F445267
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 444 | 244 | 427 | 321 |
Family's Representative Sequence
| Representative Sequence | 3300009092|Ga0105250_10000029|Ga0105250_10000029112 |
| Length | 373 |
| Sequence | LLDHHRKCSNLGLALPLKSTYHSIDPQEAYLCEWRIRRHDYTGTSDRAEGKMLMSVASKLANRLRLPVIAAPLFLVSGPDLVINCCKEGVVGTFPSLNLRTAEAFEGWLIQIKTALASYDAEHPKAPSAPFGVNIIAHKTNKRLDEDMGLVEKHQVPIVITSVGNPSEIVKTVHGYGGLVFHDVTTPLWAKKAIAAGVDGIILVCGGAGGHAGLINPFAFVPQVREFYDGALLLAGCVSDGRSIHAAQALGADFAYIGTKFIATTESMASDAYKQMLVDSGPTDLVYTPAFSGIPANMLRQSIIDNGMDPDRLPSKDHIDLGEEFNHEAKAWRDIWTAGQGVGAIHDVRPVRDVIEQLKREYFASKEGTRRSQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 2 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 3 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 4 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 5 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 6 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 7 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 8 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 9 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 10 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 11 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 12 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 13 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 14 | 3001892409 | Neobacillus rhizophilus FJAT-49825 | Isolate | Rhizosphere |
| 15 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 16 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 17 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 18 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 19 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 20 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 21 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 68 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 69 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 84 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 122 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 127 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 128 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 129 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 130 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 131 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 133 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 134 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 135 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 136 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 137 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 138 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 139 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 140 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 141 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 142 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 143 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 144 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 146 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 147 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 148 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 149 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 150 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 151 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 152 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 153 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 154 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 155 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 156 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 157 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 158 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 159 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 160 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 161 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 162 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 163 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 164 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 165 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 184 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 185 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 186 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 187 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 188 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 191 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 192 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 193 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 194 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 195 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 196 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 197 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 198 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 199 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 200 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 201 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 202 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 203 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 204 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 205 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 206 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 207 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 208 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 209 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 216 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 217 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 218 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 219 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 220 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 221 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 222 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 223 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 224 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 225 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 226 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 227 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 228 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 229 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 230 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 233 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 234 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 235 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 236 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 237 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 238 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 239 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 240 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 241 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 242 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 243 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
| 244 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.17 |
| Metatranscriptomes | 0 |
| Isolates | 3.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.18 |
| Nodule | 1.13 |
| Rhizoplane | 3.38 |
| Rhizosphere | 81.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24748J21848_1001425 | 3300002074 | Bacteria | 2627 |
| 2 | JGI24034J26672_10005569 | 3300002239 | Bacteria | 1806 |
| 3 | JGI24751J29686_10000084 | 3300002459 | Bacteria | 52362 |
| 4 | JGI24751J29686_10000964 | 3300002459 | Bacteria | 6337 |
| 5 | JGI25151J46595_10000254 | 3300003187 | Bacteria | 62429 |
| 6 | JGI25151J46595_10008014 | 3300003187 | Bacteria | 5122 |
| 7 | rootL2_10034672 | 3300003322 | Bacteria | 4908 |
| 8 | rootL2_10141192 | 3300003322 | Bacteria | 1895 |
| 9 | Ga0055529_1001556 | 3300003763 | Bacteria | 6471 |
| 10 | Ga0055531_10002410 | 3300003794 | Bacteria | 12551 |
| 11 | Ga0065704_10127118 | 3300005289 | Unclassified | 1680 |
| 12 | Ga0065715_10089715 | 3300005293 | Bacteria | 8773 |
| 13 | Ga0065707_10002266 | 3300005295 | Bacteria | 8464 |
| 14 | Ga0065707_10031194 | 3300005295 | Bacteria | 1462 |
| 15 | Ga0065707_10084019 | 3300005295 | Bacteria | 7816 |
| 16 | Ga0070658_10009711 | 3300005327 | Bacteria | 7726 |
| 17 | Ga0070658_10046890 | 3300005327 | Bacteria | 3496 |
| 18 | Ga0070658_10174274 | 3300005327 | Bacteria | 1808 |
| 19 | Ga0070676_10015937 | 3300005328 | Bacteria | 4148 |
| 20 | Ga0070683_100007757 | 3300005329 | Bacteria | 9088 |
| 21 | Ga0070690_100158905 | 3300005330 | Bacteria | 1547 |
| 22 | Ga0070670_100077680 | 3300005331 | Bacteria | 2852 |
| 23 | Ga0070677_10004231 | 3300005333 | Bacteria | 4674 |
| 24 | Ga0070666_10007821 | 3300005335 | Bacteria | 6602 |
| 25 | Ga0070666_10165239 | 3300005335 | Unclassified | 1548 |
| 26 | Ga0070680_100053641 | 3300005336 | Bacteria | 3291 |
| 27 | Ga0070660_100050854 | 3300005339 | Bacteria | 3189 |
| 28 | Ga0070660_100069080 | 3300005339 | Bacteria | 2754 |
| 29 | Ga0070661_100055710 | 3300005344 | Bacteria | 2895 |
| 30 | Ga0070692_10030862 | 3300005345 | Bacteria | 2683 |
| 31 | Ga0070668_100000378 | 3300005347 | Bacteria | 29470 |
| 32 | Ga0070668_100050894 | 3300005347 | Bacteria | 3191 |
| 33 | Ga0070668_100072270 | 3300005347 | Bacteria | 2688 |
| 34 | Ga0070669_100015974 | 3300005353 | Bacteria | 5357 |
| 35 | Ga0070669_100138922 | 3300005353 | Bacteria | 1871 |
| 36 | Ga0070671_100000063 | 3300005355 | Bacteria | 72834 |
| 37 | Ga0070671_100053827 | 3300005355 | Bacteria | 3345 |
| 38 | Ga0070674_100042317 | 3300005356 | Bacteria | 3093 |
| 39 | Ga0070659_100072225 | 3300005366 | Bacteria | 2745 |
| 40 | Ga0070659_100142302 | 3300005366 | Bacteria | 1953 |
| 41 | Ga0070667_100000145 | 3300005367 | Bacteria | 89528 |
| 42 | Ga0070667_100001147 | 3300005367 | Bacteria | 24025 |
| 43 | Ga0070667_100017434 | 3300005367 | Bacteria | 5952 |
| 44 | Ga0070667_100101350 | 3300005367 | Bacteria | 2487 |
| 45 | Ga0070694_100014116 | 3300005444 | Bacteria | 4999 |
| 46 | Ga0070663_100001996 | 3300005455 | Bacteria | 11392 |
| 47 | Ga0070663_100269137 | 3300005455 | Bacteria | 1354 |
| 48 | Ga0070662_100011928 | 3300005457 | Bacteria | 5745 |
| 49 | Ga0070662_100180836 | 3300005457 | Bacteria | 1662 |
| 50 | Ga0070681_10002051 | 3300005458 | Bacteria | 18267 |
| 51 | Ga0070681_10184987 | 3300005458 | Bacteria | 2004 |
| 52 | Ga0070684_100114847 | 3300005535 | Bacteria | 2417 |
| 53 | Ga0070695_100044550 | 3300005545 | Bacteria | 2825 |
| 54 | Ga0070693_100094428 | 3300005547 | Bacteria | 1809 |
| 55 | Ga0070665_100188906 | 3300005548 | Bacteria | 2061 |
| 56 | Ga0070665_100284735 | 3300005548 | Bacteria | 1655 |
| 57 | Ga0068855_100005574 | 3300005563 | Bacteria | 15362 |
| 58 | Ga0068855_100045610 | 3300005563 | Bacteria | 5184 |
| 59 | Ga0068855_100070112 | 3300005563 | Bacteria | 4079 |
| 60 | Ga0068855_100097806 | 3300005563 | Bacteria | 3381 |
| 61 | Ga0068854_100007618 | 3300005578 | Bacteria | 6924 |
| 62 | Ga0068856_100033987 | 3300005614 | Bacteria | 4993 |
| 63 | Ga0068856_100048304 | 3300005614 | Bacteria | 4193 |
| 64 | Ga0068856_100170121 | 3300005614 | Bacteria | 2191 |
| 65 | Ga0068852_100060863 | 3300005616 | Bacteria | 3279 |
| 66 | Ga0068852_100094763 | 3300005616 | Bacteria | 2679 |
| 67 | Ga0068859_100010870 | 3300005617 | Bacteria | 9159 |
| 68 | Ga0068859_100061424 | 3300005617 | Bacteria | 3786 |
| 69 | Ga0068864_100011182 | 3300005618 | Bacteria | 7417 |
| 70 | Ga0068864_100014840 | 3300005618 | Bacteria | 6473 |
| 71 | Ga0068864_100035398 | 3300005618 | Bacteria | 4251 |
| 72 | Ga0068861_100005587 | 3300005719 | Bacteria | 8524 |
| 73 | Ga0068863_100000723 | 3300005841 | Bacteria | 33109 |
| 74 | Ga0068863_100000879 | 3300005841 | Bacteria | 30177 |
| 75 | Ga0068863_100001090 | 3300005841 | Bacteria | 27124 |
| 76 | Ga0068863_100003202 | 3300005841 | Bacteria | 16195 |
| 77 | Ga0068863_100105523 | 3300005841 | Bacteria | 2680 |
| 78 | Ga0068863_100188783 | 3300005841 | Bacteria | 1980 |
| 79 | Ga0068858_100001621 | 3300005842 | Bacteria | 22962 |
| 80 | Ga0068858_100031035 | 3300005842 | Bacteria | 4963 |
| 81 | Ga0068860_100000942 | 3300005843 | Bacteria | 32259 |
| 82 | Ga0068860_100010487 | 3300005843 | Bacteria | 9158 |
| 83 | Ga0068860_100020207 | 3300005843 | Bacteria | 6454 |
| 84 | Ga0068860_100023541 | 3300005843 | Bacteria | 5952 |
| 85 | Ga0068860_100160958 | 3300005843 | Bacteria | 2164 |
| 86 | Ga0068860_100520570 | 3300005843 | Bacteria | 1189 |
| 87 | Ga0068862_100004956 | 3300005844 | Bacteria | 11212 |
| 88 | Ga0081455_10010851 | 3300005937 | Bacteria | 9197 |
| 89 | Ga0070712_100057586 | 3300006175 | Bacteria | 2731 |
| 90 | Ga0070712_100221655 | 3300006175 | Bacteria | 1498 |
| 91 | Ga0075366_10019960 | 3300006195 | Bacteria | 3884 |
| 92 | Ga0075428_100160286 | 3300006844 | Bacteria | 2442 |
| 93 | Ga0097620_100010871 | 3300006931 | Bacteria | 9159 |
| 94 | Ga0097620_100061421 | 3300006931 | Bacteria | 3786 |
| 95 | Ga0099823_1001313 | 3300006944 | Bacteria | 20187 |
| 96 | Ga0099794_10138403 | 3300007265 | Unclassified | 1232 |
| 97 | Ga0105250_10000029 | 3300009092 | Bacteria | 180331 |
| 98 | Ga0105240_10003877 | 3300009093 | Bacteria | 23099 |
| 99 | Ga0105243_10157747 | 3300009148 | Bacteria | 1953 |
| 100 | Ga0105248_10131246 | 3300009177 | Bacteria | 2827 |
| 101 | Ga0105248_10131600 | 3300009177 | Bacteria | 2822 |
| 102 | Ga0105248_10713608 | 3300009177 | Bacteria | 1131 |
| 103 | Ga0105238_10129088 | 3300009551 | Bacteria | 2506 |
| 104 | Ga0105249_10008804 | 3300009553 | Bacteria | 8810 |
| 105 | Ga0105249_10110638 | 3300009553 | Bacteria | 2596 |
| 106 | Ga0105249_10249860 | 3300009553 | Bacteria | 1758 |
| 107 | Ga0157373_10005394 | 3300013100 | Bacteria | 9604 |
| 108 | Ga0157373_10082246 | 3300013100 | Bacteria | 2270 |
| 109 | Ga0157371_10008644 | 3300013102 | Bacteria | 8091 |
| 110 | Ga0157371_10016732 | 3300013102 | Bacteria | 5464 |
| 111 | Ga0157371_10032979 | 3300013102 | Bacteria | 3723 |
| 112 | Ga0157369_10240313 | 3300013105 | Bacteria | 1892 |
| 113 | Ga0157374_10247691 | 3300013296 | Bacteria | 1753 |
| 114 | Ga0163162_10013412 | 3300013306 | Bacteria | 8001 |
| 115 | Ga0163162_10014423 | 3300013306 | Bacteria | 7723 |
| 116 | Ga0157372_10044590 | 3300013307 | Bacteria | 4915 |
| 117 | Ga0157380_10000486 | 3300014326 | Bacteria | 24146 |
| 118 | Ga0157379_10000433 | 3300014968 | Bacteria | 33887 |
| 119 | Ga0183365_10004 | 3300015684 | Bacteria | 333304 |
| 120 | Ga0207672_1002161 | 3300025223 | Bacteria | 1234 |
| 121 | Ga0209672_104071 | 3300025228 | Bacteria | 2816 |
| 122 | Ga0209455_1000566 | 3300025272 | Bacteria | 24635 |
| 123 | Ga0209130_1023547 | 3300025284 | Bacteria | 1356 |
| 124 | Ga0209025_1000003 | 3300025294 | Bacteria | 1366495 |
| 125 | Ga0209025_1000113 | 3300025294 | Bacteria | 218943 |
| 126 | Ga0209257_1000130 | 3300025304 | Bacteria | 212188 |
| 127 | Ga0207696_1000150 | 3300025711 | Bacteria | 120372 |
| 128 | Ga0207680_10005706 | 3300025903 | Bacteria | 5963 |
| 129 | Ga0207680_10014274 | 3300025903 | Bacteria | 4105 |
| 130 | Ga0207680_10113710 | 3300025903 | Bacteria | 1760 |
| 131 | Ga0207647_10081285 | 3300025904 | Bacteria | 1942 |
| 132 | Ga0207705_10003893 | 3300025909 | Bacteria | 11358 |
| 133 | Ga0207705_10023911 | 3300025909 | Bacteria | 4360 |
| 134 | Ga0207705_10120232 | 3300025909 | Bacteria | 1948 |
| 135 | Ga0207707_10084997 | 3300025912 | Bacteria | 2764 |
| 136 | Ga0207707_10157931 | 3300025912 | Bacteria | 1983 |
| 137 | Ga0207695_10283589 | 3300025913 | Bacteria | 1550 |
| 138 | Ga0207693_10375103 | 3300025915 | Bacteria | 1113 |
| 139 | Ga0207660_10076283 | 3300025917 | Bacteria | 2451 |
| 140 | Ga0207657_10000553 | 3300025919 | Bacteria | 39885 |
| 141 | Ga0207657_10005822 | 3300025919 | Bacteria | 12839 |
| 142 | Ga0207657_10119756 | 3300025919 | Bacteria | 2166 |
| 143 | Ga0207657_10156183 | 3300025919 | Bacteria | 1855 |
| 144 | Ga0207652_10077776 | 3300025921 | Bacteria | 2896 |
| 145 | Ga0207681_10043239 | 3300025923 | Bacteria | 3014 |
| 146 | Ga0207681_10238308 | 3300025923 | Bacteria | 1415 |
| 147 | Ga0207650_10024234 | 3300025925 | Bacteria | 4311 |
| 148 | Ga0207644_10000075 | 3300025931 | Bacteria | 72848 |
| 149 | Ga0207644_10005717 | 3300025931 | Bacteria | 8095 |
| 150 | Ga0207644_10223553 | 3300025931 | Bacteria | 1493 |
| 151 | Ga0207690_10017465 | 3300025932 | Bacteria | 4380 |
| 152 | Ga0207690_10272462 | 3300025932 | Bacteria | 1315 |
| 153 | Ga0207706_10001551 | 3300025933 | Bacteria | 22762 |
| 154 | Ga0207706_10255253 | 3300025933 | Bacteria | 1531 |
| 155 | Ga0207669_10082962 | 3300025937 | Bacteria | 2059 |
| 156 | Ga0207711_10153616 | 3300025941 | Bacteria | 2079 |
| 157 | Ga0207679_10150313 | 3300025945 | Bacteria | 1894 |
| 158 | Ga0207667_10004924 | 3300025949 | Bacteria | 16311 |
| 159 | Ga0207667_10067632 | 3300025949 | Bacteria | 3721 |
| 160 | Ga0207667_10082347 | 3300025949 | Bacteria | 3334 |
| 161 | Ga0207668_10000022 | 3300025972 | Bacteria | 135782 |
| 162 | Ga0207668_10000416 | 3300025972 | Bacteria | 26868 |
| 163 | Ga0207668_10093534 | 3300025972 | Bacteria | 2215 |
| 164 | Ga0207658_10000021 | 3300025986 | Bacteria | 201456 |
| 165 | Ga0207658_10000103 | 3300025986 | Bacteria | 93261 |
| 166 | Ga0207658_10000639 | 3300025986 | Bacteria | 30807 |
| 167 | Ga0207658_10227609 | 3300025986 | Unclassified | 1572 |
| 168 | Ga0207703_10001299 | 3300026035 | Bacteria | 23105 |
| 169 | Ga0207703_10413257 | 3300026035 | Unclassified | 1254 |
| 170 | Ga0207678_10003655 | 3300026067 | Bacteria | 13817 |
| 171 | Ga0207708_10114884 | 3300026075 | Bacteria | 2093 |
| 172 | Ga0207702_10121876 | 3300026078 | Bacteria | 2335 |
| 173 | Ga0207641_10000040 | 3300026088 | Bacteria | 192446 |
| 174 | Ga0207641_10000344 | 3300026088 | Bacteria | 55824 |
| 175 | Ga0207641_10057722 | 3300026088 | Bacteria | 3301 |
| 176 | Ga0207641_10059935 | 3300026088 | Bacteria | 3243 |
| 177 | Ga0207641_10164374 | 3300026088 | Bacteria | 2020 |
| 178 | Ga0207676_10005543 | 3300026095 | Bacteria | 8932 |
| 179 | Ga0207676_10132263 | 3300026095 | Bacteria | 2123 |
| 180 | Ga0207674_10081914 | 3300026116 | Bacteria | 3229 |
| 181 | Ga0207675_100034684 | 3300026118 | Bacteria | 4706 |
| 182 | Ga0207683_10224928 | 3300026121 | Bacteria | 1710 |
| 183 | Ga0207698_10065767 | 3300026142 | Bacteria | 2850 |
| 184 | Ga0207698_10275417 | 3300026142 | Bacteria | 1553 |
| 185 | Ga0209389_1000054 | 3300027296 | Bacteria | 108815 |
| 186 | Ga0209983_1024233 | 3300027665 | Bacteria | 1276 |
| 187 | Ga0268266_10234457 | 3300028379 | Bacteria | 1691 |
| 188 | Ga0268265_10000808 | 3300028380 | Bacteria | 29755 |
| 189 | Ga0268265_10135584 | 3300028380 | Bacteria | 2053 |
| 190 | Ga0268264_10000214 | 3300028381 | Bacteria | 114177 |
| 191 | Ga0268264_10000351 | 3300028381 | Bacteria | 69834 |
| 192 | Ga0268264_10032223 | 3300028381 | Bacteria | 4300 |
| 193 | Ga0268264_10076748 | 3300028381 | Bacteria | 2844 |
| 194 | Ga0268264_10108028 | 3300028381 | Bacteria | 2432 |
| 195 | Ga0268264_10132201 | 3300028381 | Bacteria | 2214 |
| 196 | Ga0268264_10181111 | 3300028381 | Bacteria | 1914 |
| 197 | Ga0268264_10386004 | 3300028381 | Bacteria | 1342 |
| 198 | Ga0265338_10126699 | 3300028800 | Bacteria | 2024 |
| 199 | Ga0265330_10046353 | 3300031235 | Bacteria | 1915 |
| 200 | Ga0265328_10031391 | 3300031239 | Bacteria | 1974 |
| 201 | Ga0265331_10145771 | 3300031250 | Bacteria | 1076 |
| 202 | Ga0307408_100009214 | 3300031548 | Bacteria | 6508 |
| 203 | Ga0307408_100199850 | 3300031548 | Bacteria | 1617 |
| 204 | Ga0307408_100229679 | 3300031548 | Bacteria | 1519 |
| 205 | Ga0307405_10000277 | 3300031731 | Bacteria | 18938 |
| 206 | Ga0307405_10002071 | 3300031731 | Bacteria | 8734 |
| 207 | Ga0307405_10026792 | 3300031731 | Bacteria | 3331 |
| 208 | Ga0307405_10064146 | 3300031731 | Bacteria | 2333 |
| 209 | Ga0307413_10001575 | 3300031824 | Bacteria | 8783 |
| 210 | Ga0307413_10016889 | 3300031824 | Bacteria | 3787 |
| 211 | Ga0307413_10017716 | 3300031824 | Bacteria | 3717 |
| 212 | Ga0307413_10025357 | 3300031824 | Bacteria | 3249 |
| 213 | Ga0307413_10093521 | 3300031824 | Bacteria | 1965 |
| 214 | Ga0307413_10104722 | 3300031824 | Bacteria | 1879 |
| 215 | Ga0307413_10211140 | 3300031824 | Bacteria | 1410 |
| 216 | Ga0307410_10000955 | 3300031852 | Bacteria | 12399 |
| 217 | Ga0307410_10001610 | 3300031852 | Bacteria | 10362 |
| 218 | Ga0307410_10018918 | 3300031852 | Bacteria | 4176 |
| 219 | Ga0307410_10026028 | 3300031852 | Bacteria | 3677 |
| 220 | Ga0307410_10026238 | 3300031852 | Bacteria | 3665 |
| 221 | Ga0307410_10037420 | 3300031852 | Bacteria | 3169 |
| 222 | Ga0307410_10067165 | 3300031852 | Bacteria | 2473 |
| 223 | Ga0307410_10126408 | 3300031852 | Bacteria | 1872 |
| 224 | Ga0307406_10082011 | 3300031901 | Bacteria | 2146 |
| 225 | Ga0307406_10239003 | 3300031901 | Bacteria | 1361 |
| 226 | Ga0307407_10017979 | 3300031903 | Bacteria | 3562 |
| 227 | Ga0307407_10022660 | 3300031903 | Bacteria | 3264 |
| 228 | Ga0307407_10044802 | 3300031903 | Bacteria | 2496 |
| 229 | Ga0307407_10089700 | 3300031903 | Bacteria | 1881 |
| 230 | Ga0307407_10386717 | 3300031903 | Bacteria | 1000 |
| 231 | Ga0307412_10009717 | 3300031911 | Bacteria | 5525 |
| 232 | Ga0307412_10013657 | 3300031911 | Bacteria | 4770 |
| 233 | Ga0307412_10056030 | 3300031911 | Bacteria | 2625 |
| 234 | Ga0307412_10354414 | 3300031911 | Bacteria | 1179 |
| 235 | Ga0307409_100000527 | 3300031995 | Bacteria | 16577 |
| 236 | Ga0307409_100000928 | 3300031995 | Bacteria | 13639 |
| 237 | Ga0307409_100012135 | 3300031995 | Bacteria | 5474 |
| 238 | Ga0307409_100014023 | 3300031995 | Bacteria | 5191 |
| 239 | Ga0307409_100075583 | 3300031995 | Bacteria | 2698 |
| 240 | Ga0307409_100327407 | 3300031995 | Bacteria | 1436 |
| 241 | Ga0307416_100009961 | 3300032002 | Bacteria | 6254 |
| 242 | Ga0307416_100016512 | 3300032002 | Bacteria | 5134 |
| 243 | Ga0307416_100018674 | 3300032002 | Bacteria | 4893 |
| 244 | Ga0307416_100056925 | 3300032002 | Bacteria | 3159 |
| 245 | Ga0307416_100065836 | 3300032002 | Bacteria | 2980 |
| 246 | Ga0307416_100167043 | 3300032002 | Bacteria | 2042 |
| 247 | Ga0307416_100175941 | 3300032002 | Bacteria | 1999 |
| 248 | Ga0307416_100295608 | 3300032002 | Bacteria | 1606 |
| 249 | Ga0307416_100415426 | 3300032002 | Bacteria | 1387 |
| 250 | Ga0307414_10002424 | 3300032004 | Bacteria | 9752 |
| 251 | Ga0307414_10018787 | 3300032004 | Bacteria | 4266 |
| 252 | Ga0307414_10034909 | 3300032004 | Bacteria | 3340 |
| 253 | Ga0307414_10115317 | 3300032004 | Bacteria | 2054 |
| 254 | Ga0307414_10269036 | 3300032004 | Bacteria | 1426 |
| 255 | Ga0307414_10370931 | 3300032004 | Bacteria | 1234 |
| 256 | Ga0307414_10454318 | 3300032004 | Bacteria | 1124 |
| 257 | Ga0307411_10000789 | 3300032005 | Bacteria | 11762 |
| 258 | Ga0307411_10002364 | 3300032005 | Bacteria | 8297 |
| 259 | Ga0307411_10003274 | 3300032005 | Bacteria | 7475 |
| 260 | Ga0307411_10008735 | 3300032005 | Bacteria | 5269 |
| 261 | Ga0307411_10010123 | 3300032005 | Bacteria | 5006 |
| 262 | Ga0307411_10013756 | 3300032005 | Bacteria | 4479 |
| 263 | Ga0307411_10030356 | 3300032005 | Bacteria | 3312 |
| 264 | Ga0307411_10039958 | 3300032005 | Bacteria | 2972 |
| 265 | Ga0307411_10044772 | 3300032005 | Bacteria | 2841 |
| 266 | Ga0307411_10056401 | 3300032005 | Bacteria | 2589 |
| 267 | Ga0307411_10075516 | 3300032005 | Bacteria | 2301 |
| 268 | Ga0307411_10345356 | 3300032005 | Bacteria | 1211 |
| 269 | Ga0307415_100005302 | 3300032126 | Bacteria | 6826 |
| 270 | Ga0307415_100018792 | 3300032126 | Bacteria | 4183 |
| 271 | Ga0307415_100034044 | 3300032126 | Bacteria | 3312 |
| 272 | Ga0307415_100080324 | 3300032126 | Bacteria | 2326 |
| 273 | Ga0307415_100099534 | 3300032126 | Bacteria | 2128 |
| 274 | Ga0307415_100101909 | 3300032126 | Bacteria | 2108 |
| 275 | Ga0307415_100204322 | 3300032126 | Bacteria | 1570 |
| 276 | Ga0307415_100258368 | 3300032126 | Bacteria | 1419 |
| 277 | Ga0373924_0034441 | 3300035410 | Bacteria | 2050 |
| 278 | Ga0373931_0042017 | 3300035691 | Bacteria | 2403 |
| 279 | Ga0373937_0053865 | 3300036401 | Bacteria | 3690 |
| 280 | Ga0373925_0013194 | 3300037068 | Bacteria | 5981 |
| 281 | Ga0395899_0000625 | 3300037312 | Bacteria | 36841 |
| 282 | Ga0395899_0054410 | 3300037312 | Bacteria | 2961 |
| 283 | Ga0395899_0229826 | 3300037312 | Bacteria | 1281 |
| 284 | Ga0395900_0000368 | 3300037418 | Bacteria | 64936 |
| 285 | Ga0395900_0000487 | 3300037418 | Bacteria | 56286 |
| 286 | Ga0395900_0011655 | 3300037418 | Bacteria | 8994 |
| 287 | Ga0395900_0017485 | 3300037418 | Bacteria | 7319 |
| 288 | Ga0395900_0190817 | 3300037418 | Bacteria | 2078 |
| 289 | Ga0395900_0345641 | 3300037418 | Bacteria | 1462 |
| 290 | Ga0395898_0089142 | 3300037466 | Bacteria | 2969 |
| 291 | Ga0395898_0093082 | 3300037466 | Bacteria | 2897 |
| 292 | Ga0395898_0226724 | 3300037466 | Bacteria | 1782 |
| 293 | Ga0395905_0000136 | 3300037471 | Bacteria | 121009 |
| 294 | Ga0395905_0000165 | 3300037471 | Bacteria | 109385 |
| 295 | Ga0395905_0058635 | 3300037471 | Bacteria | 3600 |
| 296 | Ga0395905_0080946 | 3300037471 | Bacteria | 3044 |
| 297 | Ga0395905_0083359 | 3300037471 | Bacteria | 2995 |
| 298 | Ga0395905_0107100 | 3300037471 | Bacteria | 2624 |
| 299 | Ga0395905_0206767 | 3300037471 | Bacteria | 1840 |
| 300 | Ga0436364_0553893 | 3300037853 | Bacteria | 1234 |
| 301 | Ga0395901_0000064 | 3300038443 | Bacteria | 147477 |
| 302 | Ga0395901_0000726 | 3300038443 | Bacteria | 37460 |
| 303 | Ga0395901_0240740 | 3300038443 | Bacteria | 1887 |
| 304 | Ga0395901_0241730 | 3300038443 | Bacteria | 1883 |
| 305 | Ga0395901_0273428 | 3300038443 | Bacteria | 1757 |
| 306 | Ga0400483_072280 | 3300039062 | Bacteria | 5533 |
| 307 | Ga0400483_075161 | 3300039062 | Bacteria | 103046 |
| 308 | Ga0400483_105415 | 3300039062 | Bacteria | 25489 |
| 309 | Ga0400483_107214 | 3300039062 | Bacteria | 7059 |
| 310 | Ga0400483_157736 | 3300039062 | Bacteria | 6853 |
| 311 | Ga0400483_194331 | 3300039062 | Bacteria | 23045 |
| 312 | Ga0400483_227307 | 3300039062 | Bacteria | 4577 |
| 313 | Ga0400483_265160 | 3300039062 | Bacteria | 2242 |
| 314 | Ga0436365_0969411 | 3300039437 | Bacteria | 2143 |
| 315 | Ga0451853_3155702 | 3300041512 | Bacteria | 1294 |
| 316 | Ga0466969_0000553 | 3300044656 | Bacteria | 20545 |
| 317 | Ga0466965_0105328 | 3300044683 | Bacteria | 1446 |
| 318 | Ga0466966_0000701 | 3300044684 | Bacteria | 21320 |
| 319 | Ga0466966_0020323 | 3300044684 | Bacteria | 4368 |
| 320 | Ga0466961_0002006 | 3300044693 | Bacteria | 12657 |
| 321 | Ga0466971_0000434 | 3300044719 | Bacteria | 16357 |
| 322 | Ga0466970_0002099 | 3300044765 | Bacteria | 9625 |
| 323 | Ga0466970_0082384 | 3300044765 | Bacteria | 1740 |
| 324 | Ga0466957_0000699 | 3300044842 | Bacteria | 17153 |
| 325 | Ga0466959_0000100 | 3300045049 | Bacteria | 54979 |
| 326 | Ga0466959_0109064 | 3300045049 | Bacteria | 1977 |
| 327 | Ga0466958_0007763 | 3300045836 | Bacteria | 5919 |
| 328 | Ga0466967_0101058 | 3300045976 | Bacteria | 2635 |
| 329 | Ga0495627_000489 | 3300046453 | Bacteria | 33226 |
| 330 | Ga0495650_0015607 | 3300046471 | Bacteria | 3887 |
| 331 | Ga0495610_0000556 | 3300046512 | Bacteria | 37327 |
| 332 | Ga0495616_0030451 | 3300046513 | Bacteria | 2836 |
| 333 | Ga0495620_0000351 | 3300046515 | Bacteria | 31904 |
| 334 | Ga0495643_0000039 | 3300046522 | Bacteria | 235175 |
| 335 | Ga0495597_0000028 | 3300046542 | Bacteria | 137215 |
| 336 | Ga0495645_0095802 | 3300046543 | Bacteria | 2115 |
| 337 | Ga0495633_0152786 | 3300046558 | Bacteria | 1066 |
| 338 | Ga0495668_0000024 | 3300046616 | Bacteria | 359469 |
| 339 | Ga0495668_0016136 | 3300046616 | Bacteria | 4345 |
| 340 | Ga0495659_0021668 | 3300046664 | Bacteria | 2168 |
| 341 | Ga0495658_0061095 | 3300046683 | Bacteria | 2163 |
| 342 | Ga0495672_0008996 | 3300047320 | Bacteria | 7286 |
| 343 | Ga0495673_0059321 | 3300047469 | Bacteria | 1645 |
| 344 | Ga0495681_0000269 | 3300047470 | Bacteria | 41587 |
| 345 | Ga0495615_0000011 | 3300048090 | Bacteria | 65444 |
| 346 | Ga0496100_0045218 | 3300048903 | Bacteria | 2825 |
| 347 | Ga0496101_0021178 | 3300048904 | Bacteria | 4463 |
| 348 | Ga0496102_0555307 | 3300048905 | Bacteria | 1071 |
| 349 | Ga0496104_0003273 | 3300048907 | Bacteria | 13976 |
| 350 | Ga0496105_0031876 | 3300048908 | Bacteria | 4322 |
| 351 | Ga0496106_0001852 | 3300048909 | Bacteria | 15826 |
| 352 | Ga0496107_0001923 | 3300048910 | Bacteria | 13183 |
| 353 | Ga0496107_0138290 | 3300048910 | Bacteria | 1800 |
| 354 | Ga0496108_0081329 | 3300048911 | Bacteria | 2745 |
| 355 | Ga0496108_0276147 | 3300048911 | Bacteria | 1463 |
| 356 | Ga0496109_0522746 | 3300048912 | Bacteria | 1120 |
| 357 | Ga0496112_0000224 | 3300048915 | Bacteria | 36869 |
| 358 | Ga0496113_0000456 | 3300048916 | Bacteria | 19887 |
| 359 | Ga0496114_0051712 | 3300048917 | Bacteria | 3421 |
| 360 | Ga0496115_0111435 | 3300048918 | Bacteria | 2248 |
| 361 | Ga0496117_0007760 | 3300048920 | Bacteria | 10363 |
| 362 | Ga0496118_0015971 | 3300048921 | Bacteria | 6915 |
| 363 | Ga0496119_0000562 | 3300048922 | Bacteria | 50080 |
| 364 | Ga0496120_0000122 | 3300048923 | Bacteria | 130209 |
| 365 | Ga0496121_0003153 | 3300048924 | Bacteria | 23785 |
| 366 | Ga0496121_0041765 | 3300048924 | Bacteria | 4003 |
| 367 | Ga0496121_0074298 | 3300048924 | Bacteria | 2720 |
| 368 | Ga0496122_0003557 | 3300048925 | Bacteria | 20365 |
| 369 | Ga0496123_0001182 | 3300048926 | Bacteria | 38436 |
| 370 | Ga0496123_0040630 | 3300048926 | Bacteria | 3236 |
| 371 | Ga0496124_0000007 | 3300048927 | Bacteria | 883534 |
| 372 | Ga0496124_0000273 | 3300048927 | Bacteria | 99505 |
| 373 | Ga0496124_0028325 | 3300048927 | Bacteria | 5013 |
| 374 | Ga0496124_0051145 | 3300048927 | Bacteria | 3516 |
| 375 | Ga0496125_0048198 | 3300048928 | Bacteria | 3555 |
| 376 | Ga0501290_002776 | 3300049513 | Bacteria | 2240 |
| 377 | Ga0501292_000001 | 3300049515 | Bacteria | 211592 |
| 378 | Ga0501293_001185 | 3300049516 | Bacteria | 1958 |
| 379 | Ga0501294_000918 | 3300049517 | Bacteria | 3160 |
| 380 | Ga0501297_002396 | 3300049520 | Bacteria | 1810 |
| 381 | Ga0501300_001437 | 3300049523 | Bacteria | 3567 |
| 382 | Ga0501033_0101958 | 3300049570 | Bacteria | 2094 |
| 383 | Ga0501033_0137577 | 3300049570 | Bacteria | 1767 |
| 384 | Ga0501034_0000050 | 3300049571 | Bacteria | 213092 |
| 385 | Ga0501034_0025425 | 3300049571 | Bacteria | 6028 |
| 386 | Ga0501034_0157725 | 3300049571 | Bacteria | 2242 |
| 387 | Ga0501034_0260901 | 3300049571 | Bacteria | 1675 |
| 388 | Ga0501038_0356546 | 3300049574 | Bacteria | 1138 |
| 389 | Ga0501043_0096021 | 3300049579 | Bacteria | 2330 |
| 390 | Ga0501046_0188343 | 3300049580 | Bacteria | 1540 |
| 391 | Ga0501047_0000176 | 3300049581 | Bacteria | 78742 |
| 392 | Ga0501047_0002464 | 3300049581 | Bacteria | 17651 |
| 393 | Ga0501206_001012 | 3300049653 | Bacteria | 3507 |
| 394 | Ga0501223_001012 | 3300049663 | Bacteria | 6639 |
| 395 | Ga0501224_000103 | 3300049664 | Bacteria | 9013 |
| 396 | Ga0501227_001743 | 3300049665 | Bacteria | 4824 |
| 397 | Ga0501233_001311 | 3300049668 | Bacteria | 4251 |
| 398 | Ga0501235_000098 | 3300049669 | Bacteria | 13771 |
| 399 | Ga0501257_000043 | 3300049686 | Bacteria | 36418 |
| 400 | Ga0501259_001065 | 3300049688 | Bacteria | 4585 |
| 401 | Ga0501261_000008 | 3300049690 | Bacteria | 58609 |
| 402 | Ga0501221_000797 | 3300049704 | Bacteria | 5108 |
| 403 | Ga0501225_0000622 | 3300049705 | Bacteria | 11051 |
| 404 | Ga0501279_000001 | 3300049775 | Bacteria | 299671 |
| 405 | Ga0501280_000600 | 3300049776 | Bacteria | 8256 |
| 406 | Ga0501280_001292 | 3300049776 | Bacteria | 4815 |
| 407 | Ga0501281_00043 | 3300049777 | Bacteria | 14744 |
| 408 | Ga0501282_000026 | 3300049778 | Bacteria | 20814 |
| 409 | Ga0501035_0008851 | 3300049822 | Bacteria | 9366 |
| 410 | Ga0501035_0010206 | 3300049822 | Bacteria | 8715 |
| 411 | Ga0501035_0022709 | 3300049822 | Bacteria | 5762 |
| 412 | Ga0501035_0273236 | 3300049822 | Bacteria | 1430 |
| 413 | Ga0501044_0000022 | 3300049823 | Bacteria | 201689 |
| 414 | Ga0501044_0024648 | 3300049823 | Bacteria | 6383 |
| 415 | nmdc:mga0yw44_1367_c2 | 3300050492 | Bacteria | 6429 |
| 416 | Ga0500635_0002879 | 3300053080 | Bacteria | 4278 |
| 417 | Ga0500643_000001 | 3300053087 | Bacteria | 1440111 |
| 418 | Ga0500641_0004502 | 3300053096 | Bacteria | 4925 |
| 419 | Ga0500594_0002137 | 3300053118 | Bacteria | 4274 |
| 420 | Ga0500608_001168 | 3300053122 | Bacteria | 9346 |
| 421 | Ga0500608_002285 | 3300053122 | Bacteria | 6938 |
| 422 | Ga0500559_0021172 | 3300053136 | Bacteria | 2754 |
| 423 | Ga0500559_0180315 | 3300053136 | Bacteria | 995 |
| 424 | Ga0500564_002986 | 3300053138 | Bacteria | 6436 |
| 425 | Ga0500568_0000207 | 3300053139 | Bacteria | 51335 |
| 426 | Ga0500625_000003 | 3300053729 | Bacteria | 268493 |
| 427 | Ga0466962_0004127 | 3300061719 | Bacteria | 6959 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025915 | Ga0207693_10375103 | Ga0207693_103751032 | 284 |
| 2 | 3300048926 | Ga0496123_0040630 | Ga0496123_0040630_2302_3189 | 291 |
| 3 | 3300049778 | Ga0501282_000026 | Ga0501282_000026_33_977 | 291 |
| 4 | 3300053136 | Ga0500559_0180315 | Ga0500559_0180315_74_973 | 292 |
| 5 | 3300003794 | Ga0055531_10002410 | Ga0055531_100024107 | 293 |
| 6 | 3300053139 | Ga0500568_0000207 | Ga0500568_0000207_26132_27094 | 295 |
| 7 | iso_pu_bacteria | 3001892409 | 3001897272 | 295 |
| 8 | 3300048924 | Ga0496121_0074298 | Ga0496121_0074298_1036_1941 | 296 |
| 9 | 3300044656 | Ga0466969_0000553 | Ga0466969_0000553_12936_13889 | 297 |
| 10 | 3300044684 | Ga0466966_0000701 | Ga0466966_0000701_1051_2004 | 297 |
| 11 | 3300044693 | Ga0466961_0002006 | Ga0466961_0002006_4063_5016 | 297 |
| 12 | 3300044719 | Ga0466971_0000434 | Ga0466971_0000434_12093_13046 | 297 |
| 13 | 3300044765 | Ga0466970_0002099 | Ga0466970_0002099_3947_4900 | 297 |
| 14 | 3300044842 | Ga0466957_0000699 | Ga0466957_0000699_12903_13856 | 297 |
| 15 | 3300045049 | Ga0466959_0000100 | Ga0466959_0000100_31206_32159 | 297 |
| 16 | 3300045836 | Ga0466958_0007763 | Ga0466958_0007763_3914_4867 | 297 |
| 17 | 3300049579 | Ga0501043_0096021 | Ga0501043_0096021_1381_2295 | 297 |
| 18 | 3300061719 | Ga0466962_0004127 | Ga0466962_0004127_4366_5319 | 297 |
| 19 | 3300049686 | Ga0501257_000043 | Ga0501257_000043_11561_12565 | 298 |
| 20 | 3300049776 | Ga0501280_001292 | Ga0501280_001292_2494_3498 | 298 |
| 21 | 3300005614 | Ga0068856_100048304 | Ga0068856_1000483045 | 299 |
| 22 | 3300026078 | Ga0207702_10121876 | Ga0207702_101218762 | 299 |
| 23 | 3300038443 | Ga0395901_0241730 | Ga0395901_0241730_339_1244 | 299 |
| 24 | 3300044683 | Ga0466965_0105328 | Ga0466965_0105328_91_999 | 300 |
| 25 | iso_pu_bacteria | 2643221598 | 2644002215 | 300 |
| 26 | 3300049570 | Ga0501033_0137577 | Ga0501033_0137577_301_1260 | 301 |
| 27 | 3300049581 | Ga0501047_0002464 | Ga0501047_0002464_16522_17481 | 301 |
| 28 | 3300049822 | Ga0501035_0008851 | Ga0501035_0008851_8224_9183 | 301 |
| 29 | 3300049823 | Ga0501044_0024648 | Ga0501044_0024648_763_1722 | 301 |
| 30 | 3300049580 | Ga0501046_0188343 | Ga0501046_0188343_429_1361 | 302 |
| 31 | 3300049581 | Ga0501047_0000176 | Ga0501047_0000176_61395_62327 | 302 |
| 32 | iso_pu_bacteria | 2854681122 | 2854684421 | 302 |
| 33 | 3300005618 | Ga0068864_100014840 | Ga0068864_1000148405 | 303 |
| 34 | 3300026088 | Ga0207641_10059935 | Ga0207641_100599352 | 303 |
| 35 | 3300053096 | Ga0500641_0004502 | Ga0500641_0004502_3501_4436 | 303 |
| 36 | 3300005841 | Ga0068863_100000879 | Ga0068863_1000008795 | 305 |
| 37 | 3300031250 | Ga0265331_10145771 | Ga0265331_101457711 | 305 |
| 38 | 3300031731 | Ga0307405_10000277 | Ga0307405_100002778 | 306 |
| 39 | iso_pu_bacteria | 2643221736 | 2644746565 | 306 |
| 40 | iso_pu_bacteria | 2851182111 | 2851182132 | 306 |
| 41 | iso_pu_bacteria | 2894772417 | 2894777084 | 306 |
| 42 | iso_pu_bacteria | 8057529695 | 8057535142 | 306 |
| 43 | 3300005563 | Ga0068855_100005574 | Ga0068855_1000055749 | 307 |
| 44 | 3300005563 | Ga0068855_100070112 | Ga0068855_1000701124 | 307 |
| 45 | 3300005616 | Ga0068852_100094763 | Ga0068852_1000947633 | 307 |
| 46 | 3300025949 | Ga0207667_10004924 | Ga0207667_1000492414 | 307 |
| 47 | 3300026142 | Ga0207698_10065767 | Ga0207698_100657672 | 307 |
| 48 | 3300031903 | Ga0307407_10386717 | Ga0307407_103867171 | 307 |
| 49 | iso_pu_bacteria | 2501025504 | 2501408712 | 307 |
| 50 | iso_pu_bacteria | 2510917014 | 2511098423 | 307 |
| 51 | 3300005327 | Ga0070658_10174274 | Ga0070658_101742741 | 308 |
| 52 | 3300013100 | Ga0157373_10082246 | Ga0157373_100822462 | 308 |
| 53 | 3300013105 | Ga0157369_10240313 | Ga0157369_102403132 | 308 |
| 54 | 3300013296 | Ga0157374_10247691 | Ga0157374_102476912 | 308 |
| 55 | 3300013307 | Ga0157372_10044590 | Ga0157372_100445902 | 308 |
| 56 | 3300025284 | Ga0209130_1023547 | Ga0209130_10235471 | 308 |
| 57 | 3300025304 | Ga0209257_1000130 | Ga0209257_100013051 | 309 |
| 58 | 3300028800 | Ga0265338_10126699 | Ga0265338_101266992 | 309 |
| 59 | 3300046513 | Ga0495616_0030451 | Ga0495616_0030451_1121_2062 | 309 |
| 60 | 3300046522 | Ga0495643_0000039 | Ga0495643_0000039_105692_106633 | 309 |
| 61 | 3300048090 | Ga0495615_0000011 | Ga0495615_0000011_34634_35575 | 309 |
| 62 | 3300048925 | Ga0496122_0003557 | Ga0496122_0003557_5721_6662 | 309 |
| 63 | 3300048926 | Ga0496123_0001182 | Ga0496123_0001182_23325_24266 | 309 |
| 64 | 3300048927 | Ga0496124_0028325 | Ga0496124_0028325_3328_4269 | 309 |
| 65 | 3300049571 | Ga0501034_0025425 | Ga0501034_0025425_131_1084 | 309 |
| 66 | 3300003322 | rootL2_10034672 | rootL2_100346726 | 310 |
| 67 | 3300005444 | Ga0070694_100014116 | Ga0070694_1000141163 | 310 |
| 68 | 3300005545 | Ga0070695_100044550 | Ga0070695_1000445503 | 310 |
| 69 | 3300035691 | Ga0373931_0042017 | Ga0373931_0042017_699_1676 | 310 |
| 70 | 3300037471 | Ga0395905_0000136 | Ga0395905_0000136_86482_87435 | 310 |
| 71 | 3300037471 | Ga0395905_0083359 | Ga0395905_0083359_204_1157 | 310 |
| 72 | 3300045049 | Ga0466959_0109064 | Ga0466959_0109064_581_1534 | 310 |
| 73 | 3300003322 | rootL2_10141192 | rootL2_101411921 | 311 |
| 74 | 3300015684 | Ga0183365_10004 | Ga0183365_10004156 | 311 |
| 75 | 3300049513 | Ga0501290_002776 | Ga0501290_002776_38_1042 | 311 |
| 76 | 3300049515 | Ga0501292_000001 | Ga0501292_000001_30774_31769 | 311 |
| 77 | 3300049516 | Ga0501293_001185 | Ga0501293_001185_827_1831 | 311 |
| 78 | 3300049517 | Ga0501294_000918 | Ga0501294_000918_946_1950 | 311 |
| 79 | 3300049520 | Ga0501297_002396 | Ga0501297_002396_371_1375 | 311 |
| 80 | 3300049523 | Ga0501300_001437 | Ga0501300_001437_458_1453 | 311 |
| 81 | 3300049570 | Ga0501033_0101958 | Ga0501033_0101958_549_1505 | 311 |
| 82 | 3300049571 | Ga0501034_0157725 | Ga0501034_0157725_397_1353 | 311 |
| 83 | 3300049653 | Ga0501206_001012 | Ga0501206_001012_2003_2998 | 311 |
| 84 | 3300049663 | Ga0501223_001012 | Ga0501223_001012_5496_6500 | 311 |
| 85 | 3300049664 | Ga0501224_000103 | Ga0501224_000103_4840_5844 | 311 |
| 86 | 3300049665 | Ga0501227_001743 | Ga0501227_001743_3577_4572 | 311 |
| 87 | 3300049668 | Ga0501233_001311 | Ga0501233_001311_1636_2640 | 311 |
| 88 | 3300049669 | Ga0501235_000098 | Ga0501235_000098_4765_5769 | 311 |
| 89 | 3300049688 | Ga0501259_001065 | Ga0501259_001065_2648_3643 | 311 |
| 90 | 3300049690 | Ga0501261_000008 | Ga0501261_000008_46580_47575 | 311 |
| 91 | 3300049704 | Ga0501221_000797 | Ga0501221_000797_1443_2447 | 311 |
| 92 | 3300049705 | Ga0501225_0000622 | Ga0501225_0000622_8806_9810 | 311 |
| 93 | 3300049775 | Ga0501279_000001 | Ga0501279_000001_30636_31631 | 311 |
| 94 | 3300049776 | Ga0501280_000600 | Ga0501280_000600_4796_5800 | 311 |
| 95 | 3300049777 | Ga0501281_00043 | Ga0501281_00043_8987_9991 | 311 |
| 96 | 3300049822 | Ga0501035_0010206 | Ga0501035_0010206_6714_7673 | 311 |
| 97 | 3300053080 | Ga0500635_0002879 | Ga0500635_0002879_3263_4210 | 311 |
| 98 | 3300053118 | Ga0500594_0002137 | Ga0500594_0002137_34_1023 | 311 |
| 99 | iso_pu_bacteria | 2881412998 | 2881413975 | 311 |
| 100 | 3300007265 | Ga0099794_10138403 | Ga0099794_101384031 | 312 |
| 101 | 3300047320 | Ga0495672_0008996 | Ga0495672_0008996_4076_5041 | 312 |
| 102 | 3300049571 | Ga0501034_0260901 | Ga0501034_0260901_159_1118 | 312 |
| 103 | 3300053122 | Ga0500608_002285 | Ga0500608_002285_3658_4617 | 312 |
| 104 | iso_pu_bacteria | 2857542790 | 2857544435 | 313 |
| 105 | iso_pu_bacteria | 3007619802 | 3007625558 | 313 |
| 106 | 3300005293 | Ga0065715_10089715 | Ga0065715_100897157 | 314 |
| 107 | 3300005356 | Ga0070674_100042317 | Ga0070674_1000423172 | 314 |
| 108 | 3300005617 | Ga0068859_100061424 | Ga0068859_1000614242 | 314 |
| 109 | 3300006931 | Ga0097620_100061421 | Ga0097620_1000614212 | 314 |
| 110 | 3300025937 | Ga0207669_10082962 | Ga0207669_100829622 | 314 |
| 111 | 3300031731 | Ga0307405_10002071 | Ga0307405_100020712 | 314 |
| 112 | 3300031731 | Ga0307405_10064146 | Ga0307405_100641461 | 314 |
| 113 | 3300031911 | Ga0307412_10056030 | Ga0307412_100560302 | 314 |
| 114 | 3300032002 | Ga0307416_100167043 | Ga0307416_1001670433 | 314 |
| 115 | 3300032004 | Ga0307414_10370931 | Ga0307414_103709312 | 314 |
| 116 | 3300032005 | Ga0307411_10002364 | Ga0307411_100023641 | 314 |
| 117 | 3300032126 | Ga0307415_100204322 | Ga0307415_1002043222 | 314 |
| 118 | iso_pu_bacteria | 2881101125 | 2881104482 | 314 |
| 119 | iso_pu_bacteria | 2882806704 | 2882807903 | 314 |
| 120 | iso_pu_bacteria | 2895880812 | 2895882552 | 314 |
| 121 | iso_pu_bacteria | 8002392321 | 8002392695 | 314 |
| 122 | 3300003187 | JGI25151J46595_10000254 | JGI25151J46595_1000025450 | 315 |
| 123 | 3300005328 | Ga0070676_10015937 | Ga0070676_100159373 | 315 |
| 124 | 3300005347 | Ga0070668_100072270 | Ga0070668_1000722702 | 315 |
| 125 | 3300005455 | Ga0070663_100269137 | Ga0070663_1002691371 | 315 |
| 126 | 3300005457 | Ga0070662_100180836 | Ga0070662_1001808362 | 315 |
| 127 | 3300005843 | Ga0068860_100520570 | Ga0068860_1005205701 | 315 |
| 128 | 3300006175 | Ga0070712_100057586 | Ga0070712_1000575861 | 315 |
| 129 | 3300006844 | Ga0075428_100160286 | Ga0075428_1001602863 | 315 |
| 130 | 3300009177 | Ga0105248_10131246 | Ga0105248_101312463 | 315 |
| 131 | 3300025294 | Ga0209025_1000003 | Ga0209025_10000031085 | 315 |
| 132 | 3300025931 | Ga0207644_10223553 | Ga0207644_102235532 | 315 |
| 133 | 3300025933 | Ga0207706_10255253 | Ga0207706_102552532 | 315 |
| 134 | 3300025972 | Ga0207668_10093534 | Ga0207668_100935342 | 315 |
| 135 | 3300026075 | Ga0207708_10114884 | Ga0207708_101148842 | 315 |
| 136 | 3300027665 | Ga0209983_1024233 | Ga0209983_10242332 | 315 |
| 137 | 3300028381 | Ga0268264_10386004 | Ga0268264_103860041 | 315 |
| 138 | 3300031235 | Ga0265330_10046353 | Ga0265330_100463531 | 315 |
| 139 | 3300031239 | Ga0265328_10031391 | Ga0265328_100313912 | 315 |
| 140 | 3300031548 | Ga0307408_100009214 | Ga0307408_10000921410 | 315 |
| 141 | 3300031548 | Ga0307408_100199850 | Ga0307408_1001998502 | 315 |
| 142 | 3300031548 | Ga0307408_100229679 | Ga0307408_1002296792 | 315 |
| 143 | 3300031731 | Ga0307405_10026792 | Ga0307405_100267923 | 315 |
| 144 | 3300031824 | Ga0307413_10001575 | Ga0307413_100015752 | 315 |
| 145 | 3300031824 | Ga0307413_10017716 | Ga0307413_100177163 | 315 |
| 146 | 3300031824 | Ga0307413_10025357 | Ga0307413_100253573 | 315 |
| 147 | 3300031824 | Ga0307413_10093521 | Ga0307413_100935212 | 315 |
| 148 | 3300031824 | Ga0307413_10104722 | Ga0307413_101047223 | 315 |
| 149 | 3300031852 | Ga0307410_10000955 | Ga0307410_1000095511 | 315 |
| 150 | 3300031852 | Ga0307410_10001610 | Ga0307410_1000161011 | 315 |
| 151 | 3300031852 | Ga0307410_10018918 | Ga0307410_100189183 | 315 |
| 152 | 3300031852 | Ga0307410_10026238 | Ga0307410_100262383 | 315 |
| 153 | 3300031852 | Ga0307410_10037420 | Ga0307410_100374204 | 315 |
| 154 | 3300031852 | Ga0307410_10067165 | Ga0307410_100671653 | 315 |
| 155 | 3300031852 | Ga0307410_10126408 | Ga0307410_101264083 | 315 |
| 156 | 3300031901 | Ga0307406_10082011 | Ga0307406_100820113 | 315 |
| 157 | 3300031901 | Ga0307406_10239003 | Ga0307406_102390032 | 315 |
| 158 | 3300031903 | Ga0307407_10017979 | Ga0307407_100179792 | 315 |
| 159 | 3300031903 | Ga0307407_10022660 | Ga0307407_100226603 | 315 |
| 160 | 3300031903 | Ga0307407_10044802 | Ga0307407_100448023 | 315 |
| 161 | 3300031903 | Ga0307407_10089700 | Ga0307407_100897002 | 315 |
| 162 | 3300031911 | Ga0307412_10009717 | Ga0307412_100097173 | 315 |
| 163 | 3300031911 | Ga0307412_10013657 | Ga0307412_100136575 | 315 |
| 164 | 3300031995 | Ga0307409_100000527 | Ga0307409_10000052710 | 315 |
| 165 | 3300031995 | Ga0307409_100000928 | Ga0307409_1000009285 | 315 |
| 166 | 3300031995 | Ga0307409_100075583 | Ga0307409_1000755833 | 315 |
| 167 | 3300031995 | Ga0307409_100327407 | Ga0307409_1003274072 | 315 |
| 168 | 3300032002 | Ga0307416_100016512 | Ga0307416_1000165123 | 315 |
| 169 | 3300032002 | Ga0307416_100018674 | Ga0307416_1000186743 | 315 |
| 170 | 3300032002 | Ga0307416_100065836 | Ga0307416_1000658362 | 315 |
| 171 | 3300032002 | Ga0307416_100175941 | Ga0307416_1001759412 | 315 |
| 172 | 3300032002 | Ga0307416_100295608 | Ga0307416_1002956082 | 315 |
| 173 | 3300032002 | Ga0307416_100415426 | Ga0307416_1004154262 | 315 |
| 174 | 3300032004 | Ga0307414_10002424 | Ga0307414_100024245 | 315 |
| 175 | 3300032004 | Ga0307414_10018787 | Ga0307414_100187872 | 315 |
| 176 | 3300032004 | Ga0307414_10034909 | Ga0307414_100349092 | 315 |
| 177 | 3300032004 | Ga0307414_10115317 | Ga0307414_101153172 | 315 |
| 178 | 3300032004 | Ga0307414_10269036 | Ga0307414_102690362 | 315 |
| 179 | 3300032005 | Ga0307411_10000789 | Ga0307411_100007899 | 315 |
| 180 | 3300032005 | Ga0307411_10008735 | Ga0307411_100087353 | 315 |
| 181 | 3300032005 | Ga0307411_10013756 | Ga0307411_100137565 | 315 |
| 182 | 3300032005 | Ga0307411_10030356 | Ga0307411_100303562 | 315 |
| 183 | 3300032005 | Ga0307411_10039958 | Ga0307411_100399582 | 315 |
| 184 | 3300032005 | Ga0307411_10044772 | Ga0307411_100447723 | 315 |
| 185 | 3300032005 | Ga0307411_10056401 | Ga0307411_100564012 | 315 |
| 186 | 3300032005 | Ga0307411_10075516 | Ga0307411_100755163 | 315 |
| 187 | 3300032005 | Ga0307411_10345356 | Ga0307411_103453561 | 315 |
| 188 | 3300032126 | Ga0307415_100005302 | Ga0307415_1000053027 | 315 |
| 189 | 3300032126 | Ga0307415_100034044 | Ga0307415_1000340445 | 315 |
| 190 | 3300032126 | Ga0307415_100080324 | Ga0307415_1000803242 | 315 |
| 191 | 3300032126 | Ga0307415_100101909 | Ga0307415_1001019092 | 315 |
| 192 | 3300032126 | Ga0307415_100258368 | Ga0307415_1002583682 | 315 |
| 193 | 3300035410 | Ga0373924_0034441 | Ga0373924_0034441_398_1369 | 315 |
| 194 | 3300036401 | Ga0373937_0053865 | Ga0373937_0053865_563_1534 | 315 |
| 195 | 3300037312 | Ga0395899_0229826 | Ga0395899_0229826_46_999 | 315 |
| 196 | 3300037418 | Ga0395900_0000487 | Ga0395900_0000487_15367_16320 | 315 |
| 197 | 3300037471 | Ga0395905_0000165 | Ga0395905_0000165_23633_24586 | 315 |
| 198 | 3300037471 | Ga0395905_0206767 | Ga0395905_0206767_323_1276 | 315 |
| 199 | 3300038443 | Ga0395901_0000726 | Ga0395901_0000726_29189_30142 | 315 |
| 200 | 3300046543 | Ga0495645_0095802 | Ga0495645_0095802_361_1332 | 315 |
| 201 | 3300046664 | Ga0495659_0021668 | Ga0495659_0021668_1159_2112 | 315 |
| 202 | 3300046683 | Ga0495658_0061095 | Ga0495658_0061095_272_1243 | 315 |
| 203 | 3300048905 | Ga0496102_0555307 | Ga0496102_0555307_56_1051 | 315 |
| 204 | 3300048910 | Ga0496107_0138290 | Ga0496107_0138290_271_1266 | 315 |
| 205 | 3300048912 | Ga0496109_0522746 | Ga0496109_0522746_18_983 | 315 |
| 206 | 3300003763 | Ga0055529_1001556 | Ga0055529_10015562 | 316 |
| 207 | 3300005548 | Ga0070665_100188906 | Ga0070665_1001889062 | 316 |
| 208 | 3300005841 | Ga0068863_100188783 | Ga0068863_1001887832 | 316 |
| 209 | 3300006944 | Ga0099823_1001313 | Ga0099823_10013135 | 316 |
| 210 | 3300025228 | Ga0209672_104071 | Ga0209672_1040712 | 316 |
| 211 | 3300025272 | Ga0209455_1000566 | Ga0209455_10005669 | 316 |
| 212 | 3300026088 | Ga0207641_10164374 | Ga0207641_101643742 | 316 |
| 213 | 3300027296 | Ga0209389_1000054 | Ga0209389_100005492 | 316 |
| 214 | 3300031824 | Ga0307413_10016889 | Ga0307413_100168892 | 316 |
| 215 | 3300031824 | Ga0307413_10211140 | Ga0307413_102111402 | 316 |
| 216 | 3300031852 | Ga0307410_10026028 | Ga0307410_100260284 | 316 |
| 217 | 3300031911 | Ga0307412_10354414 | Ga0307412_103544141 | 316 |
| 218 | 3300031995 | Ga0307409_100012135 | Ga0307409_1000121356 | 316 |
| 219 | 3300032002 | Ga0307416_100056925 | Ga0307416_1000569253 | 316 |
| 220 | 3300032004 | Ga0307414_10454318 | Ga0307414_104543181 | 316 |
| 221 | 3300032005 | Ga0307411_10003274 | Ga0307411_100032747 | 316 |
| 222 | 3300032005 | Ga0307411_10010123 | Ga0307411_100101235 | 316 |
| 223 | 3300032126 | Ga0307415_100018792 | Ga0307415_1000187923 | 316 |
| 224 | 3300032126 | Ga0307415_100099534 | Ga0307415_1000995343 | 316 |
| 225 | 3300037853 | Ga0436364_0553893 | Ga0436364_0553893_119_1144 | 316 |
| 226 | 3300039062 | Ga0400483_072280 | Ga0400483_072280_3417_4373 | 316 |
| 227 | 3300039062 | Ga0400483_157736 | Ga0400483_157736_5258_6214 | 316 |
| 228 | 3300046453 | Ga0495627_000489 | Ga0495627_000489_3830_4792 | 316 |
| 229 | 3300046471 | Ga0495650_0015607 | Ga0495650_0015607_1451_2413 | 316 |
| 230 | 3300046512 | Ga0495610_0000556 | Ga0495610_0000556_33791_34753 | 316 |
| 231 | 3300046515 | Ga0495620_0000351 | Ga0495620_0000351_2574_3536 | 316 |
| 232 | 3300046558 | Ga0495633_0152786 | Ga0495633_0152786_61_1023 | 316 |
| 233 | 3300047469 | Ga0495673_0059321 | Ga0495673_0059321_628_1590 | 316 |
| 234 | 3300047470 | Ga0495681_0000269 | Ga0495681_0000269_2494_3456 | 316 |
| 235 | 3300048927 | Ga0496124_0000007 | Ga0496124_0000007_751335_752303 | 316 |
| 236 | 3300049574 | Ga0501038_0356546 | Ga0501038_0356546_105_1061 | 316 |
| 237 | 3300049822 | Ga0501035_0022709 | Ga0501035_0022709_3138_4094 | 316 |
| 238 | 3300049822 | Ga0501035_0273236 | Ga0501035_0273236_131_1087 | 316 |
| 239 | 3300049823 | Ga0501044_0000022 | Ga0501044_0000022_20114_21070 | 316 |
| 240 | 3300005289 | Ga0065704_10127118 | Ga0065704_101271181 | 317 |
| 241 | 3300005327 | Ga0070658_10009711 | Ga0070658_100097117 | 317 |
| 242 | 3300005329 | Ga0070683_100007757 | Ga0070683_1000077573 | 317 |
| 243 | 3300005339 | Ga0070660_100050854 | Ga0070660_1000508544 | 317 |
| 244 | 3300005339 | Ga0070660_100069080 | Ga0070660_1000690803 | 317 |
| 245 | 3300005344 | Ga0070661_100055710 | Ga0070661_1000557102 | 317 |
| 246 | 3300005345 | Ga0070692_10030862 | Ga0070692_100308623 | 317 |
| 247 | 3300005455 | Ga0070663_100001996 | Ga0070663_1000019965 | 317 |
| 248 | 3300005535 | Ga0070684_100114847 | Ga0070684_1001148472 | 317 |
| 249 | 3300005563 | Ga0068855_100045610 | Ga0068855_1000456106 | 317 |
| 250 | 3300005614 | Ga0068856_100033987 | Ga0068856_1000339872 | 317 |
| 251 | 3300005616 | Ga0068852_100060863 | Ga0068852_1000608632 | 317 |
| 252 | 3300006175 | Ga0070712_100221655 | Ga0070712_1002216552 | 317 |
| 253 | 3300025904 | Ga0207647_10081285 | Ga0207647_100812852 | 317 |
| 254 | 3300025909 | Ga0207705_10003893 | Ga0207705_1000389314 | 317 |
| 255 | 3300025909 | Ga0207705_10120232 | Ga0207705_101202323 | 317 |
| 256 | 3300025919 | Ga0207657_10005822 | Ga0207657_100058222 | 317 |
| 257 | 3300025932 | Ga0207690_10017465 | Ga0207690_100174652 | 317 |
| 258 | 3300025945 | Ga0207679_10150313 | Ga0207679_101503132 | 317 |
| 259 | 3300026067 | Ga0207678_10003655 | Ga0207678_100036558 | 317 |
| 260 | 3300026116 | Ga0207674_10081914 | Ga0207674_100819142 | 317 |
| 261 | 3300026142 | Ga0207698_10275417 | Ga0207698_102754172 | 317 |
| 262 | 3300028381 | Ga0268264_10032223 | Ga0268264_100322235 | 317 |
| 263 | 3300028381 | Ga0268264_10108028 | Ga0268264_101080282 | 317 |
| 264 | 3300031995 | Ga0307409_100014023 | Ga0307409_1000140232 | 317 |
| 265 | 3300032002 | Ga0307416_100009961 | Ga0307416_1000099612 | 317 |
| 266 | 3300037312 | Ga0395899_0000625 | Ga0395899_0000625_6698_7669 | 317 |
| 267 | 3300037312 | Ga0395899_0054410 | Ga0395899_0054410_155_1126 | 317 |
| 268 | 3300037418 | Ga0395900_0000368 | Ga0395900_0000368_11849_12820 | 317 |
| 269 | 3300037418 | Ga0395900_0011655 | Ga0395900_0011655_336_1307 | 317 |
| 270 | 3300037418 | Ga0395900_0017485 | Ga0395900_0017485_2015_2986 | 317 |
| 271 | 3300037418 | Ga0395900_0345641 | Ga0395900_0345641_413_1384 | 317 |
| 272 | 3300037466 | Ga0395898_0093082 | Ga0395898_0093082_1836_2807 | 317 |
| 273 | 3300037466 | Ga0395898_0226724 | Ga0395898_0226724_51_1022 | 317 |
| 274 | 3300037471 | Ga0395905_0058635 | Ga0395905_0058635_2513_3484 | 317 |
| 275 | 3300037471 | Ga0395905_0080946 | Ga0395905_0080946_1496_2455 | 317 |
| 276 | 3300037471 | Ga0395905_0107100 | Ga0395905_0107100_313_1284 | 317 |
| 277 | 3300038443 | Ga0395901_0000064 | Ga0395901_0000064_52157_53128 | 317 |
| 278 | 3300038443 | Ga0395901_0273428 | Ga0395901_0273428_582_1541 | 317 |
| 279 | 3300039062 | Ga0400483_075161 | Ga0400483_075161_84697_85656 | 317 |
| 280 | 3300039062 | Ga0400483_105415 | Ga0400483_105415_12875_13834 | 317 |
| 281 | 3300039062 | Ga0400483_107214 | Ga0400483_107214_2099_3058 | 317 |
| 282 | 3300039062 | Ga0400483_194331 | Ga0400483_194331_7613_8572 | 317 |
| 283 | 3300039062 | Ga0400483_227307 | Ga0400483_227307_2359_3318 | 317 |
| 284 | 3300039437 | Ga0436365_0969411 | Ga0436365_0969411_987_1964 | 317 |
| 285 | 3300005327 | Ga0070658_10046890 | Ga0070658_100468905 | 318 |
| 286 | 3300005333 | Ga0070677_10004231 | Ga0070677_100042315 | 318 |
| 287 | 3300005366 | Ga0070659_100142302 | Ga0070659_1001423022 | 318 |
| 288 | 3300005457 | Ga0070662_100011928 | Ga0070662_1000119284 | 318 |
| 289 | 3300005458 | Ga0070681_10184987 | Ga0070681_101849872 | 318 |
| 290 | 3300005563 | Ga0068855_100097806 | Ga0068855_1000978062 | 318 |
| 291 | 3300005578 | Ga0068854_100007618 | Ga0068854_1000076185 | 318 |
| 292 | 3300006195 | Ga0075366_10019960 | Ga0075366_100199602 | 318 |
| 293 | 3300009148 | Ga0105243_10157747 | Ga0105243_101577471 | 318 |
| 294 | 3300013100 | Ga0157373_10005394 | Ga0157373_100053944 | 318 |
| 295 | 3300013102 | Ga0157371_10008644 | Ga0157371_100086443 | 318 |
| 296 | 3300013102 | Ga0157371_10016732 | Ga0157371_100167322 | 318 |
| 297 | 3300013102 | Ga0157371_10032979 | Ga0157371_100329794 | 318 |
| 298 | 3300025909 | Ga0207705_10023911 | Ga0207705_100239114 | 318 |
| 299 | 3300025912 | Ga0207707_10157931 | Ga0207707_101579313 | 318 |
| 300 | 3300025917 | Ga0207660_10076283 | Ga0207660_100762832 | 318 |
| 301 | 3300025919 | Ga0207657_10000553 | Ga0207657_1000055313 | 318 |
| 302 | 3300025932 | Ga0207690_10272462 | Ga0207690_102724622 | 318 |
| 303 | 3300025933 | Ga0207706_10001551 | Ga0207706_1000155115 | 318 |
| 304 | 3300025949 | Ga0207667_10082347 | Ga0207667_100823471 | 318 |
| 305 | 3300026121 | Ga0207683_10224928 | Ga0207683_102249282 | 318 |
| 306 | 3300037418 | Ga0395900_0190817 | Ga0395900_0190817_497_1459 | 318 |
| 307 | 3300037466 | Ga0395898_0089142 | Ga0395898_0089142_960_1922 | 318 |
| 308 | 3300038443 | Ga0395901_0240740 | Ga0395901_0240740_68_1030 | 318 |
| 309 | 3300039062 | Ga0400483_265160 | Ga0400483_265160_131_1111 | 318 |
| 310 | 3300044684 | Ga0466966_0020323 | Ga0466966_0020323_2936_3907 | 318 |
| 311 | 3300044765 | Ga0466970_0082384 | Ga0466970_0082384_460_1431 | 318 |
| 312 | 3300045976 | Ga0466967_0101058 | Ga0466967_0101058_441_1406 | 318 |
| 313 | 3300046616 | Ga0495668_0000024 | Ga0495668_0000024_160808_161779 | 318 |
| 314 | 3300046616 | Ga0495668_0016136 | Ga0495668_0016136_2370_3332 | 318 |
| 315 | 3300048911 | Ga0496108_0276147 | Ga0496108_0276147_312_1292 | 318 |
| 316 | 3300053087 | Ga0500643_000001 | Ga0500643_000001_1290994_1291974 | 318 |
| 317 | 3300053122 | Ga0500608_001168 | Ga0500608_001168_4952_5929 | 318 |
| 318 | 3300053136 | Ga0500559_0021172 | Ga0500559_0021172_778_1755 | 318 |
| 319 | 3300053138 | Ga0500564_002986 | Ga0500564_002986_1572_2549 | 318 |
| 320 | 3300053729 | Ga0500625_000003 | Ga0500625_000003_25876_26853 | 318 |
| 321 | 3300002459 | JGI24751J29686_10000084 | JGI24751J29686_1000008430 | 319 |
| 322 | 3300003187 | JGI25151J46595_10008014 | JGI25151J46595_100080144 | 319 |
| 323 | 3300005295 | Ga0065707_10002266 | Ga0065707_100022662 | 319 |
| 324 | 3300005295 | Ga0065707_10084019 | Ga0065707_100840194 | 319 |
| 325 | 3300005330 | Ga0070690_100158905 | Ga0070690_1001589052 | 319 |
| 326 | 3300005335 | Ga0070666_10165239 | Ga0070666_101652391 | 319 |
| 327 | 3300005336 | Ga0070680_100053641 | Ga0070680_1000536411 | 319 |
| 328 | 3300005347 | Ga0070668_100000378 | Ga0070668_1000003787 | 319 |
| 329 | 3300005347 | Ga0070668_100050894 | Ga0070668_1000508943 | 319 |
| 330 | 3300005353 | Ga0070669_100015974 | Ga0070669_1000159743 | 319 |
| 331 | 3300005355 | Ga0070671_100000063 | Ga0070671_10000006310 | 319 |
| 332 | 3300005366 | Ga0070659_100072225 | Ga0070659_1000722252 | 319 |
| 333 | 3300005367 | Ga0070667_100000145 | Ga0070667_10000014518 | 319 |
| 334 | 3300005367 | Ga0070667_100001147 | Ga0070667_10000114711 | 319 |
| 335 | 3300005367 | Ga0070667_100101350 | Ga0070667_1001013503 | 319 |
| 336 | 3300005458 | Ga0070681_10002051 | Ga0070681_100020516 | 319 |
| 337 | 3300005547 | Ga0070693_100094428 | Ga0070693_1000944282 | 319 |
| 338 | 3300005614 | Ga0068856_100170121 | Ga0068856_1001701212 | 319 |
| 339 | 3300005618 | Ga0068864_100035398 | Ga0068864_1000353982 | 319 |
| 340 | 3300005841 | Ga0068863_100000723 | Ga0068863_10000072326 | 319 |
| 341 | 3300005841 | Ga0068863_100001090 | Ga0068863_10000109014 | 319 |
| 342 | 3300005842 | Ga0068858_100031035 | Ga0068858_1000310352 | 319 |
| 343 | 3300005843 | Ga0068860_100000942 | Ga0068860_10000094226 | 319 |
| 344 | 3300005843 | Ga0068860_100010487 | Ga0068860_1000104875 | 319 |
| 345 | 3300005843 | Ga0068860_100020207 | Ga0068860_1000202076 | 319 |
| 346 | 3300005843 | Ga0068860_100160958 | Ga0068860_1001609582 | 319 |
| 347 | 3300005937 | Ga0081455_10010851 | Ga0081455_1001085111 | 319 |
| 348 | 3300009093 | Ga0105240_10003877 | Ga0105240_1000387722 | 319 |
| 349 | 3300009177 | Ga0105248_10131600 | Ga0105248_101316002 | 319 |
| 350 | 3300009177 | Ga0105248_10713608 | Ga0105248_107136082 | 319 |
| 351 | 3300009551 | Ga0105238_10129088 | Ga0105238_101290881 | 319 |
| 352 | 3300009553 | Ga0105249_10008804 | Ga0105249_100088045 | 319 |
| 353 | 3300009553 | Ga0105249_10249860 | Ga0105249_102498602 | 319 |
| 354 | 3300013306 | Ga0163162_10013412 | Ga0163162_100134125 | 319 |
| 355 | 3300013306 | Ga0163162_10014423 | Ga0163162_100144236 | 319 |
| 356 | 3300014326 | Ga0157380_10000486 | Ga0157380_1000048612 | 319 |
| 357 | 3300014968 | Ga0157379_10000433 | Ga0157379_1000043315 | 319 |
| 358 | 3300025294 | Ga0209025_1000113 | Ga0209025_1000113144 | 319 |
| 359 | 3300025711 | Ga0207696_1000150 | Ga0207696_100015061 | 319 |
| 360 | 3300025903 | Ga0207680_10014274 | Ga0207680_100142745 | 319 |
| 361 | 3300025903 | Ga0207680_10113710 | Ga0207680_101137101 | 319 |
| 362 | 3300025912 | Ga0207707_10084997 | Ga0207707_100849972 | 319 |
| 363 | 3300025913 | Ga0207695_10283589 | Ga0207695_102835891 | 319 |
| 364 | 3300025919 | Ga0207657_10119756 | Ga0207657_101197562 | 319 |
| 365 | 3300025919 | Ga0207657_10156183 | Ga0207657_101561831 | 319 |
| 366 | 3300025921 | Ga0207652_10077776 | Ga0207652_100777764 | 319 |
| 367 | 3300025923 | Ga0207681_10043239 | Ga0207681_100432393 | 319 |
| 368 | 3300025923 | Ga0207681_10238308 | Ga0207681_102383081 | 319 |
| 369 | 3300025931 | Ga0207644_10000075 | Ga0207644_1000007548 | 319 |
| 370 | 3300025941 | Ga0207711_10153616 | Ga0207711_101536162 | 319 |
| 371 | 3300025949 | Ga0207667_10067632 | Ga0207667_100676326 | 319 |
| 372 | 3300025972 | Ga0207668_10000022 | Ga0207668_10000022104 | 319 |
| 373 | 3300025986 | Ga0207658_10000021 | Ga0207658_1000002166 | 319 |
| 374 | 3300025986 | Ga0207658_10000103 | Ga0207658_1000010314 | 319 |
| 375 | 3300025986 | Ga0207658_10227609 | Ga0207658_102276092 | 319 |
| 376 | 3300026035 | Ga0207703_10413257 | Ga0207703_104132572 | 319 |
| 377 | 3300026088 | Ga0207641_10000040 | Ga0207641_1000004064 | 319 |
| 378 | 3300026088 | Ga0207641_10000344 | Ga0207641_1000034434 | 319 |
| 379 | 3300026095 | Ga0207676_10132263 | Ga0207676_101322631 | 319 |
| 380 | 3300028380 | Ga0268265_10135584 | Ga0268265_101355842 | 319 |
| 381 | 3300028381 | Ga0268264_10000351 | Ga0268264_1000035147 | 319 |
| 382 | 3300028381 | Ga0268264_10076748 | Ga0268264_100767481 | 319 |
| 383 | 3300028381 | Ga0268264_10132201 | Ga0268264_101322012 | 319 |
| 384 | 3300028381 | Ga0268264_10181111 | Ga0268264_101811112 | 319 |
| 385 | 3300037068 | Ga0373925_0013194 | Ga0373925_0013194_4175_5203 | 319 |
| 386 | 3300048903 | Ga0496100_0045218 | Ga0496100_0045218_160_1137 | 319 |
| 387 | 3300048904 | Ga0496101_0021178 | Ga0496101_0021178_3180_4157 | 319 |
| 388 | 3300048907 | Ga0496104_0003273 | Ga0496104_0003273_3029_4006 | 319 |
| 389 | 3300048908 | Ga0496105_0031876 | Ga0496105_0031876_1103_2080 | 319 |
| 390 | 3300048909 | Ga0496106_0001852 | Ga0496106_0001852_4132_5109 | 319 |
| 391 | 3300048910 | Ga0496107_0001923 | Ga0496107_0001923_10820_11797 | 319 |
| 392 | 3300048911 | Ga0496108_0081329 | Ga0496108_0081329_892_1869 | 319 |
| 393 | 3300048915 | Ga0496112_0000224 | Ga0496112_0000224_4773_5750 | 319 |
| 394 | 3300048916 | Ga0496113_0000456 | Ga0496113_0000456_9960_10937 | 319 |
| 395 | 3300048917 | Ga0496114_0051712 | Ga0496114_0051712_175_1164 | 319 |
| 396 | 3300048918 | Ga0496115_0111435 | Ga0496115_0111435_86_1075 | 319 |
| 397 | 3300048920 | Ga0496117_0007760 | Ga0496117_0007760_1199_2179 | 319 |
| 398 | 3300048921 | Ga0496118_0015971 | Ga0496118_0015971_5299_6279 | 319 |
| 399 | 3300048922 | Ga0496119_0000562 | Ga0496119_0000562_47371_48333 | 319 |
| 400 | 3300048923 | Ga0496120_0000122 | Ga0496120_0000122_6883_7845 | 319 |
| 401 | 3300048924 | Ga0496121_0003153 | Ga0496121_0003153_13870_14847 | 319 |
| 402 | 3300048924 | Ga0496121_0041765 | Ga0496121_0041765_2526_3485 | 319 |
| 403 | 3300048927 | Ga0496124_0051145 | Ga0496124_0051145_666_1646 | 319 |
| 404 | 3300049571 | Ga0501034_0000050 | Ga0501034_0000050_45558_46535 | 319 |
| 405 | 3300050492 | nmdc:mga0yw44_1367_c2 | nmdc:mga0yw44_1367_c2_5384_6385 | 319 |
| 406 | iso_pu_bacteria | 2894023352 | 2894025389 | 319 |
| 407 | 3300005841 | Ga0068863_100003202 | Ga0068863_1000032026 | 320 |
| 408 | 3300046542 | Ga0495597_0000028 | Ga0495597_0000028_104038_105048 | 320 |
| 409 | 3300041512 | Ga0451853_3155702 | Ga0451853_3155702_14_1078 | 322 |
| 410 | 3300002074 | JGI24748J21848_1001425 | JGI24748J21848_10014252 | 323 |
| 411 | 3300002239 | JGI24034J26672_10005569 | JGI24034J26672_100055692 | 323 |
| 412 | 3300002459 | JGI24751J29686_10000964 | JGI24751J29686_100009642 | 323 |
| 413 | 3300005295 | Ga0065707_10031194 | Ga0065707_100311942 | 323 |
| 414 | 3300005331 | Ga0070670_100077680 | Ga0070670_1000776802 | 323 |
| 415 | 3300005335 | Ga0070666_10007821 | Ga0070666_100078216 | 323 |
| 416 | 3300005353 | Ga0070669_100138922 | Ga0070669_1001389222 | 323 |
| 417 | 3300005355 | Ga0070671_100053827 | Ga0070671_1000538272 | 323 |
| 418 | 3300005367 | Ga0070667_100017434 | Ga0070667_1000174345 | 323 |
| 419 | 3300005548 | Ga0070665_100284735 | Ga0070665_1002847352 | 323 |
| 420 | 3300005617 | Ga0068859_100010870 | Ga0068859_1000108709 | 323 |
| 421 | 3300005618 | Ga0068864_100011182 | Ga0068864_1000111828 | 323 |
| 422 | 3300005719 | Ga0068861_100005587 | Ga0068861_1000055872 | 323 |
| 423 | 3300005841 | Ga0068863_100105523 | Ga0068863_1001055232 | 323 |
| 424 | 3300005842 | Ga0068858_100001621 | Ga0068858_10000162124 | 323 |
| 425 | 3300005843 | Ga0068860_100023541 | Ga0068860_1000235416 | 323 |
| 426 | 3300005844 | Ga0068862_100004956 | Ga0068862_10000495611 | 323 |
| 427 | 3300006931 | Ga0097620_100010871 | Ga0097620_1000108719 | 323 |
| 428 | 3300009092 | Ga0105250_10000029 | Ga0105250_10000029112 | 323 |
| 429 | 3300009553 | Ga0105249_10110638 | Ga0105249_101106382 | 323 |
| 430 | 3300025223 | Ga0207672_1002161 | Ga0207672_10021611 | 323 |
| 431 | 3300025903 | Ga0207680_10005706 | Ga0207680_100057066 | 323 |
| 432 | 3300025925 | Ga0207650_10024234 | Ga0207650_100242342 | 323 |
| 433 | 3300025931 | Ga0207644_10005717 | Ga0207644_100057172 | 323 |
| 434 | 3300025972 | Ga0207668_10000416 | Ga0207668_100004162 | 323 |
| 435 | 3300025986 | Ga0207658_10000639 | Ga0207658_1000063922 | 323 |
| 436 | 3300026035 | Ga0207703_10001299 | Ga0207703_100012992 | 323 |
| 437 | 3300026088 | Ga0207641_10057722 | Ga0207641_100577222 | 323 |
| 438 | 3300026095 | Ga0207676_10005543 | Ga0207676_100055437 | 323 |
| 439 | 3300026118 | Ga0207675_100034684 | Ga0207675_1000346843 | 323 |
| 440 | 3300028379 | Ga0268266_10234457 | Ga0268266_102344572 | 323 |
| 441 | 3300028380 | Ga0268265_10000808 | Ga0268265_1000080828 | 323 |
| 442 | 3300028381 | Ga0268264_10000214 | Ga0268264_10000214112 | 323 |
| 443 | 3300048927 | Ga0496124_0000273 | Ga0496124_0000273_49300_50334 | 323 |
| 444 | 3300048928 | Ga0496125_0048198 | Ga0496125_0048198_1636_2670 | 323 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5gvj-assembly1.cif.gz_A-2 | structure of fabk (m276a) mutant from thermotoga maritima | 0.8647 | 6 | 322 |
| 5gvj-assembly2.cif.gz_B-3 | structure of fabk (m276a) mutant from thermotoga maritima | 0.8492 | 6 | 322 |
| 5gvj-assembly1.cif.gz_A-2 | structure of fabk (m276a) mutant from thermotoga maritima | 0.848 | 6 | 322 |
| 3bw3-assembly1.cif.gz_A-2 | crystal structures and site-directed mutagenesis study of nitroalkane oxidase from streptomyces ansochromogenes | 0.8461 | 11 | 319 |
| 2z6j-assembly1.cif.gz_A | crystal structure of s. pneumoniae enoyl-acyl carrier protein reductase (fabk) in complex with an inhibitor | 0.8356 | 6 | 322 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5gvjA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8647 | 6 | 322 | 3.20.20.70 |
| 5gvjA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.848 | 6 | 322 | 3.20.20.70 |
| af_Q2FZX9_3_354_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8334 | 6 | 315 | 3.20.20.70 |
| 2gjnA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.832 | 9 | 322 | 3.20.20.70 |
| af_P71847_8_353_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8296 | 10 | 321 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258K951-F1-model_v4 | Nitronate monooxygenase | 0.9927 | 13 | 227 |
GO:0018580
|
| AF-A0A3D1XFG9-F1-model_v4 | deleted | 0.9924 | 11 | 226 |
|
| AF-A0A3N5GCM7-F1-model_v4 | Nitronate monooxygenase | 0.9919 | 11 | 244 |
GO:0018580
|
| AF-A0A3B9ITZ0-F1-model_v4 | Nitronate monooxygenase | 0.9914 | 37 | 212 |
GO:0018580
|
| AF-A0A5C7UUD6-F1-model_v4 | Nitronate monooxygenase | 0.9911 | 24 | 174 |
GO:0018580
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar