187074 Ga0495595_0187074_34_987 300
219 3300028563 Ga0265319_1003876 Ga0265319_10038766 302
220 3300039453 Ga0436362_0236558 Ga0436362_0236558_56_1006 304
221 3300005617 Ga0068859_100028735 Ga0068859_1000287358 305
222 3300006237 Ga0097621_100010944 Ga0097621_1000109444 305
223 3300006237 Ga0097621_100227472 Ga0097621_1002274722 305
224 3300006931 Ga0097620_100028735 Ga0097620_1000287358 305
225 3300025924 Ga0207694_10043075 Ga0207694_100430753 305
226 3300028379 Ga0268266_10021421 Ga0268266_100214212 305
227 3300005345 Ga0070692_10035563 Ga0070692_100355633 306
228 3300005438 Ga0070701_10001401 Ga0070701_100014014 306
229 3300005615 Ga0070702_100189187 Ga0070702_1001891871 306
230 3300050512 nmdc:mga0n895_451323_c1 nmdc:mga0n895_451323_c1_359_1285 306
231 3300053078 Ga0495612_0122848 Ga0495612_0122848_45_986 306
232 3300006852 Ga0075433_10034485 Ga0075433_100344854 307
233 3300009094 Ga0111539_10621670 Ga0111539_106216701 307
234 3300050511 nmdc:mga08y16_517071_c1 nmdc:mga08y16_517071_c1_143_1108 307
235 3300050513 nmdc:mga0rr50_138568_c1 nmdc:mga0rr50_138568_c1_44_1003 307
236 3300050515 nmdc:mga0a205_123355_c1 nmdc:mga0a205_123355_c1_1244_2209 307
237 3300005435 Ga0070714_100268157 Ga0070714_1002681571 308
238 3300005445 Ga0070708_100023502 Ga0070708_1000235022 308
239 3300005458 Ga0070681_10077182 Ga0070681_100771823 308
240 3300005467 Ga0070706_100027193 Ga0070706_1000271932 308
241 3300005468 Ga0070707_100022206 Ga0070707_1000222063 308
242 3300005471 Ga0070698_100017927 Ga0070698_1000179274 308
243 3300005471 Ga0070698_100288342 Ga0070698_1002883421 308
244 3300005518 Ga0070699_100018599 Ga0070699_1000185993 308
245 3300005536 Ga0070697_100008259 Ga0070697_1000082595 308
246 3300005616 Ga0068852_100062225 Ga0068852_1000622253 308
247 3300006844 Ga0075428_100002079 Ga0075428_1000020794 308
248 3300006847 Ga0075431_100005914 Ga0075431_10000591410 308
249 3300006871 Ga0075434_100237050 Ga0075434_1002370502 308
250 3300006880 Ga0075429_100002897 Ga0075429_1000028978 308
251 3300006914 Ga0075436_100003236 Ga0075436_1000032367 308
252 3300007076 Ga0075435_100016100 Ga0075435_1000161004 308
253 3300009147 Ga0114129_10013818 Ga0114129_100138185 308
254 3300009147 Ga0114129_10014251 Ga0114129_100142516 308
255 3300009545 Ga0105237_10169733 Ga0105237_101697333 308
256 3300009551 Ga0105238_10149311 Ga0105238_101493111 308
257 3300013104 Ga0157370_10356350 Ga0157370_103563501 308
258 3300025910 Ga0207684_10003214 Ga0207684_100032147 308
259 3300025912 Ga0207707_10046577 Ga0207707_100465772 308
260 3300025913 Ga0207695_10018113 Ga0207695_100181133 308
261 3300025919 Ga0207657_10010361 Ga0207657_100103616 308
262 3300025949 Ga0207667_10175721 Ga0207667_101757213 308
263 3300026078 Ga0207702_10291104 Ga0207702_102911041 308
264 3300037471 Ga0395905_0026581 Ga0395905_0026581_816_1766 308
265 3300050507 nmdc:mga05p37_3933_c1 nmdc:mga05p37_3933_c1_11444_12394 308
266 3300050507 nmdc:mga05p37_4105_c1 nmdc:mga05p37_4105_c1_12102_13052 308
267 3300050510 nmdc:mga06r32_81074_c1 nmdc:mga06r32_81074_c1_1741_2691 308
268 3300050512 nmdc:mga0n895_4580_c1 nmdc:mga0n895_4580_c1_5430_6380 308
269 3300050513 nmdc:mga0rr50_2759_c1 nmdc:mga0rr50_2759_c1_5770_6720 308
270 3300050514 nmdc:mga08x19_2437_c1 nmdc:mga08x19_2437_c1_4981_5931 308
271 3300050515 nmdc:mga0a205_570_c1 nmdc:mga0a205_570_c1_5588_6538 308
272 3300009147 Ga0114129_10304541 Ga0114129_103045413 309
273 3300025916 Ga0207663_10425241 Ga0207663_104252411 309
274 3300046476 Ga0495662_0116704 Ga0495662_0116704_76_1035 309
275 3300046689 Ga0495613_0015024 Ga0495613_0015024_2101_3060 309
276 3300047447 Ga0495685_040622 Ga0495685_040622_344_1303 310
277 3300028577 Ga0265318_10000780 Ga0265318_100007802 311
278 3300031238 Ga0265332_10077214 Ga0265332_100772141 311
279 3300031240 Ga0265320_10000598 Ga0265320_1000059818 311
280 3300031241 Ga0265325_10009149 Ga0265325_100091494 311
281 3300031241 Ga0265325_10094063 Ga0265325_100940631 311
282 3300031242 Ga0265329_10000677 Ga0265329_1000067718 311
283 3300031247 Ga0265340_10016258 Ga0265340_100162584 311
284 3300031249 Ga0265339_10005556 Ga0265339_100055562 311
285 3300031250 Ga0265331_10000740 Ga0265331_100007402 311
286 3300031344 Ga0265316_10002478 Ga0265316_1000247819 311
287 3300031595 Ga0265313_10148240 Ga0265313_101482401 311
288 3300031711 Ga0265314_10027043 Ga0265314_100270435 311
289 3300031712 Ga0265342_10000911 Ga0265342_100009112 311
290 3300025939 Ga0207665_10037822 Ga0207665_100378223 312
291 3300035111 Ga0373923_0015498 Ga0373923_0015498_30_989 312
292 3300035113 Ga0373936_0011417 Ga0373936_0011417_1957_2916 312
293 3300035117 Ga0373953_0006486 Ga0373953_0006486_2468_3427 312
294 3300035119 Ga0373956_0087437 Ga0373956_0087437_86_1045 312
295 3300035171 Ga0373946_0000442 Ga0373946_0000442_7516_8475 312
296 3300035172 Ga0373955_0000166 Ga0373955_0000166_433_1392 312
297 3300035410 Ga0373924_0000432 Ga0373924_0000432_7101_8060 312
298 3300035692 Ga0373935_0000370 Ga0373935_0000370_10967_11926 312
299 3300035695 Ga0373927_0124155 Ga0373927_0124155_663_1622 312
300 3300035724 Ga0373933_0004813 Ga0373933_0004813_1463_2422 312
301 3300035725 Ga0373947_0000476 Ga0373947_0000476_6990_7949 312
302 3300036401 Ga0373937_0000009 Ga0373937_0000009_91755_92714 312
303 3300037068 Ga0373925_0000194 Ga0373925_0000194_19484_20443 312
304 3300046454 Ga0495592_0000018 Ga0495592_0000018_28846_29805 312
305 3300046462 Ga0495651_0001122 Ga0495651_0001122_15117_16076 312
306 3300046463 Ga0495653_0000032 Ga0495653_0000032_60956_61915 312
307 3300046476 Ga0495662_0020235 Ga0495662_0020235_389_1348 312
308 3300046477 Ga0495664_0000010 Ga0495664_0000010_175797_176756 312
309 3300046511 Ga0495608_0000008 Ga0495608_0000008_91893_92852 312
310 3300046514 Ga0495618_0000002 Ga0495618_0000002_178070_179029 312
311 3300046516 Ga0495628_0000009 Ga0495628_0000009_175825_176784 312
312 3300046517 Ga0495630_0001850 Ga0495630_0001850_6844_7803 312
313 3300046529 Ga0495652_0000011 Ga0495652_0000011_91583_92542 312
314 3300046531 Ga0495665_0046368 Ga0495665_0046368_520_1479 312
315 3300046533 Ga0495640_0000009 Ga0495640_0000009_40335_41294 312
316 3300046536 Ga0495587_0000006 Ga0495587_0000006_289543_290502 312
317 3300046543 Ga0495645_0000010 Ga0495645_0000010_60956_61915 312
318 3300046559 Ga0495667_0000005 Ga0495667_0000005_175825_176784 312
319 3300046642 Ga0495634_0000223 Ga0495634_0000223_47225_48184 312
320 3300046663 Ga0495635_0000008 Ga0495635_0000008_91566_92525 312
321 3300046675 Ga0495657_0000058 Ga0495657_0000058_46319_47278 312
322 3300046678 Ga0495599_0000007 Ga0495599_0000007_91583_92542 312
323 3300046679 Ga0495623_0005790 Ga0495623_0005790_4966_5925 312
324 3300046680 Ga0495646_0000021 Ga0495646_0000021_91538_92497 312
325 3300046683 Ga0495658_0073514 Ga0495658_0073514_49_1008 312
326 3300046809 Ga0495600_0000001 Ga0495600_0000001_91583_92542 312
327 3300047317 Ga0495604_0000012 Ga0495604_0000012_175812_176771 312
328 3300047319 Ga0495674_0000011 Ga0495674_0000011_178098_179057 312
329 3300047322 Ga0495680_0001281 Ga0495680_0001281_6840_7799 312
330 3300047444 Ga0495675_0000096 Ga0495675_0000096_22282_23241 312
331 3300047471 Ga0495684_0000084 Ga0495684_0000084_3686_4645 312
332 3300047673 Ga0495593_0000727 Ga0495593_0000727_2975_3934 312
333 3300048088 Ga0495602_0000073 Ga0495602_0000073_91566_92525 312
334 3300053077 Ga0495601_0000009 Ga0495601_0000009_91566_92525 312
335 3300053078 Ga0495612_0000019 Ga0495612_0000019_45303_46262 312
336 3300053084 Ga0495595_0000015 Ga0495595_0000015_72821_73780 312
337 3300053085 Ga0495619_0000012 Ga0495619_0000012_91566_92525 312
338 3300005334 Ga0068869_100047429 Ga0068869_1000474293 313
339 3300005340 Ga0070689_100136951 Ga0070689_1001369512 313
340 3300005354 Ga0070675_100007193 Ga0070675_1000071938 313
341 3300005440 Ga0070705_100092764 Ga0070705_1000927642 313
342 3300005564 Ga0070664_100151886 Ga0070664_1001518862 313
343 3300005617 Ga0068859_100018752 Ga0068859_1000187525 313
344 3300005842 Ga0068858_100350349 Ga0068858_1003503492 313
345 3300005843 Ga0068860_100020565 Ga0068860_1000205654 313
346 3300006871 Ga0075434_100043265 Ga0075434_1000432654 313
347 3300006931 Ga0097620_100018752 Ga0097620_1000187527 313
348 3300007788 Ga0099795_10016312 Ga0099795_100163123 313
349 3300010159 Ga0099796_10014376 Ga0099796_100143762 313
350 3300014745 Ga0157377_10013921 Ga0157377_100139213 313
351 3300025898 Ga0207692_10048111 Ga0207692_100481112 313
352 3300025926 Ga0207659_10004140 Ga0207659_100041405 313
353 3300025936 Ga0207670_10073379 Ga0207670_100733791 313
354 3300025938 Ga0207704_10034655 Ga0207704_100346554 313
355 3300025941 Ga0207711_10046246 Ga0207711_100462462 313
356 3300026035 Ga0207703_10171012 Ga0207703_101710122 313
357 3300026075 Ga0207708_10130635 Ga0207708_101306352 313
358 3300026095 Ga0207676_10543362 Ga0207676_105433621 313
359 3300028381 Ga0268264_10080379 Ga0268264_100803792 313
360 3300028577 Ga0265318_10000536 Ga0265318_1000053612 313
361 3300031240 Ga0265320_10000606 Ga0265320_1000060612 313
362 3300031242 Ga0265329_10002472 Ga0265329_100024724 313
363 3300031249 Ga0265339_10035633 Ga0265339_100356331 313
364 3300031250 Ga0265331_10000094 Ga0265331_100000941 313
365 3300031344 Ga0265316_10017739 Ga0265316_100177391 313
366 3300031711 Ga0265314_10102863 Ga0265314_101028632 313
367 3300031712 Ga0265342_10000685 Ga0265342_1000068515 313
368 3300050512 nmdc:mga0n895_40451_c1 nmdc:mga0n895_40451_c1_2279_3247 313
369 3300046462 Ga0495651_0000776 Ga0495651_0000776_4420_5385 314
370 3300046559 Ga0495667_0075453 Ga0495667_0075453_825_1790 314
371 3300046809 Ga0495600_0107963 Ga0495600_0107963_410_1375 314
372 3300047322 Ga0495680_0000879 Ga0495680_0000879_11152_12117 314
373 3300047444 Ga0495675_0082571 Ga0495675_0082571_256_1221 314
374 3300046691 Ga0495670_0199000 Ga0495670_0199000_82_1047 315
375 3300005338 Ga0068868_100027322 Ga0068868_1000273224 316
376 3300005367 Ga0070667_100186251 Ga0070667_1001862512 316
377 3300005539 Ga0068853_100040263 Ga0068853_1000402633 316
378 3300005719 Ga0068861_100137626 Ga0068861_1001376262 316
379 3300005842 Ga0068858_100169341 Ga0068858_1001693412 316
380 3300005842 Ga0068858_100460563 Ga0068858_1004605632 316
381 3300009098 Ga0105245_10004857 Ga0105245_100048576 316
382 3300009098 Ga0105245_10251628 Ga0105245_102516282 316
383 3300009174 Ga0105241_10008926 Ga0105241_100089269 316
384 3300009177 Ga0105248_10444049 Ga0105248_104440492 316
385 3300009545 Ga0105237_10064698 Ga0105237_100646982 316
386 3300009551 Ga0105238_10008064 Ga0105238_100080649 316
387 3300013297 Ga0157378_10286260 Ga0157378_102862602 316
388 3300014325 Ga0163163_10088079 Ga0163163_100880792 316
389 3300025911 Ga0207654_10059393 Ga0207654_100593932 316
390 3300025927 Ga0207687_10101590 Ga0207687_101015902 316
391 3300025927 Ga0207687_10445235 Ga0207687_104452351 316
392 3300025986 Ga0207658_10234095 Ga0207658_102340952 316
393 3300026023 Ga0207677_10145564 Ga0207677_101455642 316
394 3300026023 Ga0207677_10306134 Ga0207677_103061342 316
395 3300026041 Ga0207639_10152579 Ga0207639_101525792 316
396 3300035116 Ga0373945_0091074 Ga0373945_0091074_69_1034 316
397 3300035725 Ga0373947_0010161 Ga0373947_0010161_3071_4036 316
398 3300035725 Ga0373947_0146808 Ga0373947_0146808_141_1109 316
399 3300037068 Ga0373925_0008239 Ga0373925_0008239_613_1578 316
400 3300046472 Ga0495580_0059585 Ga0495580_0059585_517_1482 316
401 3300046531 Ga0495665_0035206 Ga0495665_0035206_1092_2060 316
402 3300005440 Ga0070705_100000815 Ga0070705_1000008159 317
403 3300005444 Ga0070694_100031388 Ga0070694_1000313882 317
404 3300005471 Ga0070698_100162559 Ga0070698_1001625592 317
405 3300005518 Ga0070699_100000432 Ga0070699_1000004324 317
406 3300005518 Ga0070699_100074620 Ga0070699_1000746202 317
407 3300005545 Ga0070695_100000165 Ga0070695_10000016522 317
408 3300005546 Ga0070696_100002625 Ga0070696_1000026253 317
409 3300005549 Ga0070704_100101876 Ga0070704_1001018762 317
410 3300005615 Ga0070702_100015847 Ga0070702_1000158473 317
411 3300006844 Ga0075428_100014398 Ga0075428_1000143983 317
412 3300006852 Ga0075433_10096371 Ga0075433_100963712 317
413 3300006871 Ga0075434_100029751 Ga0075434_1000297514 317
414 3300009147 Ga0114129_10000636 Ga0114129_1000063633 317
415 3300009147 Ga0114129_10141802 Ga0114129_101418023 317
416 3300025934 Ga0207686_10010553 Ga0207686_100105537 317
417 3300025934 Ga0207686_10056759 Ga0207686_100567592 317
418 3300046523 Ga0495644_0047006 Ga0495644_0047006_473_1435 317
419 3300046664 Ga0495659_0018363 Ga0495659_0018363_805_1767 317
420 3300046691 Ga0495670_0046872 Ga0495670_0046872_1147_2109 317
421 3300050512 nmdc:mga0n895_72497_c1 nmdc:mga0n895_72497_c1_847_1806 317
422 3300050515 nmdc:mga0a205_151111_c1 nmdc:mga0a205_151111_c1_885_1865 317
423 3300050515 nmdc:mga0a205_52830_c1 nmdc:mga0a205_52830_c1_1056_2015 317
424 3300005327 Ga0070658_10007032 Ga0070658_100070326 319
425 3300005339 Ga0070660_100134659 Ga0070660_1001346592 319
426 3300005367 Ga0070667_100088781 Ga0070667_1000887813 319
427 3300005530 Ga0070679_100099357 Ga0070679_1000993573 319
428 3300005577 Ga0068857_100072470 Ga0068857_1000724703 319
429 3300005842 Ga0068858_100009375 Ga0068858_1000093758 319
430 3300009174 Ga0105241_10001852 Ga0105241_100018527 319
431 3300009174 Ga0105241_10137117 Ga0105241_101371172 319
432 3300009174 Ga0105241_10154728 Ga0105241_101547282 319
433 3300009176 Ga0105242_10572224 Ga0105242_105722241 319
434 3300009545 Ga0105237_10015330 Ga0105237_100153309 319
435 3300010375 Ga0105239_10045923 Ga0105239_100459231 319
436 3300013306 Ga0163162_10008969 Ga0163162_1000896910 319
437 3300013308 Ga0157375_10166609 Ga0157375_101666093 319
438 3300025900 Ga0207710_10044755 Ga0207710_100447552 319
439 3300025914 Ga0207671_10251253 Ga0207671_102512532 319
440 3300025924 Ga0207694_10114285 Ga0207694_101142852 319
441 3300025986 Ga0207658_10253001 Ga0207658_102530012 319
442 3300026035 Ga0207703_10001507 Ga0207703_1000150715 319
443 3300026078 Ga0207702_10084062 Ga0207702_100840621 319
444 3300026116 Ga0207674_10004655 Ga0207674_100046555 319

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

66

329

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4di9-assembly1.cif.gz_A crystal structure of the d248a mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 6.5 0.9214 28 314
4mup-assembly3.cif.gz_C crystal structure of agrobacterium tumefaciens atu3138 (efi target 505157), apo structure 0.9124 41 318
4dia-assembly1.cif.gz_A crystal structure of the d248n mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 4.6 0.9089 32 314
4mup-assembly3.cif.gz_C crystal structure of agrobacterium tumefaciens atu3138 (efi target 505157), apo structure 0.9061 41 318
4mup-assembly1.cif.gz_A crystal structure of agrobacterium tumefaciens atu3138 (efi target 505157), apo structure 0.9047 34 318
ID Description Score Start End Superfamily
4d95A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9247 28 314 3.20.20.140
4mupC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9124 41 318 3.20.20.140
4mupC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9061 41 318 3.20.20.140
4d95A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8825 28 314 3.20.20.140
2ffiA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8153 45 318 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A561JS93-F1-model_v4 deleted 0.9724 32 315
AF-A0A2T0P8R3-F1-model_v4 deleted 0.9722 55 316
AF-A0A6B2R150-F1-model_v4 Amidohydrolase family protein 0.9721 43 318 GO:0016787
AF-I8I3V5-F1-model_v4 Amidohydrolase 2 0.9719 94 319 GO:0016787
AF-A0A176Z937-F1-model_v4 2-pyrone-4,6-dicarboxylate hydrolase 0.9713 33 317 GO:0016787

Feature Viewer

pLDDT pTM Quality
88.23 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map