F445277

General Info

Members Datasets Scaffolds Average Seq Length
444 190 888 289

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10190244|Ga0157373_101902442
Length 320
Sequence MIFGADPSGRGIKMQKTFAVRVVLFCSIAGSMPAASLAVGTSSGSTPSMNAPSFDAAAEYRKGVEALKGSQFSAAKSSFARVLGVAPDDANTNFLAGMADAGLNDLKAAARHYEHAVRADGKMVVAQQELGVTYAKLGDRPKAEATLGKLKNMDASCGGSCKDAELLKKAISAIQAALGQPGQAMLTTSPSLLFASAKAGDSAYLQAVGLINEKRYIEAIATLQRARAAFGAHPDVLTYLGFANRKLHHYDVAESYYRAALAVAPNHKGATEYYGEMMIERGDMAGAKRMLAKLDSQCTFGCAEADELRRWIDAKGSPAS

Samples

Sample ID Description Type Environment
1 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
163 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
181 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
182 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
183 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
184 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
185 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
186 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
187 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
188 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
189 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
190 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.42
Metatranscriptomes 0.45
Isolates 1.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.15
Nodule 0
Rhizoplane 5.18
Rhizosphere 90.54
Stem 0
Stem Tuber 0
Unclassified 8.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157373_10190244 3300013100 Bacteria 1446
2 JGI24740J21852_10025566 3300001979 Bacteria 1988
3 JGI24739J22299_10019175 3300001989 Bacteria 2451
4 JGI24737J22298_10001072 3300001990 Bacteria 9637
5 JGI24735J21928_10015588 3300002067 Unclassified 2369
6 JGI24750J21931_1001082 3300002070 Bacteria 3546
7 JGI25406J46586_10047765 3300003203 Bacteria 1456
8 Ga0055536_1000674 3300003781 Bacteria 23027
9 Ga0055534_1009792 3300003784 Bacteria 2052
10 Ga0055530_10000005 3300003791 Bacteria 206625
11 Ga0055531_10001378 3300003794 Bacteria 18052
12 Ga0065715_10129661 3300005293 Bacteria 2041
13 Ga0065707_10085104 3300005295 Bacteria 6455
14 Ga0070658_10003133 3300005327 Bacteria 13651
15 Ga0070658_10338879 3300005327 Bacteria 1286
16 Ga0070683_100001288 3300005329 Bacteria 19087
17 Ga0070683_100004201 3300005329 Bacteria 11815
18 Ga0070683_100164105 3300005329 Bacteria 2108
19 Ga0070690_100000010 3300005330 Bacteria 103492
20 Ga0070690_100076325 3300005330 Bacteria 2186
21 Ga0070670_100000032 3300005331 Bacteria 158514
22 Ga0070670_100347543 3300005331 Unclassified 1302
23 Ga0070670_100375274 3300005331 Bacteria 1252
24 Ga0068869_100056564 3300005334 Bacteria 2861
25 Ga0070666_10000006 3300005335 Bacteria 319173
26 Ga0070666_10001049 3300005335 Bacteria 16895
27 Ga0070666_10075688 3300005335 Bacteria 2295
28 Ga0070682_100083913 3300005337 Unclassified 2069
29 Ga0070660_100000042 3300005339 Bacteria 73112
30 Ga0070660_100004669 3300005339 Bacteria 9484
31 Ga0070660_100027358 3300005339 Bacteria 4255
32 Ga0070660_100113689 3300005339 Bacteria 2156
33 Ga0070660_100137240 3300005339 Unclassified 1960
34 Ga0070660_100164349 3300005339 Bacteria 1790
35 Ga0070660_100210411 3300005339 Unclassified 1579
36 Ga0070660_100291349 3300005339 Unclassified 1337
37 Ga0070661_100000120 3300005344 Bacteria 65485
38 Ga0070661_100007216 3300005344 Bacteria 7661
39 Ga0070661_100034584 3300005344 Bacteria 3665
40 Ga0070661_100057061 3300005344 Bacteria 2862
41 Ga0070661_100195158 3300005344 Bacteria 1545
42 Ga0070661_100297674 3300005344 Bacteria 1255
43 Ga0070692_10111671 3300005345 Bacteria 1512
44 Ga0070668_100003201 3300005347 Bacteria 12061
45 Ga0070668_100019962 3300005347 Bacteria 5051
46 Ga0070668_100023100 3300005347 Bacteria 4701
47 Ga0070668_100029705 3300005347 Bacteria 4153
48 Ga0070669_100021707 3300005353 Bacteria 4589
49 Ga0070675_100016555 3300005354 Bacteria 5853
50 Ga0070671_100009834 3300005355 Bacteria 7678
51 Ga0070671_100034384 3300005355 Bacteria 4196
52 Ga0070671_100102663 3300005355 Bacteria 2399
53 Ga0070671_100127758 3300005355 Bacteria 2140
54 Ga0070674_100076145 3300005356 Bacteria 2385
55 Ga0070674_100221725 3300005356 Bacteria 1471
56 Ga0070674_100249016 3300005356 Bacteria 1395
57 Ga0070673_100063956 3300005364 Bacteria 2929
58 Ga0070673_100186635 3300005364 Bacteria 1778
59 Ga0070659_100000130 3300005366 Bacteria 57297
60 Ga0070659_100004618 3300005366 Bacteria 9840
61 Ga0070659_100008423 3300005366 Bacteria 7532
62 Ga0070667_100000110 3300005367 Bacteria 105201
63 Ga0070667_100015446 3300005367 Bacteria 6313
64 Ga0070667_100083621 3300005367 Bacteria 2735
65 Ga0070667_100113035 3300005367 Bacteria 2356
66 Ga0070667_100135190 3300005367 Bacteria 2155
67 Ga0070667_100495612 3300005367 Unclassified 1119
68 Ga0070714_100013288 3300005435 Bacteria 6595
69 Ga0070714_100234772 3300005435 Bacteria 1691
70 Ga0070694_100116209 3300005444 Bacteria 1913
71 Ga0070663_100033093 3300005455 Bacteria 3568
72 Ga0070663_100060182 3300005455 Bacteria 2731
73 Ga0070663_100083536 3300005455 Bacteria 2352
74 Ga0070663_100302405 3300005455 Bacteria 1281
75 Ga0070662_100000665 3300005457 Bacteria 20905
76 Ga0070662_100009472 3300005457 Bacteria 6372
77 Ga0068867_100163884 3300005459 Bacteria 1755
78 Ga0070679_100077565 3300005530 Bacteria 3312
79 Ga0070679_100141634 3300005530 Bacteria 2384
80 Ga0070684_100016474 3300005535 Bacteria 6042
81 Ga0068853_100006595 3300005539 Bacteria 9245
82 Ga0068853_100039078 3300005539 Bacteria 4046
83 Ga0068853_100266966 3300005539 Unclassified 1575
84 Ga0070672_100057962 3300005543 Bacteria 3042
85 Ga0070672_100186592 3300005543 Bacteria 1730
86 Ga0070672_100253429 3300005543 Bacteria 1483
87 Ga0070686_100000042 3300005544 Bacteria 103828
88 Ga0070686_100428549 3300005544 Bacteria 1012
89 Ga0070693_100001289 3300005547 Bacteria 11326
90 Ga0070665_100004277 3300005548 Bacteria 15013
91 Ga0070665_100014894 3300005548 Bacteria 7805
92 Ga0070665_100031216 3300005548 Bacteria 5363
93 Ga0070665_100070995 3300005548 Bacteria 3489
94 Ga0068855_100002509 3300005563 Bacteria 22601
95 Ga0068855_100012347 3300005563 Bacteria 10318
96 Ga0068855_100767978 3300005563 Bacteria 1026
97 Ga0068855_100788848 3300005563 Unclassified 1010
98 Ga0070664_100000071 3300005564 Bacteria 63639
99 Ga0070664_100004603 3300005564 Bacteria 11071
100 Ga0070664_100005256 3300005564 Bacteria 10392
101 Ga0070664_100016014 3300005564 Bacteria 6142
102 Ga0070664_100066660 3300005564 Bacteria 3075
103 Ga0068857_100042735 3300005577 Bacteria 4021
104 Ga0068857_100044519 3300005577 Bacteria 3937
105 Ga0068857_100635822 3300005577 Unclassified 1010
106 Ga0068854_100197629 3300005578 Bacteria 1579
107 Ga0068854_100266956 3300005578 Bacteria 1372
108 Ga0068856_100000244 3300005614 Bacteria 59255
109 Ga0068856_100068315 3300005614 Bacteria 3513
110 Ga0068856_100167948 3300005614 Bacteria 2205
111 Ga0068856_100351535 3300005614 Unclassified 1492
112 Ga0068852_100414254 3300005616 Unclassified 1328
113 Ga0068852_100453095 3300005616 Unclassified 1270
114 Ga0068852_100546210 3300005616 Unclassified 1158
115 Ga0068859_100057915 3300005617 Bacteria 3902
116 Ga0068859_100281851 3300005617 Bacteria 1755
117 Ga0068864_100000463 3300005618 Bacteria 35196
118 Ga0068864_100181799 3300005618 Unclassified 1923
119 Ga0068864_100556286 3300005618 Unclassified 1109
120 Ga0068863_100000288 3300005841 Bacteria 52048
121 Ga0068863_100002101 3300005841 Bacteria 19740
122 Ga0068863_100005663 3300005841 Bacteria 12269
123 Ga0068863_100141527 3300005841 Unclassified 2299
124 Ga0068863_100202981 3300005841 Unclassified 1907
125 Ga0068858_100021183 3300005842 Bacteria 6070
126 Ga0068858_100027709 3300005842 Bacteria 5265
127 Ga0068858_100029547 3300005842 Bacteria 5090
128 Ga0068858_100103416 3300005842 Bacteria 2657
129 Ga0068858_100208862 3300005842 Unclassified 1847
130 Ga0068860_100000014 3300005843 Bacteria 319437
131 Ga0068860_100002727 3300005843 Bacteria 18371
132 Ga0068860_100013096 3300005843 Bacteria 8140
133 Ga0068860_100063882 3300005843 Bacteria 3496
134 Ga0068862_100000260 3300005844 Bacteria 58763
135 Ga0068862_100000437 3300005844 Bacteria 45283
136 Ga0068862_100363341 3300005844 Bacteria 1346
137 Ga0081455_10000131 3300005937 Bacteria 87553
138 Ga0081539_10019849 3300005985 Bacteria 4577
139 Ga0097621_100072100 3300006237 Bacteria 2856
140 Ga0068871_100421774 3300006358 Bacteria 1191
141 Ga0075433_10037036 3300006852 Bacteria 4205
142 Ga0075434_100381047 3300006871 Bacteria 1431
143 Ga0068865_100036898 3300006881 Bacteria 3298
144 Ga0097620_100057917 3300006931 Bacteria 3902
145 Ga0097620_100281864 3300006931 Bacteria 1755
146 Ga0075435_100196407 3300007076 Bacteria 1709
147 Ga0105240_10059397 3300009093 Bacteria 4773
148 Ga0105240_10336362 3300009093 Bacteria 1716
149 Ga0105247_10035580 3300009101 Bacteria 3036
150 Ga0105243_10366982 3300009148 Bacteria 1327
151 Ga0105241_10214309 3300009174 Bacteria 1615
152 Ga0105241_10291719 3300009174 Unclassified 1397
153 Ga0105241_10370324 3300009174 Bacteria 1249
154 Ga0105241_10442882 3300009174 Bacteria 1148
155 Ga0105242_10070011 3300009176 Bacteria 2907
156 Ga0105248_10001764 3300009177 Bacteria 24053
157 Ga0105248_10007469 3300009177 Bacteria 11993
158 Ga0105248_10008420 3300009177 Bacteria 11318
159 Ga0105248_10088663 3300009177 Bacteria 3482
160 Ga0105248_10206366 3300009177 Bacteria 2214
161 Ga0105248_10359825 3300009177 Bacteria 1638
162 Ga0105248_10422448 3300009177 Unclassified 1501
163 Ga0105248_10641010 3300009177 Unclassified 1199
164 Ga0105237_10018026 3300009545 Bacteria 7314
165 Ga0105249_10000015 3300009553 Bacteria 282138
166 Ga0105249_10000035 3300009553 Bacteria 201325
167 Ga0105249_10000365 3300009553 Bacteria 44960
168 Ga0105249_10018910 3300009553 Bacteria 6140
169 Ga0105239_10657632 3300010375 Bacteria 1197
170 Ga0157373_10009522 3300013100 Bacteria 7171
171 Ga0157373_10021731 3300013100 Bacteria 4657
172 Ga0157373_10030045 3300013100 Bacteria 3910
173 Ga0157373_10047495 3300013100 Bacteria 3062
174 Ga0157373_10051376 3300013100 Bacteria 2936
175 Ga0157373_10062060 3300013100 Bacteria 2647
176 Ga0157373_10148466 3300013100 Bacteria 1649
177 Ga0157371_10009362 3300013102 Bacteria 7715
178 Ga0157371_10104209 3300013102 Bacteria 2013
179 Ga0157371_10141221 3300013102 Unclassified 1715
180 Ga0157371_10214002 3300013102 Bacteria 1383
181 Ga0157370_10191048 3300013104 Bacteria 1901
182 Ga0157370_10304543 3300013104 Bacteria 1471
183 Ga0157369_10183382 3300013105 Bacteria 2202
184 Ga0157374_10006813 3300013296 Bacteria 9720
185 Ga0157374_10032299 3300013296 Bacteria 4764
186 Ga0157374_10333634 3300013296 Bacteria 1504
187 Ga0157374_10509704 3300013296 Bacteria 1208
188 Ga0163162_10049239 3300013306 Bacteria 4223
189 Ga0163162_10379002 3300013306 Bacteria 1548
190 Ga0157372_10063796 3300013307 Bacteria 4132
191 Ga0157375_10277731 3300013308 Bacteria 1838
192 Ga0157375_10690055 3300013308 Bacteria 1175
193 Ga0163163_10006208 3300014325 Bacteria 10424
194 Ga0163163_10079568 3300014325 Bacteria 3276
195 Ga0157380_10004014 3300014326 Bacteria 10162
196 Ga0157380_10149896 3300014326 Bacteria 2015
197 Ga0157379_10038267 3300014968 Bacteria 4280
198 Ga0163161_10000269 3300017792 Bacteria 45675
199 Ga0206354_10630464 3300020081 Bacteria 4890
200 Ga0206353_10613120 3300020082 Bacteria 9187
201 Ga0209675_1000357 3300025291 Bacteria 39250
202 Ga0209676_1000132 3300025292 Bacteria 185063
203 Ga0209025_1003923 3300025294 Bacteria 13389
204 Ga0209050_1000139 3300025298 Bacteria 173691
205 Ga0209257_1000164 3300025304 Bacteria 173339
206 Ga0207697_10022326 3300025315 Bacteria 2593
207 Ga0207688_10013433 3300025901 Bacteria 4450
208 Ga0207680_10000011 3300025903 Bacteria 391225
209 Ga0207680_10000196 3300025903 Bacteria 29133
210 Ga0207680_10270101 3300025903 Unclassified 1179
211 Ga0207647_10009788 3300025904 Bacteria 6798
212 Ga0207647_10020180 3300025904 Bacteria 4472
213 Ga0207647_10022266 3300025904 Bacteria 4212
214 Ga0207647_10041340 3300025904 Bacteria 2899
215 Ga0207647_10062555 3300025904 Bacteria 2267
216 Ga0207699_10157129 3300025906 Bacteria 1510
217 Ga0207645_10016465 3300025907 Bacteria 4893
218 Ga0207643_10038458 3300025908 Bacteria 2687
219 Ga0207705_10000370 3300025909 Bacteria 40613
220 Ga0207705_10110965 3300025909 Bacteria 2026
221 Ga0207705_10251024 3300025909 Unclassified 1349
222 Ga0207654_10090233 3300025911 Bacteria 1866
223 Ga0207654_10176996 3300025911 Unclassified 1389
224 Ga0207695_10015279 3300025913 Bacteria 9048
225 Ga0207695_10232641 3300025913 Bacteria 1747
226 Ga0207695_10419150 3300025913 Unclassified 1223
227 Ga0207693_10026146 3300025915 Bacteria 4621
228 Ga0207657_10000765 3300025919 Bacteria 34074
229 Ga0207657_10005380 3300025919 Bacteria 13395
230 Ga0207657_10010490 3300025919 Bacteria 9241
231 Ga0207657_10051992 3300025919 Bacteria 3559
232 Ga0207657_10109428 3300025919 Bacteria 2284
233 Ga0207657_10231521 3300025919 Bacteria 1477
234 Ga0207657_10241201 3300025919 Bacteria 1443
235 Ga0207649_10000560 3300025920 Bacteria 25563
236 Ga0207649_10012069 3300025920 Bacteria 4780
237 Ga0207649_10021560 3300025920 Bacteria 3711
238 Ga0207649_10047351 3300025920 Bacteria 2646
239 Ga0207649_10095477 3300025920 Bacteria 1956
240 Ga0207652_10049086 3300025921 Bacteria 3611
241 Ga0207681_10022848 3300025923 Bacteria 3993
242 Ga0207681_10023631 3300025923 Bacteria 3935
243 Ga0207650_10000176 3300025925 Bacteria 75398
244 Ga0207650_10033463 3300025925 Bacteria 3723
245 Ga0207659_10003665 3300025926 Bacteria 9256
246 Ga0207687_10110908 3300025927 Bacteria 2036
247 Ga0207700_10034223 3300025928 Bacteria 3645
248 Ga0207664_10013453 3300025929 Bacteria 5874
249 Ga0207664_10224463 3300025929 Bacteria 1631
250 Ga0207644_10014034 3300025931 Bacteria 5355
251 Ga0207644_10022049 3300025931 Bacteria 4346
252 Ga0207644_10027439 3300025931 Bacteria 3932
253 Ga0207644_10027549 3300025931 Bacteria 3926
254 Ga0207644_10091647 3300025931 Bacteria 2266
255 Ga0207690_10003963 3300025932 Bacteria 8753
256 Ga0207690_10010923 3300025932 Bacteria 5414
257 Ga0207690_10033100 3300025932 Bacteria 3321
258 Ga0207706_10000739 3300025933 Bacteria 34074
259 Ga0207706_10004012 3300025933 Bacteria 13933
260 Ga0207706_10012703 3300025933 Bacteria 7667
261 Ga0207706_10018931 3300025933 Bacteria 6191
262 Ga0207706_10062608 3300025933 Bacteria 3276
263 Ga0207706_10075299 3300025933 Bacteria 2968
264 Ga0207706_10225010 3300025933 Unclassified 1642
265 Ga0207669_10048022 3300025937 Bacteria 2533
266 Ga0207669_10191350 3300025937 Bacteria 1476
267 Ga0207691_10074579 3300025940 Bacteria 3060
268 Ga0207691_10090313 3300025940 Bacteria 2746
269 Ga0207691_10357115 3300025940 Bacteria 1250
270 Ga0207711_10001055 3300025941 Bacteria 26387
271 Ga0207711_10003874 3300025941 Bacteria 12873
272 Ga0207711_10020763 3300025941 Bacteria 5480
273 Ga0207711_10034526 3300025941 Bacteria 4284
274 Ga0207711_10199322 3300025941 Bacteria 1826
275 Ga0207711_10340747 3300025941 Bacteria 1387
276 Ga0207689_10006760 3300025942 Bacteria 10098
277 Ga0207661_10011379 3300025944 Bacteria 6444
278 Ga0207679_10000166 3300025945 Bacteria 54528
279 Ga0207679_10005304 3300025945 Bacteria 8085
280 Ga0207679_10074836 3300025945 Bacteria 2567
281 Ga0207667_10002582 3300025949 Bacteria 22489
282 Ga0207667_10049260 3300025949 Bacteria 4451
283 Ga0207667_10077149 3300025949 Bacteria 3456
284 Ga0207667_10095026 3300025949 Bacteria 3077
285 Ga0207667_10109200 3300025949 Bacteria 2853
286 Ga0207651_10033326 3300025960 Bacteria 3321
287 Ga0207651_10203867 3300025960 Bacteria 1587
288 Ga0207712_10000013 3300025961 Bacteria 391208
289 Ga0207712_10000023 3300025961 Bacteria 282081
290 Ga0207712_10001170 3300025961 Bacteria 18221
291 Ga0207668_10000791 3300025972 Bacteria 19364
292 Ga0207668_10019686 3300025972 Bacteria 4272
293 Ga0207668_10020723 3300025972 Bacteria 4184
294 Ga0207668_10046859 3300025972 Bacteria 2956
295 Ga0207640_10024511 3300025981 Bacteria 3640
296 Ga0207640_10024565 3300025981 Bacteria 3637
297 Ga0207658_10000376 3300025986 Bacteria 43733
298 Ga0207658_10001954 3300025986 Bacteria 15400
299 Ga0207658_10017468 3300025986 Bacteria 4944
300 Ga0207658_10057406 3300025986 Bacteria 2892
301 Ga0207658_10122531 3300025986 Bacteria 2075
302 Ga0207703_10010767 3300026035 Bacteria 7135
303 Ga0207703_10012706 3300026035 Bacteria 6565
304 Ga0207703_10012871 3300026035 Bacteria 6525
305 Ga0207703_10025084 3300026035 Bacteria 4690
306 Ga0207703_10052298 3300026035 Bacteria 3316
307 Ga0207639_10001706 3300026041 Bacteria 14808
308 Ga0207678_10047641 3300026067 Bacteria 3706
309 Ga0207678_10082463 3300026067 Bacteria 2751
310 Ga0207678_10124739 3300026067 Bacteria 2197
311 Ga0207678_10137156 3300026067 Bacteria 2087
312 Ga0207678_10148882 3300026067 Unclassified 1998
313 Ga0207702_10026015 3300026078 Bacteria 4858
314 Ga0207641_10004681 3300026088 Bacteria 11805
315 Ga0207641_10019537 3300026088 Bacteria 5561
316 Ga0207641_10019962 3300026088 Bacteria 5500
317 Ga0207641_10237830 3300026088 Bacteria 1695
318 Ga0207641_10289560 3300026088 Bacteria 1543
319 Ga0207676_10011017 3300026095 Bacteria 6454
320 Ga0207676_10037058 3300026095 Bacteria 3713
321 Ga0207674_10003362 3300026116 Bacteria 19632
322 Ga0207674_10084320 3300026116 Bacteria 3176
323 Ga0207674_10630080 3300026116 Bacteria 1035
324 Ga0207675_100029142 3300026118 Bacteria 5145
325 Ga0207683_10007042 3300026121 Bacteria 9644
326 Ga0207683_10020788 3300026121 Bacteria 5616
327 Ga0207698_10007019 3300026142 Bacteria 7054
328 Ga0207698_10038698 3300026142 Bacteria 3526
329 Ga0207698_10130357 3300026142 Bacteria 2147
330 Ga0268266_10001436 3300028379 Bacteria 28384
331 Ga0268266_10007874 3300028379 Bacteria 9545
332 Ga0268266_10010327 3300028379 Bacteria 8169
333 Ga0268266_10060791 3300028379 Bacteria 3257
334 Ga0268265_10000164 3300028380 Bacteria 80747
335 Ga0268265_10033281 3300028380 Bacteria 3746
336 Ga0268264_10000037 3300028381 Bacteria 391116
337 Ga0268264_10000411 3300028381 Bacteria 60609
338 Ga0268264_10002977 3300028381 Bacteria 14701
339 Ga0268264_10008025 3300028381 Bacteria 8779
340 Ga0307408_100041798 3300031548 Bacteria 3252
341 Ga0307405_10151852 3300031731 Bacteria 1630
342 Ga0307413_10025341 3300031824 Bacteria 3250
343 Ga0307407_10011954 3300031903 Bacteria 4155
344 Ga0307412_10031414 3300031911 Bacteria 3354
345 Ga0307409_100391445 3300031995 Bacteria 1324
346 Ga0307416_100001274 3300032002 Bacteria 13568
347 Ga0307416_100207038 3300032002 Bacteria 1867
348 Ga0307416_100694187 3300032002 Unclassified 1106
349 Ga0307414_10030946 3300032004 Bacteria 3503
350 Ga0307414_10070638 3300032004 Bacteria 2515
351 Ga0307411_10036116 3300032005 Bacteria 3093
352 Ga0307415_100002644 3300032126 Bacteria 8933
353 Ga0307415_100013652 3300032126 Bacteria 4749
354 Ga0307415_100215073 3300032126 Unclassified 1536
355 Ga0307415_100304909 3300032126 Bacteria 1321
356 Ga0373951_0029125 3300035091 Bacteria 1296
357 Ga0373931_0026981 3300035691 Unclassified 2928
358 Ga0395899_0003847 3300037312 Bacteria 11837
359 Ga0395899_0038599 3300037312 Bacteria 3576
360 Ga0395899_0042152 3300037312 Bacteria 3408
361 Ga0395899_0053953 3300037312 Bacteria 2975
362 Ga0395899_0095056 3300037312 Bacteria 2156
363 Ga0395900_0000881 3300037418 Bacteria 39365
364 Ga0395900_0002783 3300037418 Bacteria 19124
365 Ga0395900_0008359 3300037418 Bacteria 10651
366 Ga0395900_0015754 3300037418 Bacteria 7706
367 Ga0395900_0036463 3300037418 Bacteria 5070
368 Ga0395900_0049696 3300037418 Bacteria 4320
369 Ga0395900_0128166 3300037418 Bacteria 2602
370 Ga0395900_0230954 3300037418 Bacteria 1860
371 Ga0395900_0239512 3300037418 Bacteria 1821
372 Ga0395898_0001585 3300037466 Bacteria 31078
373 Ga0395898_0020870 3300037466 Bacteria 6647
374 Ga0395898_0024112 3300037466 Bacteria 6140
375 Ga0395898_0065052 3300037466 Bacteria 3536
376 Ga0395898_0066444 3300037466 Bacteria 3494
377 Ga0395898_0118130 3300037466 Bacteria 2540
378 Ga0395898_0292821 3300037466 Bacteria 1553
379 Ga0395905_0000089 3300037471 Bacteria 152196
380 Ga0395905_0000956 3300037471 Bacteria 37067
381 Ga0395905_0001957 3300037471 Bacteria 23573
382 Ga0395905_0005181 3300037471 Bacteria 13368
383 Ga0395905_0043641 3300037471 Bacteria 4206
384 Ga0395905_0061284 3300037471 Bacteria 3519
385 Ga0395905_0076211 3300037471 Bacteria 3143
386 Ga0395905_0158165 3300037471 Bacteria 2130
387 Ga0395905_0164361 3300037471 Bacteria 2086
388 Ga0395905_0169379 3300037471 Bacteria 2051
389 Ga0395905_0220388 3300037471 Bacteria 1775
390 Ga0395905_0292508 3300037471 Bacteria 1515
391 Ga0395905_0315403 3300037471 Bacteria 1452
392 Ga0395901_0000548 3300038443 Bacteria 43338
393 Ga0395901_0031716 3300038443 Bacteria 5448
394 Ga0395901_0034059 3300038443 Bacteria 5259
395 Ga0395901_0277784 3300038443 Unclassified 1741
396 Ga0395901_0312914 3300038443 Bacteria 1626
397 Ga0395901_0348135 3300038443 Archaea 1529
398 Ga0395901_0398309 3300038443 Bacteria 1414
399 Ga0395901_0416697 3300038443 Bacteria 1378
400 Ga0436365_1349401 3300039437 Bacteria 7278
401 Ga0466972_0068370 3300044658 Bacteria 1697
402 Ga0466963_0237845 3300044694 Archaea 1277
403 Ga0466967_0294529 3300045976 Bacteria 1560
404 Ga0495629_0113925 3300046459 Bacteria 1885
405 Ga0495654_0071192 3300046530 Bacteria 1648
406 Ga0495677_0067468 3300047445 Bacteria 1331
407 Ga0496101_0193911 3300048904 Unclassified 1568
408 Ga0496102_0008602 3300048905 Bacteria 8758
409 Ga0496102_0177317 3300048905 Bacteria 2007
410 Ga0496102_0623283 3300048905 Unclassified 1002
411 Ga0496103_0105861 3300048906 Bacteria 1783
412 Ga0496103_0133212 3300048906 Bacteria 1588
413 Ga0496107_0037855 3300048910 Bacteria 3462
414 Ga0496108_0005589 3300048911 Bacteria 10172
415 Ga0496108_0013861 3300048911 Bacteria 6575
416 Ga0496109_0008141 3300048912 Bacteria 8890
417 Ga0496109_0358880 3300048912 Unclassified 1377
418 Ga0496110_0004068 3300048913 Bacteria 11282
419 Ga0496110_0005048 3300048913 Bacteria 10315
420 Ga0496111_0088201 3300048914 Bacteria 2271
421 Ga0496112_0034776 3300048915 Bacteria 4904
422 Ga0496112_0053807 3300048915 Bacteria 3954
423 Ga0496112_0065654 3300048915 Bacteria 3581
424 Ga0496112_0081473 3300048915 Bacteria 3200
425 Ga0496112_0356215 3300048915 Bacteria 1405
426 Ga0496112_0393890 3300048915 Unclassified 1325
427 Ga0496113_0335988 3300048916 Bacteria 1211
428 Ga0496114_0154729 3300048917 Bacteria 1990
429 Ga0496115_0109229 3300048918 Bacteria 2271
430 Ga0501074_0063645 3300049590 Bacteria 2657
431 Ga0501080_0056841 3300049742 Bacteria 3643
432 nmdc:mga0rr50_345247_c1 3300050513 Bacteria 1251
433 nmdc:mga08x19_295494_c1 3300050514 Unclassified 1124
434 nmdc:mga0a205_15931_c1 3300050515 Bacteria 7032
435 Ga0500594_0024088 3300053118 Bacteria 1548
436 Ga0500608_000160 3300053122 Bacteria 28018
437 Ga0500564_001872 3300053138 Bacteria 7500
438 Ga0500567_003171 3300053723 Bacteria 7263
439 Ga0500625_000025 3300053729 Bacteria 63535
440 2643836258 2643221563 Bacteria 4726935
441 2644052735 2643221608 Bacteria 4724829
442 2739651213 2739367664 Bacteria 4114334
443 2740029686 2739367865 Bacteria 4114482
444 2852653870 2852653556 Bacteria 4050083
445 Ga0157373_10190244
446 JGI24740J21852_10025566
447 JGI24739J22299_10019175
448 JGI24737J22298_10001072
449 JGI24735J21928_10015588
450 JGI24750J21931_1001082
451 JGI25406J46586_10047765
452 Ga0055536_1000674
453 Ga0055534_1009792
454 Ga0055530_10000005
455 Ga0055531_10001378
456 Ga0065715_10129661
457 Ga0065707_10085104
458 Ga0070658_10003133
459 Ga0070658_10338879
460 Ga0070683_100001288
461 Ga0070683_100004201
462 Ga0070683_100164105
463 Ga0070690_100000010
464 Ga0070690_100076325
465 Ga0070670_100000032
466 Ga0070670_100347543
467 Ga0070670_100375274
468 Ga0068869_100056564
469 Ga0070666_10000006
470 Ga0070666_10001049
471 Ga0070666_10075688
472 Ga0070682_100083913
473 Ga0070660_100000042
474 Ga0070660_100004669
475 Ga0070660_100027358
476 Ga0070660_100113689
477 Ga0070660_100137240
478 Ga0070660_100164349
479 Ga0070660_100210411
480 Ga0070660_100291349
481 Ga0070661_100000120
482 Ga0070661_100007216
483 Ga0070661_100034584
484 Ga0070661_100057061
485 Ga0070661_100195158
486 Ga0070661_100297674
487 Ga0070692_10111671
488 Ga0070668_100003201
489 Ga0070668_100019962
490 Ga0070668_100023100
491 Ga0070668_100029705
492 Ga0070669_100021707
493 Ga0070675_100016555
494 Ga0070671_100009834
495 Ga0070671_100034384
496 Ga0070671_100102663
497 Ga0070671_100127758
498 Ga0070674_100076145
499 Ga0070674_100221725
500 Ga0070674_100249016
501 Ga0070673_100063956
502 Ga0070673_100186635
503 Ga0070659_100000130
504 Ga0070659_100004618
505 Ga0070659_100008423
506 Ga0070667_100000110
507 Ga0070667_100015446
508 Ga0070667_100083621
509 Ga0070667_100113035
510 Ga0070667_100135190
511 Ga0070667_100495612
512 Ga0070714_100013288
513 Ga0070714_100234772
514 Ga0070694_100116209
515 Ga0070663_100033093
516 Ga0070663_100060182
517 Ga0070663_100083536
518 Ga0070663_100302405
519 Ga0070662_100000665
520 Ga0070662_100009472
521 Ga0068867_100163884
522 Ga0070679_100077565
523 Ga0070679_100141634
524 Ga0070684_100016474
525 Ga0068853_100006595
526 Ga0068853_100039078
527 Ga0068853_100266966
528 Ga0070672_100057962
529 Ga0070672_100186592
530 Ga0070672_100253429
531 Ga0070686_100000042
532 Ga0070686_100428549
533 Ga0070693_100001289
534 Ga0070665_100004277
535 Ga0070665_100014894
536 Ga0070665_100031216
537 Ga0070665_100070995
538 Ga0068855_100002509
539 Ga0068855_100012347
540 Ga0068855_100767978
541 Ga0068855_100788848
542 Ga0070664_100000071
543 Ga0070664_100004603
544 Ga0070664_100005256
545 Ga0070664_100016014
546 Ga0070664_100066660
547 Ga0068857_100042735
548 Ga0068857_100044519
549 Ga0068857_100635822
550 Ga0068854_100197629
551 Ga0068854_100266956
552 Ga0068856_100000244
553 Ga0068856_100068315
554 Ga0068856_100167948
555 Ga0068856_100351535
556 Ga0068852_100414254
557 Ga0068852_100453095
558 Ga0068852_100546210
559 Ga0068859_100057915
560 Ga0068859_100281851
561 Ga0068864_100000463
562 Ga0068864_100181799
563 Ga0068864_100556286
564 Ga0068863_100000288
565 Ga0068863_100002101
566 Ga0068863_100005663
567 Ga0068863_100141527
568 Ga0068863_100202981
569 Ga0068858_100021183
570 Ga0068858_100027709
571 Ga0068858_100029547
572 Ga0068858_100103416
573 Ga0068858_100208862
574 Ga0068860_100000014
575 Ga0068860_100002727
576 Ga0068860_100013096
577 Ga0068860_100063882
578 Ga0068862_100000260
579 Ga0068862_100000437
580 Ga0068862_100363341
581 Ga0081455_10000131
582 Ga0081539_10019849
583 Ga0097621_100072100
584 Ga0068871_100421774
585 Ga0075433_10037036
586 Ga0075434_100381047
587 Ga0068865_100036898
588 Ga0097620_100057917
589 Ga0097620_100281864
590 Ga0075435_100196407
591 Ga0105240_10059397
592 Ga0105240_10336362
593 Ga0105247_10035580
594 Ga0105243_10366982
595 Ga0105241_10214309
596 Ga0105241_10291719
597 Ga0105241_10370324
598 Ga0105241_10442882
599 Ga0105242_10070011
600 Ga0105248_10001764
601 Ga0105248_10007469
602 Ga0105248_10008420
603 Ga0105248_10088663
604 Ga0105248_10206366
605 Ga0105248_10359825
606 Ga0105248_10422448
607 Ga0105248_10641010
608 Ga0105237_10018026
609 Ga0105249_10000015
610 Ga0105249_10000035
611 Ga0105249_10000365
612 Ga0105249_10018910
613 Ga0105239_10657632
614 Ga0157373_10009522
615 Ga0157373_10021731
616 Ga0157373_10030045
617 Ga0157373_10047495
618 Ga0157373_10051376
619 Ga0157373_10062060
620 Ga0157373_10148466
621 Ga0157371_10009362
622 Ga0157371_10104209
623 Ga0157371_10141221
624 Ga0157371_10214002
625 Ga0157370_10191048
626 Ga0157370_10304543
627 Ga0157369_10183382
628 Ga0157374_10006813
629 Ga0157374_10032299
630 Ga0157374_10333634
631 Ga0157374_10509704
632 Ga0163162_10049239
633 Ga0163162_10379002
634 Ga0157372_10063796
635 Ga0157375_10277731
636 Ga0157375_10690055
637 Ga0163163_10006208
638 Ga0163163_10079568
639 Ga0157380_10004014
640 Ga0157380_10149896
641 Ga0157379_10038267
642 Ga0163161_10000269
643 Ga0206354_10630464
644 Ga0206353_10613120
645 Ga0209675_1000357
646 Ga0209676_1000132
647 Ga0209025_1003923
648 Ga0209050_1000139
649 Ga0209257_1000164
650 Ga0207697_10022326
651 Ga0207688_10013433
652 Ga0207680_10000011
653 Ga0207680_10000196
654 Ga0207680_10270101
655 Ga0207647_10009788
656 Ga0207647_10020180
657 Ga0207647_10022266
658 Ga0207647_10041340
659 Ga0207647_10062555
660 Ga0207699_10157129
661 Ga0207645_10016465
662 Ga0207643_10038458
663 Ga0207705_10000370
664 Ga0207705_10110965
665 Ga0207705_10251024
666 Ga0207654_10090233
667 Ga0207654_10176996
668 Ga0207695_10015279
669 Ga0207695_10232641
670 Ga0207695_10419150
671 Ga0207693_10026146
672 Ga0207657_10000765
673 Ga0207657_10005380
674 Ga0207657_10010490
675 Ga0207657_10051992
676 Ga0207657_10109428
677 Ga0207657_10231521
678 Ga0207657_10241201
679 Ga0207649_10000560
680 Ga0207649_10012069
681 Ga0207649_10021560
682 Ga0207649_10047351
683 Ga0207649_10095477
684 Ga0207652_10049086
685 Ga0207681_10022848
686 Ga0207681_10023631
687 Ga0207650_10000176
688 Ga0207650_10033463
689 Ga0207659_10003665
690 Ga0207687_10110908
691 Ga0207700_10034223
692 Ga0207664_10013453
693 Ga0207664_10224463
694 Ga0207644_10014034
695 Ga0207644_10022049
696 Ga0207644_10027439
697 Ga0207644_10027549
698 Ga0207644_10091647
699 Ga0207690_10003963
700 Ga0207690_10010923
701 Ga0207690_10033100
702 Ga0207706_10000739
703 Ga0207706_10004012
704 Ga0207706_10012703
705 Ga0207706_10018931
706 Ga0207706_10062608
707 Ga0207706_10075299
708 Ga0207706_10225010
709 Ga0207669_10048022
710 Ga0207669_10191350
711 Ga0207691_10074579
712 Ga0207691_10090313
713 Ga0207691_10357115
714 Ga0207711_10001055
715 Ga0207711_10003874
716 Ga0207711_10020763
717 Ga0207711_10034526
718 Ga0207711_10199322
719 Ga0207711_10340747
720 Ga0207689_10006760
721 Ga0207661_10011379
722 Ga0207679_10000166
723 Ga0207679_10005304
724 Ga0207679_10074836
725 Ga0207667_10002582
726 Ga0207667_10049260
727 Ga0207667_10077149
728 Ga0207667_10095026
729 Ga0207667_10109200
730 Ga0207651_10033326
731 Ga0207651_10203867
732 Ga0207712_10000013
733 Ga0207712_10000023
734 Ga0207712_10001170
735 Ga0207668_10000791
736 Ga0207668_10019686
737 Ga0207668_10020723
738 Ga0207668_10046859
739 Ga0207640_10024511
740 Ga0207640_10024565
741 Ga0207658_10000376
742 Ga0207658_10001954
743 Ga0207658_10017468
744 Ga0207658_10057406
745 Ga0207658_10122531
746 Ga0207703_10010767
747 Ga0207703_10012706
748 Ga0207703_10012871
749 Ga0207703_10025084
750 Ga0207703_10052298
751 Ga0207639_10001706
752 Ga0207678_10047641
753 Ga0207678_10082463
754 Ga0207678_10124739
755 Ga0207678_10137156
756 Ga0207678_10148882
757 Ga0207702_10026015
758 Ga0207641_10004681
759 Ga0207641_10019537
760 Ga0207641_10019962
761 Ga0207641_10237830
762 Ga0207641_10289560
763 Ga0207676_10011017
764 Ga0207676_10037058
765 Ga0207674_10003362
766 Ga0207674_10084320
767 Ga0207674_10630080
768 Ga0207675_100029142
769 Ga0207683_10007042
770 Ga0207683_10020788
771 Ga0207698_10007019
772 Ga0207698_10038698
773 Ga0207698_10130357
774 Ga0268266_10001436
775 Ga0268266_10007874
776 Ga0268266_10010327
777 Ga0268266_10060791
778 Ga0268265_10000164
779 Ga0268265_10033281
780 Ga0268264_10000037
781 Ga0268264_10000411
782 Ga0268264_10002977
783 Ga0268264_10008025
784 Ga0307408_100041798
785 Ga0307405_10151852
786 Ga0307413_10025341
787 Ga0307407_10011954
788 Ga0307412_10031414
789 Ga0307409_100391445
790 Ga0307416_100001274
791 Ga0307416_100207038
792 Ga0307416_100694187
793 Ga0307414_10030946
794 Ga0307414_10070638
795 Ga0307411_10036116
796 Ga0307415_100002644
797 Ga0307415_100013652
798 Ga0307415_100215073
799 Ga0307415_100304909
800 Ga0373951_0029125
801 Ga0373931_0026981
802 Ga0395899_0003847
803 Ga0395899_0038599
804 Ga0395899_0042152
805 Ga0395899_0053953
806 Ga0395899_0095056
807 Ga0395900_0000881
808 Ga0395900_0002783
809 Ga0395900_0008359
810 Ga0395900_0015754
811 Ga0395900_0036463
812 Ga0395900_0049696
813 Ga0395900_0128166
814 Ga0395900_0230954
815 Ga0395900_0239512
816 Ga0395898_0001585
817 Ga0395898_0020870
818 Ga0395898_0024112
819 Ga0395898_0065052
820 Ga0395898_0066444
821 Ga0395898_0118130
822 Ga0395898_0292821
823 Ga0395905_0000089
824 Ga0395905_0000956
825 Ga0395905_0001957
826 Ga0395905_0005181
827 Ga0395905_0043641
828 Ga0395905_0061284
829 Ga0395905_0076211
830 Ga0395905_0158165
831 Ga0395905_0164361
832 Ga0395905_0169379
833 Ga0395905_0220388
834 Ga0395905_0292508
835 Ga0395905_0315403
836 Ga0395901_0000548
837 Ga0395901_0031716
838 Ga0395901_0034059
839 Ga0395901_0277784
840 Ga0395901_0312914
841 Ga0395901_0348135
842 Ga0395901_0398309
843 Ga0395901_0416697
844 Ga0436365_1349401
845 Ga0466972_0068370
846 Ga0466963_0237845
847 Ga0466967_0294529
848 Ga0495629_0113925
849 Ga0495654_0071192
850 Ga0495677_0067468
851 Ga0496101_0193911
852 Ga0496102_0008602
853 Ga0496102_0177317
854 Ga0496102_0623283
855 Ga0496103_0105861
856 Ga0496103_0133212
857 Ga0496107_0037855
858 Ga0496108_0005589
859 Ga0496108_0013861
860 Ga0496109_0008141
861 Ga0496109_0358880
862 Ga0496110_0004068
863 Ga0496110_0005048
864 Ga0496111_0088201
865 Ga0496112_0034776
866 Ga0496112_0053807
867 Ga0496112_0065654
868 Ga0496112_0081473
869 Ga0496112_0356215
870 Ga0496112_0393890
871 Ga0496113_0335988
872 Ga0496114_0154729
873 Ga0496115_0109229
874 Ga0501074_0063645
875 Ga0501080_0056841
876 nmdc:mga0rr50_345247_c1
877 nmdc:mga08x19_295494_c1
878 nmdc:mga0a205_15931_c1
879 Ga0500594_0024088
880 Ga0500608_000160
881 Ga0500564_001872
882 Ga0500567_003171
883 Ga0500625_000025
884 2643836258
885 2644052735
886 2739651213
887 2740029686
888 2852653870

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13432

TPR_16

Tetratricopeptide repeat

60

124

0.95

PF13432

TPR_16

Tetratricopeptide repeat

243

288

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kd7-assembly2.cif.gz_B designed tpr module (ctpr390) in complex with its peptide-ligand (hsp90 peptide) 0.9509 187 285
3kd7-assembly2.cif.gz_B designed tpr module (ctpr390) in complex with its peptide-ligand (hsp90 peptide) 0.9329 187 285
2wqh-assembly1.cif.gz_A-2 crystal structure of ctpr3y3 0.9284 187 285
2avp-assembly1.cif.gz_A crystal structure of an 8 repeat consensus tpr superhelix 0.9273 222 288
8j07-assembly1.cif.gz_u9 96nm repeat of human respiratory doublet microtubule and associated axonemal complexes 0.9173 187 304
ID Description Score Start End Superfamily
af_Q5APB7_2_88_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9727 186 266 1.25.40.10
5c1dA01 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.961 187 284 1.25.40.10
5bnwA01 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9563 185 284 1.25.40.10
4n39A01 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9523 185 284 1.25.40.10
af_Q58350_225_318_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.952 194 281 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A7Z2PN98-F1-model_v4 Tetratricopeptide repeat protein 0.9417 185 300
AF-A0A063ZFA3-F1-model_v4 Uncharacterized protein 0.9049 179 284
AF-A0A7S2BLI2-F1-model_v4 SGS domain-containing protein 0.8969 185 303 GO:0005737
GO:0051087
AF-D1CIY5-F1-model_v4 protein O-GlcNAc transferase (EC 2.4.1.255) 0.895 184 299 GO:0000166
GO:0016757
AF-A0A3P9BUV1-F1-model_v4 Protein SGT1 homolog 0.8643 196 304 GO:0051087

Map