F445267

General Info

Members Datasets Scaffolds Average Seq Length
444 244 427 321

Family's Representative Sequence

Representative Sequence 3300009092|Ga0105250_10000029|Ga0105250_10000029112
Length 373
Sequence LLDHHRKCSNLGLALPLKSTYHSIDPQEAYLCEWRIRRHDYTGTSDRAEGKMLMSVASKLANRLRLPVIAAPLFLVSGPDLVINCCKEGVVGTFPSLNLRTAEAFEGWLIQIKTALASYDAEHPKAPSAPFGVNIIAHKTNKRLDEDMGLVEKHQVPIVITSVGNPSEIVKTVHGYGGLVFHDVTTPLWAKKAIAAGVDGIILVCGGAGGHAGLINPFAFVPQVREFYDGALLLAGCVSDGRSIHAAQALGADFAYIGTKFIATTESMASDAYKQMLVDSGPTDLVYTPAFSGIPANMLRQSIIDNGMDPDRLPSKDHIDLGEEFNHEAKAWRDIWTAGQGVGAIHDVRPVRDVIEQLKREYFASKEGTRRSQ

Samples

Sample ID Description Type Environment
1 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
2 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
3 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
4 2643221736 Bosea sp. Root483D1 Isolate Unclassified
5 2851182111 Bosea sp. Tri-44 Isolate Nodule
6 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
7 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
8 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
9 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
10 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
11 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
12 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
13 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
14 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
15 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
16 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
17 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
18 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
19 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
84 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
122 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
128 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
129 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
156 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
166 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
167 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
168 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
169 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
170 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
171 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
178 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
179 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
180 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
195 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
196 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
197 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
198 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
199 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
200 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
201 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
202 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
203 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
204 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
205 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
206 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
207 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
208 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
216 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
217 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
218 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
219 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
220 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
221 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
222 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
223 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
224 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
225 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
226 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
227 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
228 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
229 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
233 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
234 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
235 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
236 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
237 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
238 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
239 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
240 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
241 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
242 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
243 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
244 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.17
Metatranscriptomes 0
Isolates 3.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.18
Nodule 1.13
Rhizoplane 3.38
Rhizosphere 81.76
Stem 0
Stem Tuber 0
Unclassified 8.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1001425 3300002074 Bacteria 2627
2 JGI24034J26672_10005569 3300002239 Bacteria 1806
3 JGI24751J29686_10000084 3300002459 Bacteria 52362
4 JGI24751J29686_10000964 3300002459 Bacteria 6337
5 JGI25151J46595_10000254 3300003187 Bacteria 62429
6 JGI25151J46595_10008014 3300003187 Bacteria 5122
7 rootL2_10034672 3300003322 Bacteria 4908
8 rootL2_10141192 3300003322 Bacteria 1895
9 Ga0055529_1001556 3300003763 Bacteria 6471
10 Ga0055531_10002410 3300003794 Bacteria 12551
11 Ga0065704_10127118 3300005289 Unclassified 1680
12 Ga0065715_10089715 3300005293 Bacteria 8773
13 Ga0065707_10002266 3300005295 Bacteria 8464
14 Ga0065707_10031194 3300005295 Bacteria 1462
15 Ga0065707_10084019 3300005295 Bacteria 7816
16 Ga0070658_10009711 3300005327 Bacteria 7726
17 Ga0070658_10046890 3300005327 Bacteria 3496
18 Ga0070658_10174274 3300005327 Bacteria 1808
19 Ga0070676_10015937 3300005328 Bacteria 4148
20 Ga0070683_100007757 3300005329 Bacteria 9088
21 Ga0070690_100158905 3300005330 Bacteria 1547
22 Ga0070670_100077680 3300005331 Bacteria 2852
23 Ga0070677_10004231 3300005333 Bacteria 4674
24 Ga0070666_10007821 3300005335 Bacteria 6602
25 Ga0070666_10165239 3300005335 Unclassified 1548
26 Ga0070680_100053641 3300005336 Bacteria 3291
27 Ga0070660_100050854 3300005339 Bacteria 3189
28 Ga0070660_100069080 3300005339 Bacteria 2754
29 Ga0070661_100055710 3300005344 Bacteria 2895
30 Ga0070692_10030862 3300005345 Bacteria 2683
31 Ga0070668_100000378 3300005347 Bacteria 29470
32 Ga0070668_100050894 3300005347 Bacteria 3191
33 Ga0070668_100072270 3300005347 Bacteria 2688
34 Ga0070669_100015974 3300005353 Bacteria 5357
35 Ga0070669_100138922 3300005353 Bacteria 1871
36 Ga0070671_100000063 3300005355 Bacteria 72834
37 Ga0070671_100053827 3300005355 Bacteria 3345
38 Ga0070674_100042317 3300005356 Bacteria 3093
39 Ga0070659_100072225 3300005366 Bacteria 2745
40 Ga0070659_100142302 3300005366 Bacteria 1953
41 Ga0070667_100000145 3300005367 Bacteria 89528
42 Ga0070667_100001147 3300005367 Bacteria 24025
43 Ga0070667_100017434 3300005367 Bacteria 5952
44 Ga0070667_100101350 3300005367 Bacteria 2487
45 Ga0070694_100014116 3300005444 Bacteria 4999
46 Ga0070663_100001996 3300005455 Bacteria 11392
47 Ga0070663_100269137 3300005455 Bacteria 1354
48 Ga0070662_100011928 3300005457 Bacteria 5745
49 Ga0070662_100180836 3300005457 Bacteria 1662
50 Ga0070681_10002051 3300005458 Bacteria 18267
51 Ga0070681_10184987 3300005458 Bacteria 2004
52 Ga0070684_100114847 3300005535 Bacteria 2417
53 Ga0070695_100044550 3300005545 Bacteria 2825
54 Ga0070693_100094428 3300005547 Bacteria 1809
55 Ga0070665_100188906 3300005548 Bacteria 2061
56 Ga0070665_100284735 3300005548 Bacteria 1655
57 Ga0068855_100005574 3300005563 Bacteria 15362
58 Ga0068855_100045610 3300005563 Bacteria 5184
59 Ga0068855_100070112 3300005563 Bacteria 4079
60 Ga0068855_100097806 3300005563 Bacteria 3381
61 Ga0068854_100007618 3300005578 Bacteria 6924
62 Ga0068856_100033987 3300005614 Bacteria 4993
63 Ga0068856_100048304 3300005614 Bacteria 4193
64 Ga0068856_100170121 3300005614 Bacteria 2191
65 Ga0068852_100060863 3300005616 Bacteria 3279
66 Ga0068852_100094763 3300005616 Bacteria 2679
67 Ga0068859_100010870 3300005617 Bacteria 9159
68 Ga0068859_100061424 3300005617 Bacteria 3786
69 Ga0068864_100011182 3300005618 Bacteria 7417
70 Ga0068864_100014840 3300005618 Bacteria 6473
71 Ga0068864_100035398 3300005618 Bacteria 4251
72 Ga0068861_100005587 3300005719 Bacteria 8524
73 Ga0068863_100000723 3300005841 Bacteria 33109
74 Ga0068863_100000879 3300005841 Bacteria 30177
75 Ga0068863_100001090 3300005841 Bacteria 27124
76 Ga0068863_100003202 3300005841 Bacteria 16195
77 Ga0068863_100105523 3300005841 Bacteria 2680
78 Ga0068863_100188783 3300005841 Bacteria 1980
79 Ga0068858_100001621 3300005842 Bacteria 22962
80 Ga0068858_100031035 3300005842 Bacteria 4963
81 Ga0068860_100000942 3300005843 Bacteria 32259
82 Ga0068860_100010487 3300005843 Bacteria 9158
83 Ga0068860_100020207 3300005843 Bacteria 6454
84 Ga0068860_100023541 3300005843 Bacteria 5952
85 Ga0068860_100160958 3300005843 Bacteria 2164
86 Ga0068860_100520570 3300005843 Bacteria 1189
87 Ga0068862_100004956 3300005844 Bacteria 11212
88 Ga0081455_10010851 3300005937 Bacteria 9197
89 Ga0070712_100057586 3300006175 Bacteria 2731
90 Ga0070712_100221655 3300006175 Bacteria 1498
91 Ga0075366_10019960 3300006195 Bacteria 3884
92 Ga0075428_100160286 3300006844 Bacteria 2442
93 Ga0097620_100010871 3300006931 Bacteria 9159
94 Ga0097620_100061421 3300006931 Bacteria 3786
95 Ga0099823_1001313 3300006944 Bacteria 20187
96 Ga0099794_10138403 3300007265 Unclassified 1232
97 Ga0105250_10000029 3300009092 Bacteria 180331
98 Ga0105240_10003877 3300009093 Bacteria 23099
99 Ga0105243_10157747 3300009148 Bacteria 1953
100 Ga0105248_10131246 3300009177 Bacteria 2827
101 Ga0105248_10131600 3300009177 Bacteria 2822
102 Ga0105248_10713608 3300009177 Bacteria 1131
103 Ga0105238_10129088 3300009551 Bacteria 2506
104 Ga0105249_10008804 3300009553 Bacteria 8810
105 Ga0105249_10110638 3300009553 Bacteria 2596
106 Ga0105249_10249860 3300009553 Bacteria 1758
107 Ga0157373_10005394 3300013100 Bacteria 9604
108 Ga0157373_10082246 3300013100 Bacteria 2270
109 Ga0157371_10008644 3300013102 Bacteria 8091
110 Ga0157371_10016732 3300013102 Bacteria 5464
111 Ga0157371_10032979 3300013102 Bacteria 3723
112 Ga0157369_10240313 3300013105 Bacteria 1892
113 Ga0157374_10247691 3300013296 Bacteria 1753
114 Ga0163162_10013412 3300013306 Bacteria 8001
115 Ga0163162_10014423 3300013306 Bacteria 7723
116 Ga0157372_10044590 3300013307 Bacteria 4915
117 Ga0157380_10000486 3300014326 Bacteria 24146
118 Ga0157379_10000433 3300014968 Bacteria 33887
119 Ga0183365_10004 3300015684 Bacteria 333304
120 Ga0207672_1002161 3300025223 Bacteria 1234
121 Ga0209672_104071 3300025228 Bacteria 2816
122 Ga0209455_1000566 3300025272 Bacteria 24635
123 Ga0209130_1023547 3300025284 Bacteria 1356
124 Ga0209025_1000003 3300025294 Bacteria 1366495
125 Ga0209025_1000113 3300025294 Bacteria 218943
126 Ga0209257_1000130 3300025304 Bacteria 212188
127 Ga0207696_1000150 3300025711 Bacteria 120372
128 Ga0207680_10005706 3300025903 Bacteria 5963
129 Ga0207680_10014274 3300025903 Bacteria 4105
130 Ga0207680_10113710 3300025903 Bacteria 1760
131 Ga0207647_10081285 3300025904 Bacteria 1942
132 Ga0207705_10003893 3300025909 Bacteria 11358
133 Ga0207705_10023911 3300025909 Bacteria 4360
134 Ga0207705_10120232 3300025909 Bacteria 1948
135 Ga0207707_10084997 3300025912 Bacteria 2764
136 Ga0207707_10157931 3300025912 Bacteria 1983
137 Ga0207695_10283589 3300025913 Bacteria 1550
138 Ga0207693_10375103 3300025915 Bacteria 1113
139 Ga0207660_10076283 3300025917 Bacteria 2451
140 Ga0207657_10000553 3300025919 Bacteria 39885
141 Ga0207657_10005822 3300025919 Bacteria 12839
142 Ga0207657_10119756 3300025919 Bacteria 2166
143 Ga0207657_10156183 3300025919 Bacteria 1855
144 Ga0207652_10077776 3300025921 Bacteria 2896
145 Ga0207681_10043239 3300025923 Bacteria 3014
146 Ga0207681_10238308 3300025923 Bacteria 1415
147 Ga0207650_10024234 3300025925 Bacteria 4311
148 Ga0207644_10000075 3300025931 Bacteria 72848
149 Ga0207644_10005717 3300025931 Bacteria 8095
150 Ga0207644_10223553 3300025931 Bacteria 1493
151 Ga0207690_10017465 3300025932 Bacteria 4380
152 Ga0207690_10272462 3300025932 Bacteria 1315
153 Ga0207706_10001551 3300025933 Bacteria 22762
154 Ga0207706_10255253 3300025933 Bacteria 1531
155 Ga0207669_10082962 3300025937 Bacteria 2059
156 Ga0207711_10153616 3300025941 Bacteria 2079
157 Ga0207679_10150313 3300025945 Bacteria 1894
158 Ga0207667_10004924 3300025949 Bacteria 16311
159 Ga0207667_10067632 3300025949 Bacteria 3721
160 Ga0207667_10082347 3300025949 Bacteria 3334
161 Ga0207668_10000022 3300025972 Bacteria 135782
162 Ga0207668_10000416 3300025972 Bacteria 26868
163 Ga0207668_10093534 3300025972 Bacteria 2215
164 Ga0207658_10000021 3300025986 Bacteria 201456
165 Ga0207658_10000103 3300025986 Bacteria 93261
166 Ga0207658_10000639 3300025986 Bacteria 30807
167 Ga0207658_10227609 3300025986 Unclassified 1572
168 Ga0207703_10001299 3300026035 Bacteria 23105
169 Ga0207703_10413257 3300026035 Unclassified 1254
170 Ga0207678_10003655 3300026067 Bacteria 13817
171 Ga0207708_10114884 3300026075 Bacteria 2093
172 Ga0207702_10121876 3300026078 Bacteria 2335
173 Ga0207641_10000040 3300026088 Bacteria 192446
174 Ga0207641_10000344 3300026088 Bacteria 55824
175 Ga0207641_10057722 3300026088 Bacteria 3301
176 Ga0207641_10059935 3300026088 Bacteria 3243
177 Ga0207641_10164374 3300026088 Bacteria 2020
178 Ga0207676_10005543 3300026095 Bacteria 8932
179 Ga0207676_10132263 3300026095 Bacteria 2123
180 Ga0207674_10081914 3300026116 Bacteria 3229
181 Ga0207675_100034684 3300026118 Bacteria 4706
182 Ga0207683_10224928 3300026121 Bacteria 1710
183 Ga0207698_10065767 3300026142 Bacteria 2850
184 Ga0207698_10275417 3300026142 Bacteria 1553
185 Ga0209389_1000054 3300027296 Bacteria 108815
186 Ga0209983_1024233 3300027665 Bacteria 1276
187 Ga0268266_10234457 3300028379 Bacteria 1691
188 Ga0268265_10000808 3300028380 Bacteria 29755
189 Ga0268265_10135584 3300028380 Bacteria 2053
190 Ga0268264_10000214 3300028381 Bacteria 114177
191 Ga0268264_10000351 3300028381 Bacteria 69834
192 Ga0268264_10032223 3300028381 Bacteria 4300
193 Ga0268264_10076748 3300028381 Bacteria 2844
194 Ga0268264_10108028 3300028381 Bacteria 2432
195 Ga0268264_10132201 3300028381 Bacteria 2214
196 Ga0268264_10181111 3300028381 Bacteria 1914
197 Ga0268264_10386004 3300028381 Bacteria 1342
198 Ga0265338_10126699 3300028800 Bacteria 2024
199 Ga0265330_10046353 3300031235 Bacteria 1915
200 Ga0265328_10031391 3300031239 Bacteria 1974
201 Ga0265331_10145771 3300031250 Bacteria 1076
202 Ga0307408_100009214 3300031548 Bacteria 6508
203 Ga0307408_100199850 3300031548 Bacteria 1617
204 Ga0307408_100229679 3300031548 Bacteria 1519
205 Ga0307405_10000277 3300031731 Bacteria 18938
206 Ga0307405_10002071 3300031731 Bacteria 8734
207 Ga0307405_10026792 3300031731 Bacteria 3331
208 Ga0307405_10064146 3300031731 Bacteria 2333
209 Ga0307413_10001575 3300031824 Bacteria 8783
210 Ga0307413_10016889 3300031824 Bacteria 3787
211 Ga0307413_10017716 3300031824 Bacteria 3717
212 Ga0307413_10025357 3300031824 Bacteria 3249
213 Ga0307413_10093521 3300031824 Bacteria 1965
214 Ga0307413_10104722 3300031824 Bacteria 1879
215 Ga0307413_10211140 3300031824 Bacteria 1410
216 Ga0307410_10000955 3300031852 Bacteria 12399
217 Ga0307410_10001610 3300031852 Bacteria 10362
218 Ga0307410_10018918 3300031852 Bacteria 4176
219 Ga0307410_10026028 3300031852 Bacteria 3677
220 Ga0307410_10026238 3300031852 Bacteria 3665
221 Ga0307410_10037420 3300031852 Bacteria 3169
222 Ga0307410_10067165 3300031852 Bacteria 2473
223 Ga0307410_10126408 3300031852 Bacteria 1872
224 Ga0307406_10082011 3300031901 Bacteria 2146
225 Ga0307406_10239003 3300031901 Bacteria 1361
226 Ga0307407_10017979 3300031903 Bacteria 3562
227 Ga0307407_10022660 3300031903 Bacteria 3264
228 Ga0307407_10044802 3300031903 Bacteria 2496
229 Ga0307407_10089700 3300031903 Bacteria 1881
230 Ga0307407_10386717 3300031903 Bacteria 1000
231 Ga0307412_10009717 3300031911 Bacteria 5525
232 Ga0307412_10013657 3300031911 Bacteria 4770
233 Ga0307412_10056030 3300031911 Bacteria 2625
234 Ga0307412_10354414 3300031911 Bacteria 1179
235 Ga0307409_100000527 3300031995 Bacteria 16577
236 Ga0307409_100000928 3300031995 Bacteria 13639
237 Ga0307409_100012135 3300031995 Bacteria 5474
238 Ga0307409_100014023 3300031995 Bacteria 5191
239 Ga0307409_100075583 3300031995 Bacteria 2698
240 Ga0307409_100327407 3300031995 Bacteria 1436
241 Ga0307416_100009961 3300032002 Bacteria 6254
242 Ga0307416_100016512 3300032002 Bacteria 5134
243 Ga0307416_100018674 3300032002 Bacteria 4893
244 Ga0307416_100056925 3300032002 Bacteria 3159
245 Ga0307416_100065836 3300032002 Bacteria 2980
246 Ga0307416_100167043 3300032002 Bacteria 2042
247 Ga0307416_100175941 3300032002 Bacteria 1999
248 Ga0307416_100295608 3300032002 Bacteria 1606
249 Ga0307416_100415426 3300032002 Bacteria 1387
250 Ga0307414_10002424 3300032004 Bacteria 9752
251 Ga0307414_10018787 3300032004 Bacteria 4266
252 Ga0307414_10034909 3300032004 Bacteria 3340
253 Ga0307414_10115317 3300032004 Bacteria 2054
254 Ga0307414_10269036 3300032004 Bacteria 1426
255 Ga0307414_10370931 3300032004 Bacteria 1234
256 Ga0307414_10454318 3300032004 Bacteria 1124
257 Ga0307411_10000789 3300032005 Bacteria 11762
258 Ga0307411_10002364 3300032005 Bacteria 8297
259 Ga0307411_10003274 3300032005 Bacteria 7475
260 Ga0307411_10008735 3300032005 Bacteria 5269
261 Ga0307411_10010123 3300032005 Bacteria 5006
262 Ga0307411_10013756 3300032005 Bacteria 4479
263 Ga0307411_10030356 3300032005 Bacteria 3312
264 Ga0307411_10039958 3300032005 Bacteria 2972
265 Ga0307411_10044772 3300032005 Bacteria 2841
266 Ga0307411_10056401 3300032005 Bacteria 2589
267 Ga0307411_10075516 3300032005 Bacteria 2301
268 Ga0307411_10345356 3300032005 Bacteria 1211
269 Ga0307415_100005302 3300032126 Bacteria 6826
270 Ga0307415_100018792 3300032126 Bacteria 4183
271 Ga0307415_100034044 3300032126 Bacteria 3312
272 Ga0307415_100080324 3300032126 Bacteria 2326
273 Ga0307415_100099534 3300032126 Bacteria 2128
274 Ga0307415_100101909 3300032126 Bacteria 2108
275 Ga0307415_100204322 3300032126 Bacteria 1570
276 Ga0307415_100258368 3300032126 Bacteria 1419
277 Ga0373924_0034441 3300035410 Bacteria 2050
278 Ga0373931_0042017 3300035691 Bacteria 2403
279 Ga0373937_0053865 3300036401 Bacteria 3690
280 Ga0373925_0013194 3300037068 Bacteria 5981
281 Ga0395899_0000625 3300037312 Bacteria 36841
282 Ga0395899_0054410 3300037312 Bacteria 2961
283 Ga0395899_0229826 3300037312 Bacteria 1281
284 Ga0395900_0000368 3300037418 Bacteria 64936
285 Ga0395900_0000487 3300037418 Bacteria 56286
286 Ga0395900_0011655 3300037418 Bacteria 8994
287 Ga0395900_0017485 3300037418 Bacteria 7319
288 Ga0395900_0190817 3300037418 Bacteria 2078
289 Ga0395900_0345641 3300037418 Bacteria 1462
290 Ga0395898_0089142 3300037466 Bacteria 2969
291 Ga0395898_0093082 3300037466 Bacteria 2897
292 Ga0395898_0226724 3300037466 Bacteria 1782
293 Ga0395905_0000136 3300037471 Bacteria 121009
294 Ga0395905_0000165 3300037471 Bacteria 109385
295 Ga0395905_0058635 3300037471 Bacteria 3600
296 Ga0395905_0080946 3300037471 Bacteria 3044
297 Ga0395905_0083359 3300037471 Bacteria 2995
298 Ga0395905_0107100 3300037471 Bacteria 2624
299 Ga0395905_0206767 3300037471 Bacteria 1840
300 Ga0436364_0553893 3300037853 Bacteria 1234
301 Ga0395901_0000064 3300038443 Bacteria 147477
302 Ga0395901_0000726 3300038443 Bacteria 37460
303 Ga0395901_0240740 3300038443 Bacteria 1887
304 Ga0395901_0241730 3300038443 Bacteria 1883
305 Ga0395901_0273428 3300038443 Bacteria 1757
306 Ga0400483_072280 3300039062 Bacteria 5533
307 Ga0400483_075161 3300039062 Bacteria 103046
308 Ga0400483_105415 3300039062 Bacteria 25489
309 Ga0400483_107214 3300039062 Bacteria 7059
310 Ga0400483_157736 3300039062 Bacteria 6853
311 Ga0400483_194331 3300039062 Bacteria 23045
312 Ga0400483_227307 3300039062 Bacteria 4577
313 Ga0400483_265160 3300039062 Bacteria 2242
314 Ga0436365_0969411 3300039437 Bacteria 2143
315 Ga0451853_3155702 3300041512 Bacteria 1294
316 Ga0466969_0000553 3300044656 Bacteria 20545
317 Ga0466965_0105328 3300044683 Bacteria 1446
318 Ga0466966_0000701 3300044684 Bacteria 21320
319 Ga0466966_0020323 3300044684 Bacteria 4368
320 Ga0466961_0002006 3300044693 Bacteria 12657
321 Ga0466971_0000434 3300044719 Bacteria 16357
322 Ga0466970_0002099 3300044765 Bacteria 9625
323 Ga0466970_0082384 3300044765 Bacteria 1740
324 Ga0466957_0000699 3300044842 Bacteria 17153
325 Ga0466959_0000100 3300045049 Bacteria 54979
326 Ga0466959_0109064 3300045049 Bacteria 1977
327 Ga0466958_0007763 3300045836 Bacteria 5919
328 Ga0466967_0101058 3300045976 Bacteria 2635
329 Ga0495627_000489 3300046453 Bacteria 33226
330 Ga0495650_0015607 3300046471 Bacteria 3887
331 Ga0495610_0000556 3300046512 Bacteria 37327
332 Ga0495616_0030451 3300046513 Bacteria 2836
333 Ga0495620_0000351 3300046515 Bacteria 31904
334 Ga0495643_0000039 3300046522 Bacteria 235175
335 Ga0495597_0000028 3300046542 Bacteria 137215
336 Ga0495645_0095802 3300046543 Bacteria 2115
337 Ga0495633_0152786 3300046558 Bacteria 1066
338 Ga0495668_0000024 3300046616 Bacteria 359469
339 Ga0495668_0016136 3300046616 Bacteria 4345
340 Ga0495659_0021668 3300046664 Bacteria 2168
341 Ga0495658_0061095 3300046683 Bacteria 2163
342 Ga0495672_0008996 3300047320 Bacteria 7286
343 Ga0495673_0059321 3300047469 Bacteria 1645
344 Ga0495681_0000269 3300047470 Bacteria 41587
345 Ga0495615_0000011 3300048090 Bacteria 65444
346 Ga0496100_0045218 3300048903 Bacteria 2825
347 Ga0496101_0021178 3300048904 Bacteria 4463
348 Ga0496102_0555307 3300048905 Bacteria 1071
349 Ga0496104_0003273 3300048907 Bacteria 13976
350 Ga0496105_0031876 3300048908 Bacteria 4322
351 Ga0496106_0001852 3300048909 Bacteria 15826
352 Ga0496107_0001923 3300048910 Bacteria 13183
353 Ga0496107_0138290 3300048910 Bacteria 1800
354 Ga0496108_0081329 3300048911 Bacteria 2745
355 Ga0496108_0276147 3300048911 Bacteria 1463
356 Ga0496109_0522746 3300048912 Bacteria 1120
357 Ga0496112_0000224 3300048915 Bacteria 36869
358 Ga0496113_0000456 3300048916 Bacteria 19887
359 Ga0496114_0051712 3300048917 Bacteria 3421
360 Ga0496115_0111435 3300048918 Bacteria 2248
361 Ga0496117_0007760 3300048920 Bacteria 10363
362 Ga0496118_0015971 3300048921 Bacteria 6915
363 Ga0496119_0000562 3300048922 Bacteria 50080
364 Ga0496120_0000122 3300048923 Bacteria 130209
365 Ga0496121_0003153 3300048924 Bacteria 23785
366 Ga0496121_0041765 3300048924 Bacteria 4003
367 Ga0496121_0074298 3300048924 Bacteria 2720
368 Ga0496122_0003557 3300048925 Bacteria 20365
369 Ga0496123_0001182 3300048926 Bacteria 38436
370 Ga0496123_0040630 3300048926 Bacteria 3236
371 Ga0496124_0000007 3300048927 Bacteria 883534
372 Ga0496124_0000273 3300048927 Bacteria 99505
373 Ga0496124_0028325 3300048927 Bacteria 5013
374 Ga0496124_0051145 3300048927 Bacteria 3516
375 Ga0496125_0048198 3300048928 Bacteria 3555
376 Ga0501290_002776 3300049513 Bacteria 2240
377 Ga0501292_000001 3300049515 Bacteria 211592
378 Ga0501293_001185 3300049516 Bacteria 1958
379 Ga0501294_000918 3300049517 Bacteria 3160
380 Ga0501297_002396 3300049520 Bacteria 1810
381 Ga0501300_001437 3300049523 Bacteria 3567
382 Ga0501033_0101958 3300049570 Bacteria 2094
383 Ga0501033_0137577 3300049570 Bacteria 1767
384 Ga0501034_0000050 3300049571 Bacteria 213092
385 Ga0501034_0025425 3300049571 Bacteria 6028
386 Ga0501034_0157725 3300049571 Bacteria 2242
387 Ga0501034_0260901 3300049571 Bacteria 1675
388 Ga0501038_0356546 3300049574 Bacteria 1138
389 Ga0501043_0096021 3300049579 Bacteria 2330
390 Ga0501046_0188343 3300049580 Bacteria 1540
391 Ga0501047_0000176 3300049581 Bacteria 78742
392 Ga0501047_0002464 3300049581 Bacteria 17651
393 Ga0501206_001012 3300049653 Bacteria 3507
394 Ga0501223_001012 3300049663 Bacteria 6639
395 Ga0501224_000103 3300049664 Bacteria 9013
396 Ga0501227_001743 3300049665 Bacteria 4824
397 Ga0501233_001311 3300049668 Bacteria 4251
398 Ga0501235_000098 3300049669 Bacteria 13771
399 Ga0501257_000043 3300049686 Bacteria 36418
400 Ga0501259_001065 3300049688 Bacteria 4585
401 Ga0501261_000008 3300049690 Bacteria 58609
402 Ga0501221_000797 3300049704 Bacteria 5108
403 Ga0501225_0000622 3300049705 Bacteria 11051
404 Ga0501279_000001 3300049775 Bacteria 299671
405 Ga0501280_000600 3300049776 Bacteria 8256
406 Ga0501280_001292 3300049776 Bacteria 4815
407 Ga0501281_00043 3300049777 Bacteria 14744
408 Ga0501282_000026 3300049778 Bacteria 20814
409 Ga0501035_0008851 3300049822 Bacteria 9366
410 Ga0501035_0010206 3300049822 Bacteria 8715
411 Ga0501035_0022709 3300049822 Bacteria 5762
412 Ga0501035_0273236 3300049822 Bacteria 1430
413 Ga0501044_0000022 3300049823 Bacteria 201689
414 Ga0501044_0024648 3300049823 Bacteria 6383
415 nmdc:mga0yw44_1367_c2 3300050492 Bacteria 6429
416 Ga0500635_0002879 3300053080 Bacteria 4278
417 Ga0500643_000001 3300053087 Bacteria 1440111
418 Ga0500641_0004502 3300053096 Bacteria 4925
419 Ga0500594_0002137 3300053118 Bacteria 4274
420 Ga0500608_001168 3300053122 Bacteria 9346
421 Ga0500608_002285 3300053122 Bacteria 6938
422 Ga0500559_0021172 3300053136 Bacteria 2754
423 Ga0500559_0180315 3300053136 Bacteria 995
424 Ga0500564_002986 3300053138 Bacteria 6436
425 Ga0500568_0000207 3300053139 Bacteria 51335
426 Ga0500625_000003 3300053729 Bacteria 268493
427 Ga0466962_0004127 3300061719 Bacteria 6959

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025915 Ga0207693_10375103 Ga0207693_103751032 284
2 3300048926 Ga0496123_0040630 Ga0496123_0040630_2302_3189 291
3 3300049778 Ga0501282_000026 Ga0501282_000026_33_977 291
4 3300053136 Ga0500559_0180315 Ga0500559_0180315_74_973 292
5 3300003794 Ga0055531_10002410 Ga0055531_100024107 293
6 3300053139 Ga0500568_0000207 Ga0500568_0000207_26132_27094 295
7 iso_pu_bacteria 3001892409 3001897272 295
8 3300048924 Ga0496121_0074298 Ga0496121_0074298_1036_1941 296
9 3300044656 Ga0466969_0000553 Ga0466969_0000553_12936_13889 297
10 3300044684 Ga0466966_0000701 Ga0466966_0000701_1051_2004 297
11 3300044693 Ga0466961_0002006 Ga0466961_0002006_4063_5016 297
12 3300044719 Ga0466971_0000434 Ga0466971_0000434_12093_13046 297
13 3300044765 Ga0466970_0002099 Ga0466970_0002099_3947_4900 297
14 3300044842 Ga0466957_0000699 Ga0466957_0000699_12903_13856 297
15 3300045049 Ga0466959_0000100 Ga0466959_0000100_31206_32159 297
16 3300045836 Ga0466958_0007763 Ga0466958_0007763_3914_4867 297
17 3300049579 Ga0501043_0096021 Ga0501043_0096021_1381_2295 297
18 3300061719 Ga0466962_0004127 Ga0466962_0004127_4366_5319 297
19 3300049686 Ga0501257_000043 Ga0501257_000043_11561_12565 298
20 3300049776 Ga0501280_001292 Ga0501280_001292_2494_3498 298
21 3300005614 Ga0068856_100048304 Ga0068856_1000483045 299
22 3300026078 Ga0207702_10121876 Ga0207702_101218762 299
23 3300038443 Ga0395901_0241730 Ga0395901_0241730_339_1244 299
24 3300044683 Ga0466965_0105328 Ga0466965_0105328_91_999 300
25 iso_pu_bacteria 2643221598 2644002215 300
26 3300049570 Ga0501033_0137577 Ga0501033_0137577_301_1260 301
27 3300049581 Ga0501047_0002464 Ga0501047_0002464_16522_17481 301
28 3300049822 Ga0501035_0008851 Ga0501035_0008851_8224_9183 301
29 3300049823 Ga0501044_0024648 Ga0501044_0024648_763_1722 301
30 3300049580 Ga0501046_0188343 Ga0501046_0188343_429_1361 302
31 3300049581 Ga0501047_0000176 Ga0501047_0000176_61395_62327 302
32 iso_pu_bacteria 2854681122 2854684421 302
33 3300005618 Ga0068864_100014840 Ga0068864_1000148405 303
34 3300026088 Ga0207641_10059935 Ga0207641_100599352 303
35 3300053096 Ga0500641_0004502 Ga0500641_0004502_3501_4436 303
36 3300005841 Ga0068863_100000879 Ga0068863_1000008795 305
37 3300031250 Ga0265331_10145771 Ga0265331_101457711 305
38 3300031731 Ga0307405_10000277 Ga0307405_100002778 306
39 iso_pu_bacteria 2643221736 2644746565 306
40 iso_pu_bacteria 2851182111 2851182132 306
41 iso_pu_bacteria 2894772417 2894777084 306
42 iso_pu_bacteria 8057529695 8057535142 306
43 3300005563 Ga0068855_100005574 Ga0068855_1000055749 307
44 3300005563 Ga0068855_100070112 Ga0068855_1000701124 307
45 3300005616 Ga0068852_100094763 Ga0068852_1000947633 307
46 3300025949 Ga0207667_10004924 Ga0207667_1000492414 307
47 3300026142 Ga0207698_10065767 Ga0207698_100657672 307
48 3300031903 Ga0307407_10386717 Ga0307407_103867171 307
49 iso_pu_bacteria 2501025504 2501408712 307
50 iso_pu_bacteria 2510917014 2511098423 307
51 3300005327 Ga0070658_10174274 Ga0070658_101742741 308
52 3300013100 Ga0157373_10082246 Ga0157373_100822462 308
53 3300013105 Ga0157369_10240313 Ga0157369_102403132 308
54 3300013296 Ga0157374_10247691 Ga0157374_102476912 308
55 3300013307 Ga0157372_10044590 Ga0157372_100445902 308
56 3300025284 Ga0209130_1023547 Ga0209130_10235471 308
57 3300025304 Ga0209257_1000130 Ga0209257_100013051 309
58 3300028800 Ga0265338_10126699 Ga0265338_101266992 309
59 3300046513 Ga0495616_0030451 Ga0495616_0030451_1121_2062 309
60 3300046522 Ga0495643_0000039 Ga0495643_0000039_105692_106633 309
61 3300048090 Ga0495615_0000011 Ga0495615_0000011_34634_35575 309
62 3300048925 Ga0496122_0003557 Ga0496122_0003557_5721_6662 309
63 3300048926 Ga0496123_0001182 Ga0496123_0001182_23325_24266 309
64 3300048927 Ga0496124_0028325 Ga0496124_0028325_3328_4269 309
65 3300049571 Ga0501034_0025425 Ga0501034_0025425_131_1084 309
66 3300003322 rootL2_10034672 rootL2_100346726 310
67 3300005444 Ga0070694_100014116 Ga0070694_1000141163 310
68 3300005545 Ga0070695_100044550 Ga0070695_1000445503 310
69 3300035691 Ga0373931_0042017 Ga0373931_0042017_699_1676 310
70 3300037471 Ga0395905_0000136 Ga0395905_0000136_86482_87435 310
71 3300037471 Ga0395905_0083359 Ga0395905_0083359_204_1157 310
72 3300045049 Ga0466959_0109064 Ga0466959_0109064_581_1534 310
73 3300003322 rootL2_10141192 rootL2_101411921 311
74 3300015684 Ga0183365_10004 Ga0183365_10004156 311
75 3300049513 Ga0501290_002776 Ga0501290_002776_38_1042 311
76 3300049515 Ga0501292_000001 Ga0501292_000001_30774_31769 311
77 3300049516 Ga0501293_001185 Ga0501293_001185_827_1831 311
78 3300049517 Ga0501294_000918 Ga0501294_000918_946_1950 311
79 3300049520 Ga0501297_002396 Ga0501297_002396_371_1375 311
80 3300049523 Ga0501300_001437 Ga0501300_001437_458_1453 311
81 3300049570 Ga0501033_0101958 Ga0501033_0101958_549_1505 311
82 3300049571 Ga0501034_0157725 Ga0501034_0157725_397_1353 311
83 3300049653 Ga0501206_001012 Ga0501206_001012_2003_2998 311
84 3300049663 Ga0501223_001012 Ga0501223_001012_5496_6500 311
85 3300049664 Ga0501224_000103 Ga0501224_000103_4840_5844 311
86 3300049665 Ga0501227_001743 Ga0501227_001743_3577_4572 311
87 3300049668 Ga0501233_001311 Ga0501233_001311_1636_2640 311
88 3300049669 Ga0501235_000098 Ga0501235_000098_4765_5769 311
89 3300049688 Ga0501259_001065 Ga0501259_001065_2648_3643 311
90 3300049690 Ga0501261_000008 Ga0501261_000008_46580_47575 311
91 3300049704 Ga0501221_000797 Ga0501221_000797_1443_2447 311
92 3300049705 Ga0501225_0000622 Ga0501225_0000622_8806_9810 311
93 3300049775 Ga0501279_000001 Ga0501279_000001_30636_31631 311
94 3300049776 Ga0501280_000600 Ga0501280_000600_4796_5800 311
95 3300049777 Ga0501281_00043 Ga0501281_00043_8987_9991 311
96 3300049822 Ga0501035_0010206 Ga0501035_0010206_6714_7673 311
97 3300053080 Ga0500635_0002879 Ga0500635_0002879_3263_4210 311
98 3300053118 Ga0500594_0002137 Ga0500594_0002137_34_1023 311
99 iso_pu_bacteria 2881412998 2881413975 311
100 3300007265 Ga0099794_10138403 Ga0099794_101384031 312
101 3300047320 Ga0495672_0008996 Ga0495672_0008996_4076_5041 312
102 3300049571 Ga0501034_0260901 Ga0501034_0260901_159_1118 312
103 3300053122 Ga0500608_002285 Ga0500608_002285_3658_4617 312
104 iso_pu_bacteria 2857542790 2857544435 313
105 iso_pu_bacteria 3007619802 3007625558 313
106 3300005293 Ga0065715_10089715 Ga0065715_100897157 314
107 3300005356 Ga0070674_100042317 Ga0070674_1000423172 314
108 3300005617 Ga0068859_100061424 Ga0068859_1000614242 314
109 3300006931 Ga0097620_100061421 Ga0097620_1000614212 314
110 3300025937 Ga0207669_10082962 Ga0207669_100829622 314
111 3300031731 Ga0307405_10002071 Ga0307405_100020712 314
112 3300031731 Ga0307405_10064146 Ga0307405_100641461 314
113 3300031911 Ga0307412_10056030 Ga0307412_100560302 314
114 3300032002 Ga0307416_100167043 Ga0307416_1001670433 314
115 3300032004 Ga0307414_10370931 Ga0307414_103709312 314
116 3300032005 Ga0307411_10002364 Ga0307411_100023641 314
117 3300032126 Ga0307415_100204322 Ga0307415_1002043222 314
118 iso_pu_bacteria 2881101125 2881104482 314
119 iso_pu_bacteria 2882806704 2882807903 314
120 iso_pu_bacteria 2895880812 2895882552 314
121 iso_pu_bacteria 8002392321 8002392695 314
122 3300003187 JGI25151J46595_10000254 JGI25151J46595_1000025450 315
123 3300005328 Ga0070676_10015937 Ga0070676_100159373 315
124 3300005347 Ga0070668_100072270 Ga0070668_1000722702 315
125 3300005455 Ga0070663_100269137 Ga0070663_1002691371 315
126 3300005457 Ga0070662_100180836 Ga0070662_1001808362 315
127 3300005843 Ga0068860_100520570 Ga0068860_1005205701 315
128 3300006175 Ga0070712_100057586 Ga0070712_1000575861 315
129 3300006844 Ga0075428_100160286 Ga0075428_1001602863 315
130 3300009177 Ga0105248_10131246 Ga0105248_101312463 315
131 3300025294 Ga0209025_1000003 Ga0209025_10000031085 315
132 3300025931 Ga0207644_10223553 Ga0207644_102235532 315
133 3300025933 Ga0207706_10255253 Ga0207706_102552532 315
134 3300025972 Ga0207668_10093534 Ga0207668_100935342 315
135 3300026075 Ga0207708_10114884 Ga0207708_101148842 315
136 3300027665 Ga0209983_1024233 Ga0209983_10242332 315
137 3300028381 Ga0268264_10386004 Ga0268264_103860041 315
138 3300031235 Ga0265330_10046353 Ga0265330_100463531 315
139 3300031239 Ga0265328_10031391 Ga0265328_100313912 315
140 3300031548 Ga0307408_100009214 Ga0307408_10000921410 315
141 3300031548 Ga0307408_100199850 Ga0307408_1001998502 315
142 3300031548 Ga0307408_100229679 Ga0307408_1002296792 315
143 3300031731 Ga0307405_10026792 Ga0307405_100267923 315
144 3300031824 Ga0307413_10001575 Ga0307413_100015752 315
145 3300031824 Ga0307413_10017716 Ga0307413_100177163 315
146 3300031824 Ga0307413_10025357 Ga0307413_100253573 315
147 3300031824 Ga0307413_10093521 Ga0307413_100935212 315
148 3300031824 Ga0307413_10104722 Ga0307413_101047223 315
149 3300031852 Ga0307410_10000955 Ga0307410_1000095511 315
150 3300031852 Ga0307410_10001610 Ga0307410_1000161011 315
151 3300031852 Ga0307410_10018918 Ga0307410_100189183 315
152 3300031852 Ga0307410_10026238 Ga0307410_100262383 315
153 3300031852 Ga0307410_10037420 Ga0307410_100374204 315
154 3300031852 Ga0307410_10067165 Ga0307410_100671653 315
155 3300031852 Ga0307410_10126408 Ga0307410_101264083 315
156 3300031901 Ga0307406_10082011 Ga0307406_100820113 315
157 3300031901 Ga0307406_10239003 Ga0307406_102390032 315
158 3300031903 Ga0307407_10017979 Ga0307407_100179792 315
159 3300031903 Ga0307407_10022660 Ga0307407_100226603 315
160 3300031903 Ga0307407_10044802 Ga0307407_100448023 315
161 3300031903 Ga0307407_10089700 Ga0307407_100897002 315
162 3300031911 Ga0307412_10009717 Ga0307412_100097173 315
163 3300031911 Ga0307412_10013657 Ga0307412_100136575 315
164 3300031995 Ga0307409_100000527 Ga0307409_10000052710 315
165 3300031995 Ga0307409_100000928 Ga0307409_1000009285 315
166 3300031995 Ga0307409_100075583 Ga0307409_1000755833 315
167 3300031995 Ga0307409_100327407 Ga0307409_1003274072 315
168 3300032002 Ga0307416_100016512 Ga0307416_1000165123 315
169 3300032002 Ga0307416_100018674 Ga0307416_1000186743 315
170 3300032002 Ga0307416_100065836 Ga0307416_1000658362 315
171 3300032002 Ga0307416_100175941 Ga0307416_1001759412 315
172 3300032002 Ga0307416_100295608 Ga0307416_1002956082 315
173 3300032002 Ga0307416_100415426 Ga0307416_1004154262 315
174 3300032004 Ga0307414_10002424 Ga0307414_100024245 315
175 3300032004 Ga0307414_10018787 Ga0307414_100187872 315
176 3300032004 Ga0307414_10034909 Ga0307414_100349092 315
177 3300032004 Ga0307414_10115317 Ga0307414_101153172 315
178 3300032004 Ga0307414_10269036 Ga0307414_102690362 315
179 3300032005 Ga0307411_10000789 Ga0307411_100007899 315
180 3300032005 Ga0307411_10008735 Ga0307411_100087353 315
181 3300032005 Ga0307411_10013756 Ga0307411_100137565 315
182 3300032005 Ga0307411_10030356 Ga0307411_100303562 315
183 3300032005 Ga0307411_10039958 Ga0307411_100399582 315
184 3300032005 Ga0307411_10044772 Ga0307411_100447723 315
185 3300032005 Ga0307411_10056401 Ga0307411_100564012 315
186 3300032005 Ga0307411_10075516 Ga0307411_100755163 315
187 3300032005 Ga0307411_10345356 Ga0307411_103453561 315
188 3300032126 Ga0307415_100005302 Ga0307415_1000053027 315
189 3300032126 Ga0307415_100034044 Ga0307415_1000340445 315
190 3300032126 Ga0307415_100080324 Ga0307415_1000803242 315
191 3300032126 Ga0307415_100101909 Ga0307415_1001019092 315
192 3300032126 Ga0307415_100258368 Ga0307415_1002583682 315
193 3300035410 Ga0373924_0034441 Ga0373924_0034441_398_1369 315
194 3300036401 Ga0373937_0053865 Ga0373937_0053865_563_1534 315
195 3300037312 Ga0395899_0229826 Ga0395899_0229826_46_999 315
196 3300037418 Ga0395900_0000487 Ga0395900_0000487_15367_16320 315
197 3300037471 Ga0395905_0000165 Ga0395905_0000165_23633_24586 315
198 3300037471 Ga0395905_0206767 Ga0395905_0206767_323_1276 315
199 3300038443 Ga0395901_0000726 Ga0395901_0000726_29189_30142 315
200 3300046543 Ga0495645_0095802 Ga0495645_0095802_361_1332 315
201 3300046664 Ga0495659_0021668 Ga0495659_0021668_1159_2112 315
202 3300046683 Ga0495658_0061095 Ga0495658_0061095_272_1243 315
203 3300048905 Ga0496102_0555307 Ga0496102_0555307_56_1051 315
204 3300048910 Ga0496107_0138290 Ga0496107_0138290_271_1266 315
205 3300048912 Ga0496109_0522746 Ga0496109_0522746_18_983 315
206 3300003763 Ga0055529_1001556 Ga0055529_10015562 316
207 3300005548 Ga0070665_100188906 Ga0070665_1001889062 316
208 3300005841 Ga0068863_100188783 Ga0068863_1001887832 316
209 3300006944 Ga0099823_1001313 Ga0099823_10013135 316
210 3300025228 Ga0209672_104071 Ga0209672_1040712 316
211 3300025272 Ga0209455_1000566 Ga0209455_10005669 316
212 3300026088 Ga0207641_10164374 Ga0207641_101643742 316
213 3300027296 Ga0209389_1000054 Ga0209389_100005492 316
214 3300031824 Ga0307413_10016889 Ga0307413_100168892 316
215 3300031824 Ga0307413_10211140 Ga0307413_102111402 316
216 3300031852 Ga0307410_10026028 Ga0307410_100260284 316
217 3300031911 Ga0307412_10354414 Ga0307412_103544141 316
218 3300031995 Ga0307409_100012135 Ga0307409_1000121356 316
219 3300032002 Ga0307416_100056925 Ga0307416_1000569253 316
220 3300032004 Ga0307414_10454318 Ga0307414_104543181 316
221 3300032005 Ga0307411_10003274 Ga0307411_100032747 316
222 3300032005 Ga0307411_10010123 Ga0307411_100101235 316
223 3300032126 Ga0307415_100018792 Ga0307415_1000187923 316
224 3300032126 Ga0307415_100099534 Ga0307415_1000995343 316
225 3300037853 Ga0436364_0553893 Ga0436364_0553893_119_1144 316
226 3300039062 Ga0400483_072280 Ga0400483_072280_3417_4373 316
227 3300039062 Ga0400483_157736 Ga0400483_157736_5258_6214 316
228 3300046453 Ga0495627_000489 Ga0495627_000489_3830_4792 316
229 3300046471 Ga0495650_0015607 Ga0495650_0015607_1451_2413 316
230 3300046512 Ga0495610_0000556 Ga0495610_0000556_33791_34753 316
231 3300046515 Ga0495620_0000351 Ga0495620_0000351_2574_3536 316
232 3300046558 Ga0495633_0152786 Ga0495633_0152786_61_1023 316
233 3300047469 Ga0495673_0059321 Ga0495673_0059321_628_1590 316
234 3300047470 Ga0495681_0000269 Ga0495681_0000269_2494_3456 316
235 3300048927 Ga0496124_0000007 Ga0496124_0000007_751335_752303 316
236 3300049574 Ga0501038_0356546 Ga0501038_0356546_105_1061 316
237 3300049822 Ga0501035_0022709 Ga0501035_0022709_3138_4094 316
238 3300049822 Ga0501035_0273236 Ga0501035_0273236_131_1087 316
239 3300049823 Ga0501044_0000022 Ga0501044_0000022_20114_21070 316
240 3300005289 Ga0065704_10127118 Ga0065704_101271181 317
241 3300005327 Ga0070658_10009711 Ga0070658_100097117 317
242 3300005329 Ga0070683_100007757 Ga0070683_1000077573 317
243 3300005339 Ga0070660_100050854 Ga0070660_1000508544 317
244 3300005339 Ga0070660_100069080 Ga0070660_1000690803 317
245 3300005344 Ga0070661_100055710 Ga0070661_1000557102 317
246 3300005345 Ga0070692_10030862 Ga0070692_100308623 317
247 3300005455 Ga0070663_100001996 Ga0070663_1000019965 317
248 3300005535 Ga0070684_100114847 Ga0070684_1001148472 317
249 3300005563 Ga0068855_100045610 Ga0068855_1000456106 317
250 3300005614 Ga0068856_100033987 Ga0068856_1000339872 317
251 3300005616 Ga0068852_100060863 Ga0068852_1000608632 317
252 3300006175 Ga0070712_100221655 Ga0070712_1002216552 317
253 3300025904 Ga0207647_10081285 Ga0207647_100812852 317
254 3300025909 Ga0207705_10003893 Ga0207705_1000389314 317
255 3300025909 Ga0207705_10120232 Ga0207705_101202323 317
256 3300025919 Ga0207657_10005822 Ga0207657_100058222 317
257 3300025932 Ga0207690_10017465 Ga0207690_100174652 317
258 3300025945 Ga0207679_10150313 Ga0207679_101503132 317
259 3300026067 Ga0207678_10003655 Ga0207678_100036558 317
260 3300026116 Ga0207674_10081914 Ga0207674_100819142 317
261 3300026142 Ga0207698_10275417 Ga0207698_102754172 317
262 3300028381 Ga0268264_10032223 Ga0268264_100322235 317
263 3300028381 Ga0268264_10108028 Ga0268264_101080282 317
264 3300031995 Ga0307409_100014023 Ga0307409_1000140232 317
265 3300032002 Ga0307416_100009961 Ga0307416_1000099612 317
266 3300037312 Ga0395899_0000625 Ga0395899_0000625_6698_7669 317
267 3300037312 Ga0395899_0054410 Ga0395899_0054410_155_1126 317
268 3300037418 Ga0395900_0000368 Ga0395900_0000368_11849_12820 317
269 3300037418 Ga0395900_0011655 Ga0395900_0011655_336_1307 317
270 3300037418 Ga0395900_0017485 Ga0395900_0017485_2015_2986 317
271 3300037418 Ga0395900_0345641 Ga0395900_0345641_413_1384 317
272 3300037466 Ga0395898_0093082 Ga0395898_0093082_1836_2807 317
273 3300037466 Ga0395898_0226724 Ga0395898_0226724_51_1022 317
274 3300037471 Ga0395905_0058635 Ga0395905_0058635_2513_3484 317
275 3300037471 Ga0395905_0080946 Ga0395905_0080946_1496_2455 317
276 3300037471 Ga0395905_0107100 Ga0395905_0107100_313_1284 317
277 3300038443 Ga0395901_0000064 Ga0395901_0000064_52157_53128 317
278 3300038443 Ga0395901_0273428 Ga0395901_0273428_582_1541 317
279 3300039062 Ga0400483_075161 Ga0400483_075161_84697_85656 317
280 3300039062 Ga0400483_105415 Ga0400483_105415_12875_13834 317
281 3300039062 Ga0400483_107214 Ga0400483_107214_2099_3058 317
282 3300039062 Ga0400483_194331 Ga0400483_194331_7613_8572 317
283 3300039062 Ga0400483_227307 Ga0400483_227307_2359_3318 317
284 3300039437 Ga0436365_0969411 Ga0436365_0969411_987_1964 317
285 3300005327 Ga0070658_10046890 Ga0070658_100468905 318
286 3300005333 Ga0070677_10004231 Ga0070677_100042315 318
287 3300005366 Ga0070659_100142302 Ga0070659_1001423022 318
288 3300005457 Ga0070662_100011928 Ga0070662_1000119284 318
289 3300005458 Ga0070681_10184987 Ga0070681_101849872 318
290 3300005563 Ga0068855_100097806 Ga0068855_1000978062 318
291 3300005578 Ga0068854_100007618 Ga0068854_1000076185 318
292 3300006195 Ga0075366_10019960 Ga0075366_100199602 318
293 3300009148 Ga0105243_10157747 Ga0105243_101577471 318
294 3300013100 Ga0157373_10005394 Ga0157373_100053944 318
295 3300013102 Ga0157371_10008644 Ga0157371_100086443 318
296 3300013102 Ga0157371_10016732 Ga0157371_100167322 318
297 3300013102 Ga0157371_10032979 Ga0157371_100329794 318
298 3300025909 Ga0207705_10023911 Ga0207705_100239114 318
299 3300025912 Ga0207707_10157931 Ga0207707_101579313 318
300 3300025917 Ga0207660_10076283 Ga0207660_100762832 318
301 3300025919 Ga0207657_10000553 Ga0207657_1000055313 318
302 3300025932 Ga0207690_10272462 Ga0207690_102724622 318
303 3300025933 Ga0207706_10001551 Ga0207706_1000155115 318
304 3300025949 Ga0207667_10082347 Ga0207667_100823471 318
305 3300026121 Ga0207683_10224928 Ga0207683_102249282 318
306 3300037418 Ga0395900_0190817 Ga0395900_0190817_497_1459 318
307 3300037466 Ga0395898_0089142 Ga0395898_0089142_960_1922 318
308 3300038443 Ga0395901_0240740 Ga0395901_0240740_68_1030 318
309 3300039062 Ga0400483_265160 Ga0400483_265160_131_1111 318
310 3300044684 Ga0466966_0020323 Ga0466966_0020323_2936_3907 318
311 3300044765 Ga0466970_0082384 Ga0466970_0082384_460_1431 318
312 3300045976 Ga0466967_0101058 Ga0466967_0101058_441_1406 318
313 3300046616 Ga0495668_0000024 Ga0495668_0000024_160808_161779 318
314 3300046616 Ga0495668_0016136 Ga0495668_0016136_2370_3332 318
315 3300048911 Ga0496108_0276147 Ga0496108_0276147_312_1292 318
316 3300053087 Ga0500643_000001 Ga0500643_000001_1290994_1291974 318
317 3300053122 Ga0500608_001168 Ga0500608_001168_4952_5929 318
318 3300053136 Ga0500559_0021172 Ga0500559_0021172_778_1755 318
319 3300053138 Ga0500564_002986 Ga0500564_002986_1572_2549 318
320 3300053729 Ga0500625_000003 Ga0500625_000003_25876_26853 318
321 3300002459 JGI24751J29686_10000084 JGI24751J29686_1000008430 319
322 3300003187 JGI25151J46595_10008014 JGI25151J46595_100080144 319
323 3300005295 Ga0065707_10002266 Ga0065707_100022662 319
324 3300005295 Ga0065707_10084019 Ga0065707_100840194 319
325 3300005330 Ga0070690_100158905 Ga0070690_1001589052 319
326 3300005335 Ga0070666_10165239 Ga0070666_101652391 319
327 3300005336 Ga0070680_100053641 Ga0070680_1000536411 319
328 3300005347 Ga0070668_100000378 Ga0070668_1000003787 319
329 3300005347 Ga0070668_100050894 Ga0070668_1000508943 319
330 3300005353 Ga0070669_100015974 Ga0070669_1000159743 319
331 3300005355 Ga0070671_100000063 Ga0070671_10000006310 319
332 3300005366 Ga0070659_100072225 Ga0070659_1000722252 319
333 3300005367 Ga0070667_100000145 Ga0070667_10000014518 319
334 3300005367 Ga0070667_100001147 Ga0070667_10000114711 319
335 3300005367 Ga0070667_100101350 Ga0070667_1001013503 319
336 3300005458 Ga0070681_10002051 Ga0070681_100020516 319
337 3300005547 Ga0070693_100094428 Ga0070693_1000944282 319
338 3300005614 Ga0068856_100170121 Ga0068856_1001701212 319
339 3300005618 Ga0068864_100035398 Ga0068864_1000353982 319
340 3300005841 Ga0068863_100000723 Ga0068863_10000072326 319
341 3300005841 Ga0068863_100001090 Ga0068863_10000109014 319
342 3300005842 Ga0068858_100031035 Ga0068858_1000310352 319
343 3300005843 Ga0068860_100000942 Ga0068860_10000094226 319
344 3300005843 Ga0068860_100010487 Ga0068860_1000104875 319
345 3300005843 Ga0068860_100020207 Ga0068860_1000202076 319
346 3300005843 Ga0068860_100160958 Ga0068860_1001609582 319
347 3300005937 Ga0081455_10010851 Ga0081455_1001085111 319
348 3300009093 Ga0105240_10003877 Ga0105240_1000387722 319
349 3300009177 Ga0105248_10131600 Ga0105248_101316002 319
350 3300009177 Ga0105248_10713608 Ga0105248_107136082 319
351 3300009551 Ga0105238_10129088 Ga0105238_101290881 319
352 3300009553 Ga0105249_10008804 Ga0105249_100088045 319
353 3300009553 Ga0105249_10249860 Ga0105249_102498602 319
354 3300013306 Ga0163162_10013412 Ga0163162_100134125 319
355 3300013306 Ga0163162_10014423 Ga0163162_100144236 319
356 3300014326 Ga0157380_10000486 Ga0157380_1000048612 319
357 3300014968 Ga0157379_10000433 Ga0157379_1000043315 319
358 3300025294 Ga0209025_1000113 Ga0209025_1000113144 319
359 3300025711 Ga0207696_1000150 Ga0207696_100015061 319
360 3300025903 Ga0207680_10014274 Ga0207680_100142745 319
361 3300025903 Ga0207680_10113710 Ga0207680_101137101 319
362 3300025912 Ga0207707_10084997 Ga0207707_100849972 319
363 3300025913 Ga0207695_10283589 Ga0207695_102835891 319
364 3300025919 Ga0207657_10119756 Ga0207657_101197562 319
365 3300025919 Ga0207657_10156183 Ga0207657_101561831 319
366 3300025921 Ga0207652_10077776 Ga0207652_100777764 319
367 3300025923 Ga0207681_10043239 Ga0207681_100432393 319
368 3300025923 Ga0207681_10238308 Ga0207681_102383081 319
369 3300025931 Ga0207644_10000075 Ga0207644_1000007548 319
370 3300025941 Ga0207711_10153616 Ga0207711_101536162 319
371 3300025949 Ga0207667_10067632 Ga0207667_100676326 319
372 3300025972 Ga0207668_10000022 Ga0207668_10000022104 319
373 3300025986 Ga0207658_10000021 Ga0207658_1000002166 319
374 3300025986 Ga0207658_10000103 Ga0207658_1000010314 319
375 3300025986 Ga0207658_10227609 Ga0207658_102276092 319
376 3300026035 Ga0207703_10413257 Ga0207703_104132572 319
377 3300026088 Ga0207641_10000040 Ga0207641_1000004064 319
378 3300026088 Ga0207641_10000344 Ga0207641_1000034434 319
379 3300026095 Ga0207676_10132263 Ga0207676_101322631 319
380 3300028380 Ga0268265_10135584 Ga0268265_101355842 319
381 3300028381 Ga0268264_10000351 Ga0268264_1000035147 319
382 3300028381 Ga0268264_10076748 Ga0268264_100767481 319
383 3300028381 Ga0268264_10132201 Ga0268264_101322012 319
384 3300028381 Ga0268264_10181111 Ga0268264_101811112 319
385 3300037068 Ga0373925_0013194 Ga0373925_0013194_4175_5203 319
386 3300048903 Ga0496100_0045218 Ga0496100_0045218_160_1137 319
387 3300048904 Ga0496101_0021178 Ga0496101_0021178_3180_4157 319
388 3300048907 Ga0496104_0003273 Ga0496104_0003273_3029_4006 319
389 3300048908 Ga0496105_0031876 Ga0496105_0031876_1103_2080 319
390 3300048909 Ga0496106_0001852 Ga0496106_0001852_4132_5109 319
391 3300048910 Ga0496107_0001923 Ga0496107_0001923_10820_11797 319
392 3300048911 Ga0496108_0081329 Ga0496108_0081329_892_1869 319
393 3300048915 Ga0496112_0000224 Ga0496112_0000224_4773_5750 319
394 3300048916 Ga0496113_0000456 Ga0496113_0000456_9960_10937 319
395 3300048917 Ga0496114_0051712 Ga0496114_0051712_175_1164 319
396 3300048918 Ga0496115_0111435 Ga0496115_0111435_86_1075 319
397 3300048920 Ga0496117_0007760 Ga0496117_0007760_1199_2179 319
398 3300048921 Ga0496118_0015971 Ga0496118_0015971_5299_6279 319
399 3300048922 Ga0496119_0000562 Ga0496119_0000562_47371_48333 319
400 3300048923 Ga0496120_0000122 Ga0496120_0000122_6883_7845 319
401 3300048924 Ga0496121_0003153 Ga0496121_0003153_13870_14847 319
402 3300048924 Ga0496121_0041765 Ga0496121_0041765_2526_3485 319
403 3300048927 Ga0496124_0051145 Ga0496124_0051145_666_1646 319
404 3300049571 Ga0501034_0000050 Ga0501034_0000050_45558_46535 319
405 3300050492 nmdc:mga0yw44_1367_c2 nmdc:mga0yw44_1367_c2_5384_6385 319
406 iso_pu_bacteria 2894023352 2894025389 319
407 3300005841 Ga0068863_100003202 Ga0068863_1000032026 320
408 3300046542 Ga0495597_0000028 Ga0495597_0000028_104038_105048 320
409 3300041512 Ga0451853_3155702 Ga0451853_3155702_14_1078 322
410 3300002074 JGI24748J21848_1001425 JGI24748J21848_10014252 323
411 3300002239 JGI24034J26672_10005569 JGI24034J26672_100055692 323
412 3300002459 JGI24751J29686_10000964 JGI24751J29686_100009642 323
413 3300005295 Ga0065707_10031194 Ga0065707_100311942 323
414 3300005331 Ga0070670_100077680 Ga0070670_1000776802 323
415 3300005335 Ga0070666_10007821 Ga0070666_100078216 323
416 3300005353 Ga0070669_100138922 Ga0070669_1001389222 323
417 3300005355 Ga0070671_100053827 Ga0070671_1000538272 323
418 3300005367 Ga0070667_100017434 Ga0070667_1000174345 323
419 3300005548 Ga0070665_100284735 Ga0070665_1002847352 323
420 3300005617 Ga0068859_100010870 Ga0068859_1000108709 323
421 3300005618 Ga0068864_100011182 Ga0068864_1000111828 323
422 3300005719 Ga0068861_100005587 Ga0068861_1000055872 323
423 3300005841 Ga0068863_100105523 Ga0068863_1001055232 323
424 3300005842 Ga0068858_100001621 Ga0068858_10000162124 323
425 3300005843 Ga0068860_100023541 Ga0068860_1000235416 323
426 3300005844 Ga0068862_100004956 Ga0068862_10000495611 323
427 3300006931 Ga0097620_100010871 Ga0097620_1000108719 323
428 3300009092 Ga0105250_10000029 Ga0105250_10000029112 323
429 3300009553 Ga0105249_10110638 Ga0105249_101106382 323
430 3300025223 Ga0207672_1002161 Ga0207672_10021611 323
431 3300025903 Ga0207680_10005706 Ga0207680_100057066 323
432 3300025925 Ga0207650_10024234 Ga0207650_100242342 323
433 3300025931 Ga0207644_10005717 Ga0207644_100057172 323
434 3300025972 Ga0207668_10000416 Ga0207668_100004162 323
435 3300025986 Ga0207658_10000639 Ga0207658_1000063922 323
436 3300026035 Ga0207703_10001299 Ga0207703_100012992 323
437 3300026088 Ga0207641_10057722 Ga0207641_100577222 323
438 3300026095 Ga0207676_10005543 Ga0207676_100055437 323
439 3300026118 Ga0207675_100034684 Ga0207675_1000346843 323
440 3300028379 Ga0268266_10234457 Ga0268266_102344572 323
441 3300028380 Ga0268265_10000808 Ga0268265_1000080828 323
442 3300028381 Ga0268264_10000214 Ga0268264_10000214112 323
443 3300048927 Ga0496124_0000273 Ga0496124_0000273_49300_50334 323
444 3300048928 Ga0496125_0048198 Ga0496125_0048198_1636_2670 323

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03060

NMO

Nitronate monooxygenase

55

361

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gvj-assembly1.cif.gz_A-2 structure of fabk (m276a) mutant from thermotoga maritima 0.8647 6 322
5gvj-assembly2.cif.gz_B-3 structure of fabk (m276a) mutant from thermotoga maritima 0.8492 6 322
5gvj-assembly1.cif.gz_A-2 structure of fabk (m276a) mutant from thermotoga maritima 0.848 6 322
3bw3-assembly1.cif.gz_A-2 crystal structures and site-directed mutagenesis study of nitroalkane oxidase from streptomyces ansochromogenes 0.8461 11 319
2z6j-assembly1.cif.gz_A crystal structure of s. pneumoniae enoyl-acyl carrier protein reductase (fabk) in complex with an inhibitor 0.8356 6 322
ID Description Score Start End Superfamily
5gvjA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8647 6 322 3.20.20.70
5gvjA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.848 6 322 3.20.20.70
af_Q2FZX9_3_354_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8334 6 315 3.20.20.70
2gjnA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.832 9 322 3.20.20.70
af_P71847_8_353_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8296 10 321 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A258K951-F1-model_v4 Nitronate monooxygenase 0.9927 13 227 GO:0018580
AF-A0A3D1XFG9-F1-model_v4 deleted 0.9924 11 226
AF-A0A3N5GCM7-F1-model_v4 Nitronate monooxygenase 0.9919 11 244 GO:0018580
AF-A0A3B9ITZ0-F1-model_v4 Nitronate monooxygenase 0.9914 37 212 GO:0018580
AF-A0A5C7UUD6-F1-model_v4 Nitronate monooxygenase 0.9911 24 174 GO:0018580

Feature Viewer

pLDDT pTM Quality
93.22 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map