F445280

General Info

Members Datasets Scaffolds Average Seq Length
444 292 428 291

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10060107|Ga0163162_100601072
Length 325
Sequence MAAGKELRRRQSRLAISQLEYAKEQSMNAATQSMPLSSDDLALVLALTRAPTLAEAGLRLGVDTSTVFRALQRVEKRLGRRLFERDRGGYRAGELALQLAGHAERIEAELEGARSQLATGEDRVSGRVRVTTTDTVLYGLVMPVLGELTARHPHLQLELDMSYELASLSRRDADIALRATRRPPGHLVGRRLGAVRVAVYAHRKLARSAASLDALASLPWAVPDAALPDHPSARWRRKHLPKVVPRLELHGVLAVMEAVAAGVAVGVVPIFLADAYADVLALTEPIDEAETDLWMLAHPESRHLRRIAVVAASLAENIRLDAAAA

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
4 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
5 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
6 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
7 2643221556 Massilia sp. Root1485 Isolate Unclassified
8 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
9 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
10 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
11 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
12 2643221684 Massilia sp. Root133 Isolate Unclassified
13 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
14 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
15 2928058823 Ralstonia sp. 1138 Isolate Unclassified
16 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
17 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
18 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
19 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
24 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
25 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
26 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
27 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
28 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
29 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
30 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
31 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
32 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
33 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
41 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
42 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
43 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
44 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
45 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
126 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
127 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
130 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
131 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
135 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
178 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
179 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
180 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
181 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
182 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
183 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
195 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
196 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
197 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
198 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
209 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
210 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
211 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
212 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
213 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
214 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
215 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
216 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
217 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
218 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
219 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
220 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
221 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
222 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
223 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
224 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
225 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
226 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
227 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
228 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
229 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
230 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
231 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
232 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
233 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
234 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
235 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
236 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
237 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
238 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
239 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
240 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
241 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
242 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
243 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
244 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
245 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
246 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
247 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
248 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
249 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
250 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
251 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
252 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
253 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
254 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
255 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
261 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
262 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
263 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
264 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
265 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
266 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
267 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
268 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
269 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
270 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
271 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
272 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
273 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
274 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
275 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
276 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
277 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
278 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
279 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
280 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
281 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
282 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
283 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
284 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
285 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
286 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
287 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
288 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
289 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
290 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
291 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.5
Metatranscriptomes 0.9
Isolates 3.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.86
Nodule 0
Rhizoplane 4.05
Rhizosphere 70.72
Stem 0
Stem Tuber 0
Unclassified 10.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000658 3300001915 Bacteria 10437
2 JGI24740J21852_10000209 3300001979 Bacteria 24451
3 JGI24740J21852_10001259 3300001979 Bacteria 11466
4 JGI25156J39149_1009475 3300002705 Bacteria 2360
5 JGI25156J39149_1014898 3300002705 Bacteria 1580
6 JGI25154J39366_1001487 3300002738 Bacteria 8248
7 JGI25153J46596_10002209 3300003215 Bacteria 11364
8 rootH1_10022645 3300003316 Bacteria 5044
9 rootH1_10116139 3300003316 Bacteria 1394
10 rootL2_10013604 3300003322 Bacteria 8555
11 rootL2_10055306 3300003322 Bacteria 5599
12 rootL2_10135496 3300003322 Bacteria 2639
13 rootL2_10167649 3300003322 Bacteria 6504
14 rootL2_10169292 3300003322 Bacteria 1934
15 rootH1_10032690 3300003323 Bacteria 7693
16 rootH1_10053051 3300003323 Bacteria 6212
17 rootH1_10057788 3300003323 Bacteria 2281
18 rootH1_10151567 3300003323 Bacteria 2915
19 Ga0006562J51391_1058405 3300003578 Bacteria 2840
20 Ga0055539_1000326 3300003752 Bacteria 24199
21 Ga0055532_1000149 3300003758 Bacteria 66954
22 Ga0055525_1000006 3300003759 Bacteria 642912
23 Ga0055525_1000417 3300003759 Bacteria 25804
24 Ga0055535_1000180 3300003761 Bacteria 66954
25 Ga0055542_1001946 3300003762 Bacteria 8054
26 Ga0055529_1000245 3300003763 Bacteria 66949
27 Ga0055526_1007354 3300003771 Bacteria 5746
28 Ga0055530_10001181 3300003791 Bacteria 20175
29 Ga0055541_1001682 3300003841 Bacteria 4669
30 Ga0065165_1000656 3300005262 Bacteria 49919
31 Ga0070658_10025320 3300005327 Bacteria 4757
32 Ga0070676_10124802 3300005328 Bacteria 1620
33 Ga0070683_100226592 3300005329 Bacteria 1776
34 Ga0070690_100082170 3300005330 Bacteria 2109
35 Ga0070690_100415113 3300005330 Bacteria 991
36 Ga0070670_100088066 3300005331 Bacteria 2669
37 Ga0070670_100151833 3300005331 Bacteria 2005
38 Ga0070670_100276248 3300005331 Bacteria 1467
39 Ga0070677_10070739 3300005333 Bacteria 1467
40 Ga0070677_10072089 3300005333 Bacteria 1456
41 Ga0070677_10155743 3300005333 Bacteria 1067
42 Ga0068869_100349390 3300005334 Unclassified 1205
43 Ga0068869_100383749 3300005334 Bacteria 1152
44 Ga0070666_10008268 3300005335 Bacteria 6452
45 Ga0070682_100050176 3300005337 Bacteria 2604
46 Ga0070682_100234702 3300005337 Bacteria 1313
47 Ga0068868_100002199 3300005338 Bacteria 13462
48 Ga0068868_100046638 3300005338 Bacteria 3393
49 Ga0068868_100075517 3300005338 Bacteria 2693
50 Ga0070660_100308910 3300005339 Bacteria 1297
51 Ga0070661_100001832 3300005344 Bacteria 14713
52 Ga0070661_100093752 3300005344 Bacteria 2224
53 Ga0070668_100028394 3300005347 Bacteria 4248
54 Ga0070669_100014650 3300005353 Bacteria 5581
55 Ga0070675_100001074 3300005354 Bacteria 19712
56 Ga0070675_100004321 3300005354 Bacteria 10834
57 Ga0070671_100007790 3300005355 Bacteria 8554
58 Ga0070671_100022571 3300005355 Bacteria 5140
59 Ga0070671_100083533 3300005355 Bacteria 2670
60 Ga0070671_100106024 3300005355 Bacteria 2359
61 Ga0070671_100252895 3300005355 Bacteria 1497
62 Ga0070674_100068989 3300005356 Bacteria 2493
63 Ga0070673_100009810 3300005364 Bacteria 6449
64 Ga0070673_100169161 3300005364 Bacteria 1864
65 Ga0070659_100002375 3300005366 Bacteria 13379
66 Ga0070659_100031493 3300005366 Bacteria 4108
67 Ga0070700_100008919 3300005441 Bacteria 5485
68 Ga0070663_100000001 3300005455 Bacteria 318372
69 Ga0070678_100179821 3300005456 Bacteria 1730
70 Ga0070662_100004399 3300005457 Bacteria 8907
71 Ga0070662_100006160 3300005457 Bacteria 7712
72 Ga0068853_100037433 3300005539 Bacteria 4128
73 Ga0068853_100546801 3300005539 Bacteria 1097
74 Ga0070672_100088590 3300005543 Bacteria 2492
75 Ga0070693_100061609 3300005547 Bacteria 2182
76 Ga0068855_100040196 3300005563 Bacteria 5551
77 Ga0070664_100000016 3300005564 Bacteria 128509
78 Ga0068854_100000124 3300005578 Bacteria 53140
79 Ga0068854_100014889 3300005578 Bacteria 5135
80 Ga0068856_100001285 3300005614 Bacteria 26413
81 Ga0068856_100203234 3300005614 Bacteria 1996
82 Ga0070702_100067783 3300005615 Bacteria 2098
83 Ga0068852_100086558 3300005616 Bacteria 2794
84 Ga0068852_100167513 3300005616 Bacteria 2057
85 Ga0068859_100010331 3300005617 Bacteria 9397
86 Ga0068864_100003722 3300005618 Bacteria 12592
87 Ga0068864_100016321 3300005618 Bacteria 6183
88 Ga0068864_100056096 3300005618 Bacteria 3404
89 Ga0068864_100203480 3300005618 Bacteria 1820
90 Ga0068866_10025814 3300005718 Bacteria 2767
91 Ga0068861_100005129 3300005719 Bacteria 8829
92 Ga0068861_100030007 3300005719 Bacteria 3982
93 Ga0068870_10084946 3300005840 Bacteria 1758
94 Ga0068870_10110975 3300005840 Bacteria 1566
95 Ga0068863_100011848 3300005841 Bacteria 8428
96 Ga0068863_100043122 3300005841 Bacteria 4283
97 Ga0068863_100096296 3300005841 Bacteria 2810
98 Ga0068863_100493133 3300005841 Bacteria 1206
99 Ga0068858_100002455 3300005842 Bacteria 18716
100 Ga0068858_100067199 3300005842 Bacteria 3320
101 Ga0068858_100459506 3300005842 Bacteria 1228
102 Ga0068860_100007353 3300005843 Bacteria 11010
103 Ga0068860_100018150 3300005843 Bacteria 6847
104 Ga0068860_100045308 3300005843 Bacteria 4194
105 Ga0068862_100064457 3300005844 Bacteria 3154
106 Ga0068862_100084487 3300005844 Bacteria 2758
107 Ga0068862_100104274 3300005844 Bacteria 2484
108 Ga0075365_10025135 3300006038 Bacteria 3768
109 Ga0075368_10021610 3300006042 Bacteria 2446
110 Ga0075363_100016344 3300006048 Bacteria 3665
111 Ga0075363_100054304 3300006048 Bacteria 2143
112 Ga0075362_10070702 3300006177 Bacteria 1593
113 Ga0075367_10007185 3300006178 Bacteria 5685
114 Ga0075366_10002438 3300006195 Bacteria 9526
115 Ga0075366_10144636 3300006195 Bacteria 1438
116 Ga0075366_10166983 3300006195 Bacteria 1335
117 Ga0097621_100006661 3300006237 Bacteria 8210
118 Ga0097621_100265849 3300006237 Bacteria 1506
119 Ga0097621_100403683 3300006237 Bacteria 1224
120 Ga0075370_10031343 3300006353 Bacteria 2968
121 Ga0068871_100011230 3300006358 Bacteria 6564
122 Ga0075430_100223991 3300006846 Bacteria 1560
123 Ga0075431_100302270 3300006847 Bacteria 1616
124 Ga0075429_100163605 3300006880 Bacteria 1949
125 Ga0097620_100010330 3300006931 Bacteria 9397
126 Ga0105240_10257633 3300009093 Bacteria 2014
127 Ga0105240_10770139 3300009093 Bacteria 1045
128 Ga0111539_10016994 3300009094 Bacteria 9005
129 Ga0111539_10393795 3300009094 Bacteria 1613
130 Ga0105245_10009658 3300009098 Bacteria 8413
131 Ga0105245_10299027 3300009098 Bacteria 1579
132 Ga0114129_10080975 3300009147 Bacteria 4514
133 Ga0105243_10157413 3300009148 Bacteria 1955
134 Ga0105241_10205886 3300009174 Bacteria 1646
135 Ga0105248_10018741 3300009177 Bacteria 7653
136 Ga0105237_10163016 3300009545 Bacteria 2228
137 Ga0105249_10235839 3300009553 Bacteria 1806
138 Ga0105239_10180719 3300010375 Bacteria 2360
139 Ga0157373_10137761 3300013100 Bacteria 1716
140 Ga0157371_10001722 3300013102 Bacteria 22211
141 Ga0157371_10050626 3300013102 Bacteria 2952
142 Ga0157370_10001175 3300013104 Bacteria 32662
143 Ga0157369_10205644 3300013105 Bacteria 2065
144 Ga0157374_10015418 3300013296 Bacteria 6703
145 Ga0157374_10310568 3300013296 Bacteria 1561
146 Ga0157378_10014200 3300013297 Bacteria 6970
147 Ga0157378_10247741 3300013297 Bacteria 1705
148 Ga0157378_10481873 3300013297 Bacteria 1236
149 Ga0163162_10012165 3300013306 Bacteria 8401
150 Ga0163162_10026322 3300013306 Bacteria 5749
151 Ga0163162_10060107 3300013306 Bacteria 3834
152 Ga0157372_10005008 3300013307 Bacteria 14073
153 Ga0157372_10013706 3300013307 Bacteria 8665
154 Ga0157375_10043226 3300013308 Bacteria 4368
155 Ga0157375_10083172 3300013308 Bacteria 3245
156 Ga0157375_10083607 3300013308 Bacteria 3237
157 Ga0157375_10120230 3300013308 Bacteria 2735
158 Ga0163163_10061111 3300014325 Bacteria 3732
159 Ga0157380_10004965 3300014326 Bacteria 9269
160 Ga0157380_10136389 3300014326 Bacteria 2101
161 Ga0182008_10007906 3300014497 Bacteria 5834
162 Ga0157379_10008582 3300014968 Bacteria 8891
163 Ga0157379_10024519 3300014968 Bacteria 5354
164 Ga0157379_10077870 3300014968 Bacteria 2969
165 Ga0157379_10563313 3300014968 Bacteria 1061
166 Ga0157376_10006844 3300014969 Bacteria 8071
167 Ga0157376_10008302 3300014969 Bacteria 7486
168 Ga0157376_10517476 3300014969 Bacteria 1175
169 Ga0182006_1001760 3300015261 Bacteria 12555
170 Ga0182006_1006994 3300015261 Bacteria 5193
171 Ga0182007_10001066 3300015262 Bacteria 14961
172 Ga0163161_10044706 3300017792 Bacteria 3191
173 Ga0163161_10086947 3300017792 Bacteria 2308
174 Ga0197907_10652968 3300020069 Bacteria 1186
175 Ga0154015_1243737 3300020610 Bacteria 3624
176 Ga0209784_100006 3300025224 Bacteria 930704
177 Ga0209566_100002 3300025225 Bacteria 2614868
178 Ga0209566_100526 3300025225 Bacteria 26148
179 Ga0209566_100895 3300025225 Bacteria 14316
180 Ga0209674_100010 3300025226 Bacteria 1038638
181 Ga0209674_100176 3300025226 Bacteria 79399
182 Ga0209674_100430 3300025226 Bacteria 20230
183 Ga0209674_104368 3300025226 Bacteria 2314
184 Ga0209672_100110 3300025228 Bacteria 95441
185 Ga0209672_100785 3300025228 Bacteria 15134
186 Ga0209147_100018 3300025229 Bacteria 515719
187 Ga0209563_100022 3300025230 Bacteria 643318
188 Ga0209563_100041 3300025230 Bacteria 407467
189 Ga0209258_100028 3300025242 Bacteria 515719
190 Ga0207425_1000149 3300025245 Bacteria 59740
191 Ga0209646_1000043 3300025246 Bacteria 343652
192 Ga0209677_100007 3300025253 Bacteria 1021332
193 Ga0209677_104501 3300025253 Bacteria 3995
194 Ga0209148_1000151 3300025254 Bacteria 156553
195 Ga0209759_1002186 3300025256 Bacteria 8959
196 Ga0209759_1018681 3300025256 Bacteria 1670
197 Ga0209129_1000119 3300025258 Bacteria 138904
198 Ga0209455_1000065 3300025272 Bacteria 321272
199 Ga0209673_1003423 3300025273 Bacteria 9382
200 Ga0209673_1039283 3300025273 Bacteria 1368
201 Ga0209564_1000024 3300025295 Bacteria 535041
202 Ga0209758_1000194 3300025297 Bacteria 134196
203 Ga0209050_1000266 3300025298 Bacteria 111792
204 Ga0209257_1029495 3300025304 Bacteria 1786
205 Ga0207656_10048175 3300025321 Bacteria 1834
206 Ga0207682_10023179 3300025893 Bacteria 2450
207 Ga0207682_10037687 3300025893 Bacteria 1959
208 Ga0207682_10066524 3300025893 Bacteria 1519
209 Ga0207680_10002714 3300025903 Bacteria 8269
210 Ga0207645_10015601 3300025907 Bacteria 5043
211 Ga0207645_10017100 3300025907 Bacteria 4791
212 Ga0207705_10146773 3300025909 Bacteria 1765
213 Ga0207695_10000872 3300025913 Bacteria 54945
214 Ga0207671_10068920 3300025914 Bacteria 2636
215 Ga0207671_10193316 3300025914 Bacteria 1587
216 Ga0207657_10053791 3300025919 Bacteria 3485
217 Ga0207657_10293988 3300025919 Bacteria 1288
218 Ga0207649_10000200 3300025920 Bacteria 49831
219 Ga0207649_10110871 3300025920 Bacteria 1833
220 Ga0207681_10006634 3300025923 Bacteria 7107
221 Ga0207681_10016094 3300025923 Bacteria 4672
222 Ga0207650_10231980 3300025925 Bacteria 1489
223 Ga0207659_10098177 3300025926 Bacteria 2202
224 Ga0207687_10018242 3300025927 Bacteria 4629
225 Ga0207687_10103620 3300025927 Bacteria 2098
226 Ga0207644_10001367 3300025931 Bacteria 15702
227 Ga0207644_10033026 3300025931 Bacteria 3614
228 Ga0207644_10091296 3300025931 Bacteria 2271
229 Ga0207644_10106828 3300025931 Bacteria 2111
230 Ga0207690_10206451 3300025932 Bacteria 1495
231 Ga0207706_10003517 3300025933 Bacteria 14962
232 Ga0207706_10009137 3300025933 Bacteria 9111
233 Ga0207706_10180709 3300025933 Bacteria 1853
234 Ga0207669_10123832 3300025937 Bacteria 1761
235 Ga0207704_10126748 3300025938 Bacteria 1759
236 Ga0207691_10026183 3300025940 Bacteria 5473
237 Ga0207689_10000343 3300025942 Bacteria 43547
238 Ga0207689_10017611 3300025942 Bacteria 6040
239 Ga0207689_10174074 3300025942 Bacteria 1775
240 Ga0207689_10312423 3300025942 Unclassified 1303
241 Ga0207679_10000012 3300025945 Bacteria 339773
242 Ga0207651_10295450 3300025960 Bacteria 1345
243 Ga0207651_10486077 3300025960 Bacteria 1065
244 Ga0207712_10036885 3300025961 Bacteria 3332
245 Ga0207668_10030789 3300025972 Bacteria 3529
246 Ga0207640_10000047 3300025981 Bacteria 98563
247 Ga0207640_10004144 3300025981 Bacteria 7834
248 Ga0207677_10001571 3300026023 Bacteria 12081
249 Ga0207677_10012571 3300026023 Bacteria 4874
250 Ga0207677_10076892 3300026023 Bacteria 2378
251 Ga0207677_10078835 3300026023 Bacteria 2353
252 Ga0207703_10045971 3300026035 Bacteria 3514
253 Ga0207678_10000028 3300026067 Bacteria 115277
254 Ga0207678_10009061 3300026067 Bacteria 8760
255 Ga0207708_10021499 3300026075 Bacteria 4866
256 Ga0207702_10000255 3300026078 Bacteria 61384
257 Ga0207702_10076204 3300026078 Bacteria 2899
258 Ga0207641_10001478 3300026088 Bacteria 23038
259 Ga0207641_10053967 3300026088 Bacteria 3408
260 Ga0207648_10026019 3300026089 Bacteria 5203
261 Ga0207648_10072496 3300026089 Bacteria 3001
262 Ga0207676_10001292 3300026095 Bacteria 18629
263 Ga0207676_10133778 3300026095 Bacteria 2112
264 Ga0207674_10188463 3300026116 Bacteria 2013
265 Ga0207674_10421418 3300026116 Bacteria 1290
266 Ga0207675_100000232 3300026118 Bacteria 52682
267 Ga0207675_100008238 3300026118 Bacteria 9821
268 Ga0207683_10029719 3300026121 Bacteria 4732
269 Ga0207683_10054595 3300026121 Bacteria 3503
270 Ga0207683_10119217 3300026121 Bacteria 2368
271 Ga0207683_10126664 3300026121 Bacteria 2295
272 Ga0207683_10175336 3300026121 Bacteria 1943
273 Ga0207698_10122275 3300026142 Bacteria 2206
274 Ga0207698_10171800 3300026142 Bacteria 1910
275 Ga0209974_10020142 3300027876 Bacteria 2211
276 Ga0268265_10081797 3300028380 Bacteria 2551
277 Ga0268264_10013863 3300028381 Bacteria 6628
278 Ga0268264_10036237 3300028381 Bacteria 4063
279 Ga0268264_10040493 3300028381 Bacteria 3850
280 Ga0265336_10000024 3300028666 Bacteria 188787
281 Ga0307517_10049385 3300028786 Bacteria 4305
282 Ga0307515_10112219 3300028794 Bacteria 3172
283 Ga0265324_10032444 3300029957 Bacteria 1825
284 Ga0316182_1439953 3300030745 Bacteria 2500
285 Ga0307513_10000010 3300031456 Bacteria 360812
286 Ga0307513_10042652 3300031456 Bacteria 4992
287 Ga0307513_10052906 3300031456 Bacteria 4368
288 Ga0307509_10058508 3300031507 Bacteria 4081
289 Ga0307509_10121149 3300031507 Bacteria 2593
290 Ga0307408_100041393 3300031548 Bacteria 3266
291 Ga0307508_10001461 3300031616 Bacteria 26492
292 Ga0307508_10308208 3300031616 Bacteria 1176
293 Ga0307508_10372731 3300031616 Bacteria 1018
294 Ga0265314_10093394 3300031711 Bacteria 1953
295 Ga0307516_10053364 3300031730 Bacteria 3953
296 Ga0307516_10191657 3300031730 Bacteria 1770
297 Ga0307516_10308815 3300031730 Bacteria 1255
298 Ga0307413_10029599 3300031824 Bacteria 3066
299 Ga0307410_10045515 3300031852 Bacteria 2922
300 Ga0307406_10159044 3300031901 Bacteria 1621
301 Ga0307412_10097613 3300031911 Bacteria 2070
302 Ga0307414_10002937 3300032004 Bacteria 9009
303 Ga0307411_10000076 3300032005 Bacteria 30437
304 Ga0307411_10043852 3300032005 Bacteria 2864
305 Ga0307510_10058537 3300033180 Bacteria 3988
306 Ga0373929_0014296 3300035085 Bacteria 1532
307 Ga0373944_0015504 3300035089 Bacteria 2139
308 Ga0373952_0023028 3300035092 Bacteria 1328
309 Ga0373924_0070602 3300035410 Bacteria 1473
310 Ga0373931_0002401 3300035691 Bacteria 8289
311 Ga0373927_0289361 3300035695 Bacteria 1078
312 Ga0373925_0089346 3300037068 Bacteria 2353
313 Ga0373925_0599448 3300037068 Bacteria 907
314 Ga0395899_0010134 3300037312 Bacteria 7227
315 Ga0395900_0000600 3300037418 Bacteria 49320
316 Ga0395900_0003997 3300037418 Bacteria 15752
317 Ga0395900_0014004 3300037418 Bacteria 8188
318 Ga0395900_0136157 3300037418 Bacteria 2516
319 Ga0395905_0006486 3300037471 Bacteria 11773
320 Ga0395905_0064977 3300037471 Bacteria 3415
321 Ga0395905_0086939 3300037471 Bacteria 2930
322 Ga0395901_0038557 3300038443 Bacteria 4943
323 Ga0436361_0698521 3300039447 Bacteria 1322
324 Ga0436363_0253358 3300039450 Unclassified 969
325 Ga0439461_0035053 3300041410 Bacteria 1063
326 Ga0439465_0026811 3300041413 Bacteria 1824
327 Ga0439448_0074444 3300042005 Bacteria 1134
328 Ga0439449_0010795 3300042007 Bacteria 3448
329 Ga0439455_0005529 3300042012 Bacteria 2571
330 Ga0450912_000837 3300042116 Bacteria 1702
331 Ga0450891_001915 3300042129 Bacteria 2128
332 Ga0450903_010131 3300042138 Bacteria 1529
333 Ga0439459_0032400 3300042438 Unclassified 1071
334 Ga0466986_0013751 3300044650 Bacteria 5116
335 Ga0466969_0103507 3300044656 Bacteria 1338
336 Ga0466972_0007977 3300044658 Bacteria 5307
337 Ga0466972_0013531 3300044658 Bacteria 4096
338 Ga0466965_0008089 3300044683 Bacteria 4858
339 Ga0466966_0006300 3300044684 Bacteria 7851
340 Ga0466966_0019292 3300044684 Bacteria 4488
341 Ga0466966_0093297 3300044684 Bacteria 1867
342 Ga0466966_0094162 3300044684 Bacteria 1857
343 Ga0466961_0045161 3300044693 Bacteria 2819
344 Ga0466961_0105327 3300044693 Bacteria 1776
345 Ga0466964_0006808 3300044706 Bacteria 4263
346 Ga0466971_0054966 3300044719 Bacteria 1794
347 Ga0466968_0000848 3300044735 Bacteria 10694
348 Ga0466970_0041155 3300044765 Bacteria 2455
349 Ga0466957_0009294 3300044842 Bacteria 5608
350 Ga0466960_0008286 3300044901 Bacteria 4252
351 Ga0466959_0032214 3300045049 Bacteria 3880
352 Ga0466967_0072385 3300045976 Bacteria 3089
353 Ga0495592_0004992 3300046454 Bacteria 9767
354 Ga0495590_0019584 3300046457 Bacteria 2409
355 Ga0495638_0064419 3300046460 Bacteria 2258
356 Ga0495605_0000118 3300046474 Bacteria 102724
357 Ga0495584_0013018 3300046491 Bacteria 4244
358 Ga0495596_0009550 3300046500 Bacteria 4264
359 Ga0495607_0001981 3300046501 Bacteria 17244
360 Ga0495583_0025428 3300046506 Bacteria 2958
361 Ga0495616_0048893 3300046513 Bacteria 2122
362 Ga0495618_0035582 3300046514 Bacteria 3125
363 Ga0495632_0004148 3300046519 Bacteria 9948
364 Ga0495643_0001777 3300046522 Bacteria 18510
365 Ga0495666_0171012 3300046526 Bacteria 1005
366 Ga0495597_0012183 3300046542 Bacteria 4155
367 Ga0495597_0038654 3300046542 Unclassified 2138
368 Ga0495656_0003227 3300046615 Bacteria 5500
369 Ga0495661_0002001 3300046665 Bacteria 16085
370 Ga0495661_0020080 3300046665 Bacteria 4369
371 Ga0495661_0074424 3300046665 Bacteria 1976
372 Ga0495658_0018194 3300046683 Bacteria 3648
373 Ga0495589_0000136 3300046794 Bacteria 67764
374 Ga0495660_0000068 3300046810 Bacteria 119060
375 Ga0495660_0036972 3300046810 Bacteria 2721
376 Ga0495672_0000631 3300047320 Bacteria 39335
377 Ga0495687_001265 3300047443 Bacteria 23959
378 Ga0495687_006574 3300047443 Bacteria 7085
379 Ga0495677_0000754 3300047445 Bacteria 13058
380 Ga0495626_0000149 3300048091 Bacteria 86385
381 Ga0496100_0027388 3300048903 Bacteria 3505
382 Ga0496102_0339995 3300048905 Bacteria 1413
383 Ga0496104_0298525 3300048907 Bacteria 1523
384 Ga0496106_0040407 3300048909 Bacteria 3493
385 Ga0496107_0006210 3300048910 Bacteria 8212
386 Ga0496107_0092918 3300048910 Bacteria 2206
387 Ga0496108_0037801 3300048911 Bacteria 4022
388 Ga0496108_0057607 3300048911 Bacteria 3264
389 Ga0496108_0083318 3300048911 Bacteria 2713
390 Ga0496110_0022654 3300048913 Bacteria 5336
391 Ga0496111_0059683 3300048914 Bacteria 2764
392 Ga0496111_0212934 3300048914 Bacteria 1435
393 Ga0496113_0030977 3300048916 Bacteria 3877
394 Ga0496113_0100038 3300048916 Bacteria 2246
395 Ga0496113_0430127 3300048916 Bacteria 1060
396 Ga0496114_0016272 3300048917 Bacteria 5991
397 Ga0496114_0248020 3300048917 Bacteria 1567
398 Ga0496123_0004020 3300048926 Bacteria 15892
399 Ga0496124_0110431 3300048927 Bacteria 2214
400 Ga0496125_0025407 3300048928 Bacteria 5423
401 Ga0501300_013451 3300049523 Bacteria 1194
402 Ga0501222_008506 3300049662 Bacteria 1362
403 Ga0501227_011824 3300049665 Bacteria 1906
404 Ga0501235_002851 3300049669 Bacteria 3722
405 Ga0501221_000795 3300049704 Bacteria 5111
406 Ga0501229_000477 3300049706 Bacteria 4536
407 Ga0501265_003366 3300049762 Bacteria 1817
408 nmdc:mga03n38_26359_c1 3300050490 Bacteria 2399
409 nmdc:mga03n38_44796_c1 3300050490 Bacteria 1945
410 nmdc:mga0yw44_322788_c1 3300050492 Bacteria 1037
411 nmdc:mga06z11_195051_c1 3300050494 Bacteria 1174
412 nmdc:mga04h51_46468_c1 3300050495 Bacteria 1439
413 nmdc:mga07m45_121391_c1 3300050496 Bacteria 1509
414 nmdc:mga07m45_147590_c1 3300050496 Bacteria 1363
415 nmdc:mga07m45_38202_c1 3300050496 Bacteria 2679
416 nmdc:mga05p37_74162_c1 3300050507 Bacteria 4188
417 nmdc:mga0qj67_98805_c1 3300050509 Bacteria 2351
418 Ga0500578_0000057 3300053086 Bacteria 120178
419 Ga0500646_0041676 3300053090 Bacteria 1294
420 Ga0500583_0003246 3300053092 Bacteria 5073
421 Ga0500628_001630 3300053129 Bacteria 3800
422 Ga0500642_0000828 3300053130 Bacteria 9022
423 Ga0500652_000334 3300053131 Bacteria 16912
424 Ga0500559_0093630 3300053136 Bacteria 1378
425 Ga0500568_0023142 3300053139 Bacteria 2645
426 Ga0500590_003071 3300053148 Bacteria 7604
427 Ga0500622_0000081 3300053156 Bacteria 102191
428 Ga0587072_000642 3300059643 Bacteria 3728

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003323 rootH1_10032690 rootH1_100326904 238
2 3300042129 Ga0450891_001915 Ga0450891_001915_253_1125 251
3 3300042138 Ga0450903_010131 Ga0450903_010131_234_1106 251
4 3300050496 nmdc:mga07m45_147590_c1 nmdc:mga07m45_147590_c1_155_1039 251
5 iso_pu_bacteria 2643221556 2643796789 252
6 iso_pu_bacteria 2643221684 2644470106 252
7 3300003322 rootL2_10169292 rootL2_101692923 255
8 3300049523 Ga0501300_013451 Ga0501300_013451_269_1141 255
9 3300049662 Ga0501222_008506 Ga0501222_008506_319_1191 255
10 3300049704 Ga0501221_000795 Ga0501221_000795_793_1665 255
11 3300049706 Ga0501229_000477 Ga0501229_000477_497_1369 255
12 3300049762 Ga0501265_003366 Ga0501265_003366_269_1141 255
13 iso_pu_bacteria 2829745981 2829750037 256
14 3300003215 JGI25153J46596_10002209 JGI25153J46596_100022093 257
15 3300003771 Ga0055526_1007354 Ga0055526_10073543 257
16 3300006038 Ga0075365_10025135 Ga0075365_100251351 257
17 3300025245 Ga0207425_1000149 Ga0207425_10001499 257
18 3300025258 Ga0209129_1000119 Ga0209129_100011981 257
19 3300025273 Ga0209673_1039283 Ga0209673_10392832 257
20 3300025295 Ga0209564_1000024 Ga0209564_100002481 257
21 3300025297 Ga0209758_1000194 Ga0209758_100019486 257
22 3300025304 Ga0209257_1029495 Ga0209257_10294952 257
23 3300049669 Ga0501235_002851 Ga0501235_002851_396_1268 257
24 3300050492 nmdc:mga0yw44_322788_c1 nmdc:mga0yw44_322788_c1_108_995 257
25 3300003316 rootH1_10116139 rootH1_101161391 258
26 3300005539 Ga0068853_100546801 Ga0068853_1005468011 258
27 3300050490 nmdc:mga03n38_26359_c1 nmdc:mga03n38_26359_c1_860_1747 260
28 iso_pu_bacteria 2643221592 2643967653 260
29 iso_pu_bacteria 2643221625 2644140475 260
30 iso_pu_bacteria 2643221648 2644273442 260
31 3300003323 rootH1_10053051 rootH1_100530515 261
32 3300005843 Ga0068860_100045308 Ga0068860_1000453083 261
33 3300028381 Ga0268264_10036237 Ga0268264_100362373 261
34 3300032004 Ga0307414_10002937 Ga0307414_100029376 261
35 3300032005 Ga0307411_10000076 Ga0307411_100000762 261
36 3300042116 Ga0450912_000837 Ga0450912_000837_748_1620 261
37 3300044658 Ga0466972_0013531 Ga0466972_0013531_1485_2363 261
38 3300049665 Ga0501227_011824 Ga0501227_011824_423_1295 261
39 3300003316 rootH1_10022645 rootH1_100226452 262
40 3300003322 rootL2_10013604 rootL2_100136045 262
41 3300003791 Ga0055530_10001181 Ga0055530_100011813 262
42 3300005331 Ga0070670_100276248 Ga0070670_1002762481 262
43 3300009094 Ga0111539_10393795 Ga0111539_103937951 262
44 3300014326 Ga0157380_10136389 Ga0157380_101363891 262
45 3300025298 Ga0209050_1000266 Ga0209050_100026653 262
46 3300025925 Ga0207650_10231980 Ga0207650_102319802 262
47 3300025926 Ga0207659_10098177 Ga0207659_100981772 262
48 3300026078 Ga0207702_10076204 Ga0207702_100762043 262
49 3300031456 Ga0307513_10052906 Ga0307513_100529062 263
50 3300005844 Ga0068862_100064457 Ga0068862_1000644574 264
51 3300005844 Ga0068862_100084487 Ga0068862_1000844871 264
52 3300006846 Ga0075430_100223991 Ga0075430_1002239912 264
53 3300009148 Ga0105243_10157413 Ga0105243_101574132 264
54 3300025960 Ga0207651_10295450 Ga0207651_102954501 264
55 3300026089 Ga0207648_10072496 Ga0207648_100724964 264
56 3300028380 Ga0268265_10081797 Ga0268265_100817973 264
57 3300050509 nmdc:mga0qj67_98805_c1 nmdc:mga0qj67_98805_c1_1019_1903 264
58 iso_pu_bacteria 2643221544 2643743515 264
59 iso_pu_bacteria 2643221639 2644220652 264
60 3300005337 Ga0070682_100050176 Ga0070682_1000501764 265
61 3300026116 Ga0207674_10421418 Ga0207674_104214182 265
62 3300037471 Ga0395905_0006486 Ga0395905_0006486_5415_6290 265
63 3300042438 Ga0439459_0032400 Ga0439459_0032400_22_894 265
64 3300003323 rootH1_10057788 rootH1_100577883 266
65 3300005262 Ga0065165_1000656 Ga0065165_100065627 266
66 3300006195 Ga0075366_10002438 Ga0075366_100024386 266
67 3300025273 Ga0209673_1003423 Ga0209673_10034235 266
68 3300003322 rootL2_10135496 rootL2_101354962 267
69 3300025893 Ga0207682_10037687 Ga0207682_100376872 267
70 3300026121 Ga0207683_10054595 Ga0207683_100545953 267
71 3300031456 Ga0307513_10042652 Ga0307513_100426525 267
72 3300031616 Ga0307508_10001461 Ga0307508_1000146111 267
73 3300031616 Ga0307508_10308208 Ga0307508_103082081 267
74 3300031730 Ga0307516_10308815 Ga0307516_103088152 267
75 3300033180 Ga0307510_10058537 Ga0307510_100585373 267
76 iso_pu_bacteria 2585428058 2587732675 267
77 iso_pu_bacteria 2588253510 2588290342 267
78 3300002705 JGI25156J39149_1009475 JGI25156J39149_10094752 268
79 3300003752 Ga0055539_1000326 Ga0055539_100032612 268
80 3300003759 Ga0055525_1000417 Ga0055525_100041713 268
81 3300005331 Ga0070670_100088066 Ga0070670_1000880662 268
82 3300005355 Ga0070671_100083533 Ga0070671_1000835332 268
83 3300005364 Ga0070673_100169161 Ga0070673_1001691612 268
84 3300005616 Ga0068852_100086558 Ga0068852_1000865583 268
85 3300005618 Ga0068864_100056096 Ga0068864_1000560965 268
86 3300005841 Ga0068863_100493133 Ga0068863_1004931332 268
87 3300006048 Ga0075363_100054304 Ga0075363_1000543043 268
88 3300013100 Ga0157373_10137761 Ga0157373_101377612 268
89 3300013104 Ga0157370_10001175 Ga0157370_100011759 268
90 3300020069 Ga0197907_10652968 Ga0197907_106529682 268
91 3300025224 Ga0209784_100006 Ga0209784_100006222 268
92 3300025225 Ga0209566_100002 Ga0209566_100002222 268
93 3300025225 Ga0209566_100895 Ga0209566_1008954 268
94 3300025226 Ga0209674_100010 Ga0209674_100010915 268
95 3300025226 Ga0209674_100176 Ga0209674_10017640 268
96 3300025230 Ga0209563_100041 Ga0209563_100041250 268
97 3300025253 Ga0209677_100007 Ga0209677_100007222 268
98 3300025256 Ga0209759_1018681 Ga0209759_10186812 268
99 3300025931 Ga0207644_10033026 Ga0207644_100330263 268
100 3300026142 Ga0207698_10122275 Ga0207698_101222752 268
101 3300028794 Ga0307515_10112219 Ga0307515_101122192 268
102 3300035089 Ga0373944_0015504 Ga0373944_0015504_667_1545 268
103 3300035410 Ga0373924_0070602 Ga0373924_0070602_47_925 268
104 3300035695 Ga0373927_0289361 Ga0373927_0289361_149_1027 268
105 3300037068 Ga0373925_0089346 Ga0373925_0089346_635_1513 268
106 3300037068 Ga0373925_0599448 Ga0373925_0599448_15_887 268
107 3300041413 Ga0439465_0026811 Ga0439465_0026811_627_1502 268
108 3300044658 Ga0466972_0007977 Ga0466972_0007977_810_1691 268
109 3300044683 Ga0466965_0008089 Ga0466965_0008089_2795_3676 268
110 3300044706 Ga0466964_0006808 Ga0466964_0006808_1031_1912 268
111 3300044735 Ga0466968_0000848 Ga0466968_0000848_8368_9249 268
112 3300044765 Ga0466970_0041155 Ga0466970_0041155_709_1590 268
113 3300044901 Ga0466960_0008286 Ga0466960_0008286_1328_2209 268
114 3300048910 Ga0496107_0092918 Ga0496107_0092918_152_1027 268
115 3300048911 Ga0496108_0057607 Ga0496108_0057607_183_1058 268
116 3300048916 Ga0496113_0030977 Ga0496113_0030977_361_1236 268
117 3300048927 Ga0496124_0110431 Ga0496124_0110431_331_1206 268
118 3300048928 Ga0496125_0025407 Ga0496125_0025407_2787_3668 268
119 3300053086 Ga0500578_0000057 Ga0500578_0000057_97832_98725 268
120 3300059643 Ga0587072_000642 Ga0587072_000642_2265_3146 268
121 iso_pu_bacteria 2585428057 2587728708 268
122 iso_pu_bacteria 2596583598 2597029533 268
123 iso_pu_bacteria 2599185178 2599448300 268
124 iso_pu_bacteria 2900577576 2900578947 268
125 iso_pu_bacteria 2928058823 2928060580 268
126 iso_pu_bacteria 8047673197 8047676943 268
127 3300005330 Ga0070690_100415113 Ga0070690_1004151131 269
128 3300005333 Ga0070677_10070739 Ga0070677_100707392 269
129 3300005338 Ga0068868_100002199 Ga0068868_1000021996 269
130 3300005353 Ga0070669_100014650 Ga0070669_1000146503 269
131 3300005354 Ga0070675_100004321 Ga0070675_1000043215 269
132 3300005355 Ga0070671_100106024 Ga0070671_1001060242 269
133 3300005366 Ga0070659_100031493 Ga0070659_1000314932 269
134 3300005456 Ga0070678_100179821 Ga0070678_1001798212 269
135 3300005457 Ga0070662_100006160 Ga0070662_1000061602 269
136 3300005539 Ga0068853_100037433 Ga0068853_1000374335 269
137 3300005547 Ga0070693_100061609 Ga0070693_1000616091 269
138 3300005563 Ga0068855_100040196 Ga0068855_1000401962 269
139 3300005578 Ga0068854_100014889 Ga0068854_1000148892 269
140 3300005614 Ga0068856_100203234 Ga0068856_1002032342 269
141 3300005615 Ga0070702_100067783 Ga0070702_1000677833 269
142 3300005618 Ga0068864_100016321 Ga0068864_1000163212 269
143 3300005719 Ga0068861_100030007 Ga0068861_1000300072 269
144 3300005841 Ga0068863_100043122 Ga0068863_1000431222 269
145 3300005842 Ga0068858_100459506 Ga0068858_1004595062 269
146 3300005843 Ga0068860_100018150 Ga0068860_1000181505 269
147 3300006237 Ga0097621_100006661 Ga0097621_1000066615 269
148 3300006358 Ga0068871_100011230 Ga0068871_1000112303 269
149 3300009098 Ga0105245_10009658 Ga0105245_100096586 269
150 3300009545 Ga0105237_10163016 Ga0105237_101630162 269
151 3300013102 Ga0157371_10050626 Ga0157371_100506262 269
152 3300013105 Ga0157369_10205644 Ga0157369_102056441 269
153 3300013296 Ga0157374_10015418 Ga0157374_100154182 269
154 3300013306 Ga0163162_10012165 Ga0163162_100121656 269
155 3300013307 Ga0157372_10013706 Ga0157372_100137062 269
156 3300013308 Ga0157375_10083607 Ga0157375_100836072 269
157 3300014968 Ga0157379_10008582 Ga0157379_1000858210 269
158 3300014969 Ga0157376_10008302 Ga0157376_100083024 269
159 3300017792 Ga0163161_10044706 Ga0163161_100447063 269
160 3300025321 Ga0207656_10048175 Ga0207656_100481752 269
161 3300025893 Ga0207682_10066524 Ga0207682_100665242 269
162 3300025907 Ga0207645_10015601 Ga0207645_100156012 269
163 3300025914 Ga0207671_10193316 Ga0207671_101933162 269
164 3300025919 Ga0207657_10053791 Ga0207657_100537912 269
165 3300025920 Ga0207649_10110871 Ga0207649_101108712 269
166 3300025923 Ga0207681_10006634 Ga0207681_100066346 269
167 3300025927 Ga0207687_10018242 Ga0207687_100182422 269
168 3300025932 Ga0207690_10206451 Ga0207690_102064512 269
169 3300025933 Ga0207706_10003517 Ga0207706_100035179 269
170 3300025942 Ga0207689_10000343 Ga0207689_100003437 269
171 3300025981 Ga0207640_10004144 Ga0207640_100041446 269
172 3300026023 Ga0207677_10076892 Ga0207677_100768922 269
173 3300026035 Ga0207703_10045971 Ga0207703_100459712 269
174 3300026067 Ga0207678_10009061 Ga0207678_100090614 269
175 3300026088 Ga0207641_10053967 Ga0207641_100539672 269
176 3300026095 Ga0207676_10133778 Ga0207676_101337782 269
177 3300026118 Ga0207675_100000232 Ga0207675_10000023221 269
178 3300026121 Ga0207683_10119217 Ga0207683_101192172 269
179 3300035085 Ga0373929_0014296 Ga0373929_0014296_211_1134 269
180 3300035092 Ga0373952_0023028 Ga0373952_0023028_250_1173 269
181 3300035691 Ga0373931_0002401 Ga0373931_0002401_6321_7244 269
182 3300048903 Ga0496100_0027388 Ga0496100_0027388_1969_2892 269
183 3300048905 Ga0496102_0339995 Ga0496102_0339995_296_1219 269
184 3300048907 Ga0496104_0298525 Ga0496104_0298525_29_952 269
185 3300048909 Ga0496106_0040407 Ga0496106_0040407_320_1243 269
186 3300048910 Ga0496107_0006210 Ga0496107_0006210_6947_7870 269
187 3300048911 Ga0496108_0037801 Ga0496108_0037801_316_1239 269
188 3300048913 Ga0496110_0022654 Ga0496110_0022654_1828_2751 269
189 3300048914 Ga0496111_0212934 Ga0496111_0212934_29_952 269
190 3300048916 Ga0496113_0100038 Ga0496113_0100038_671_1594 269
191 3300048917 Ga0496114_0016272 Ga0496114_0016272_2393_3316 269
192 3300006042 Ga0075368_10021610 Ga0075368_100216101 270
193 3300006048 Ga0075363_100016344 Ga0075363_1000163444 270
194 3300006177 Ga0075362_10070702 Ga0075362_100707021 270
195 3300006178 Ga0075367_10007185 Ga0075367_100071854 270
196 3300006195 Ga0075366_10166983 Ga0075366_101669832 270
197 3300006353 Ga0075370_10031343 Ga0075370_100313432 270
198 3300009147 Ga0114129_10080975 Ga0114129_100809753 270
199 3300030745 Ga0316182_1439953 Ga0316182_14399532 270
200 3300031456 Ga0307513_10000010 Ga0307513_1000001015 270
201 3300031730 Ga0307516_10053364 Ga0307516_100533643 270
202 3300050490 nmdc:mga03n38_44796_c1 nmdc:mga03n38_44796_c1_182_1069 270
203 3300050494 nmdc:mga06z11_195051_c1 nmdc:mga06z11_195051_c1_35_922 270
204 3300050495 nmdc:mga04h51_46468_c1 nmdc:mga04h51_46468_c1_37_924 270
205 3300050496 nmdc:mga07m45_121391_c1 nmdc:mga07m45_121391_c1_529_1416 270
206 3300050507 nmdc:mga05p37_74162_c1 nmdc:mga05p37_74162_c1_941_1819 270
207 3300005328 Ga0070676_10124802 Ga0070676_101248022 271
208 3300005330 Ga0070690_100082170 Ga0070690_1000821701 271
209 3300005334 Ga0068869_100349390 Ga0068869_1003493902 271
210 3300005334 Ga0068869_100383749 Ga0068869_1003837491 271
211 3300005338 Ga0068868_100075517 Ga0068868_1000755173 271
212 3300005355 Ga0070671_100022571 Ga0070671_1000225711 271
213 3300006195 Ga0075366_10144636 Ga0075366_101446361 271
214 3300006847 Ga0075431_100302270 Ga0075431_1003022701 271
215 3300006880 Ga0075429_100163605 Ga0075429_1001636052 271
216 3300009093 Ga0105240_10770139 Ga0105240_107701391 271
217 3300009094 Ga0111539_10016994 Ga0111539_100169945 271
218 3300009098 Ga0105245_10299027 Ga0105245_102990272 271
219 3300010375 Ga0105239_10180719 Ga0105239_101807192 271
220 3300013297 Ga0157378_10481873 Ga0157378_104818732 271
221 3300014968 Ga0157379_10563313 Ga0157379_105633131 271
222 3300014969 Ga0157376_10006844 Ga0157376_100068443 271
223 3300014969 Ga0157376_10517476 Ga0157376_105174762 271
224 3300025907 Ga0207645_10017100 Ga0207645_100171002 271
225 3300025914 Ga0207671_10068920 Ga0207671_100689203 271
226 3300025927 Ga0207687_10103620 Ga0207687_101036202 271
227 3300025931 Ga0207644_10091296 Ga0207644_100912962 271
228 3300025942 Ga0207689_10312423 Ga0207689_103124232 271
229 3300026023 Ga0207677_10001571 Ga0207677_100015711 271
230 3300026089 Ga0207648_10026019 Ga0207648_100260193 271
231 3300026121 Ga0207683_10175336 Ga0207683_101753361 271
232 3300028666 Ga0265336_10000024 Ga0265336_1000002470 271
233 3300028786 Ga0307517_10049385 Ga0307517_100493854 271
234 3300029957 Ga0265324_10032444 Ga0265324_100324441 271
235 3300031507 Ga0307509_10058508 Ga0307509_100585083 271
236 3300031507 Ga0307509_10121149 Ga0307509_101211493 271
237 3300031548 Ga0307408_100041393 Ga0307408_1000413933 271
238 3300031616 Ga0307508_10372731 Ga0307508_103727312 271
239 3300031711 Ga0265314_10093394 Ga0265314_100933942 271
240 3300031730 Ga0307516_10191657 Ga0307516_101916571 271
241 3300031824 Ga0307413_10029599 Ga0307413_100295992 271
242 3300031852 Ga0307410_10045515 Ga0307410_100455153 271
243 3300031901 Ga0307406_10159044 Ga0307406_101590442 271
244 3300031911 Ga0307412_10097613 Ga0307412_100976133 271
245 3300032005 Ga0307411_10043852 Ga0307411_100438523 271
246 3300037418 Ga0395900_0136157 Ga0395900_0136157_1535_2464 271
247 3300037471 Ga0395905_0064977 Ga0395905_0064977_1813_2718 271
248 3300037471 Ga0395905_0086939 Ga0395905_0086939_519_1448 271
249 3300038443 Ga0395901_0038557 Ga0395901_0038557_2338_3267 271
250 3300041410 Ga0439461_0035053 Ga0439461_0035053_138_1037 271
251 3300042007 Ga0439449_0010795 Ga0439449_0010795_1265_2164 271
252 3300044656 Ga0466969_0103507 Ga0466969_0103507_355_1287 271
253 3300044684 Ga0466966_0019292 Ga0466966_0019292_2057_2989 271
254 3300044684 Ga0466966_0093297 Ga0466966_0093297_837_1745 271
255 3300046460 Ga0495638_0064419 Ga0495638_0064419_1342_2226 271
256 3300046519 Ga0495632_0004148 Ga0495632_0004148_8193_9113 271
257 3300046526 Ga0495666_0171012 Ga0495666_0171012_96_980 271
258 3300046615 Ga0495656_0003227 Ga0495656_0003227_3162_4046 271
259 3300046683 Ga0495658_0018194 Ga0495658_0018194_1101_1985 271
260 3300048917 Ga0496114_0248020 Ga0496114_0248020_603_1487 271
261 3300050496 nmdc:mga07m45_38202_c1 nmdc:mga07m45_38202_c1_1282_2193 271
262 3300053090 Ga0500646_0041676 Ga0500646_0041676_257_1177 271
263 3300053092 Ga0500583_0003246 Ga0500583_0003246_1631_2515 271
264 3300053129 Ga0500628_001630 Ga0500628_001630_1606_2526 271
265 3300053130 Ga0500642_0000828 Ga0500642_0000828_1695_2615 271
266 3300053131 Ga0500652_000334 Ga0500652_000334_15106_16026 271
267 3300053136 Ga0500559_0093630 Ga0500559_0093630_34_930 271
268 3300053139 Ga0500568_0023142 Ga0500568_0023142_1251_2171 271
269 3300053156 Ga0500622_0000081 Ga0500622_0000081_22155_23075 271
270 3300001915 JGI24741J21665_1000658 JGI24741J21665_10006587 272
271 3300001979 JGI24740J21852_10000209 JGI24740J21852_1000020912 272
272 3300001979 JGI24740J21852_10001259 JGI24740J21852_1000125911 272
273 3300002705 JGI25156J39149_1014898 JGI25156J39149_10148982 272
274 3300002738 JGI25154J39366_1001487 JGI25154J39366_10014879 272
275 3300003322 rootL2_10055306 rootL2_100553065 272
276 3300003322 rootL2_10167649 rootL2_101676495 272
277 3300003323 rootH1_10151567 rootH1_101515673 272
278 3300003578 Ga0006562J51391_1058405 Ga0006562J51391_10584052 272
279 3300003758 Ga0055532_1000149 Ga0055532_100014911 272
280 3300003759 Ga0055525_1000006 Ga0055525_1000006309 272
281 3300003761 Ga0055535_1000180 Ga0055535_100018061 272
282 3300003762 Ga0055542_1001946 Ga0055542_10019462 272
283 3300003763 Ga0055529_1000245 Ga0055529_100024561 272
284 3300003841 Ga0055541_1001682 Ga0055541_10016824 272
285 3300005327 Ga0070658_10025320 Ga0070658_100253204 272
286 3300005329 Ga0070683_100226592 Ga0070683_1002265922 272
287 3300005331 Ga0070670_100151833 Ga0070670_1001518333 272
288 3300005333 Ga0070677_10072089 Ga0070677_100720892 272
289 3300005333 Ga0070677_10155743 Ga0070677_101557431 272
290 3300005335 Ga0070666_10008268 Ga0070666_100082682 272
291 3300005337 Ga0070682_100234702 Ga0070682_1002347022 272
292 3300005338 Ga0068868_100046638 Ga0068868_1000466382 272
293 3300005339 Ga0070660_100308910 Ga0070660_1003089101 272
294 3300005344 Ga0070661_100001832 Ga0070661_10000183211 272
295 3300005344 Ga0070661_100093752 Ga0070661_1000937522 272
296 3300005347 Ga0070668_100028394 Ga0070668_1000283943 272
297 3300005354 Ga0070675_100001074 Ga0070675_1000010743 272
298 3300005355 Ga0070671_100007790 Ga0070671_1000077903 272
299 3300005355 Ga0070671_100252895 Ga0070671_1002528952 272
300 3300005356 Ga0070674_100068989 Ga0070674_1000689893 272
301 3300005364 Ga0070673_100009810 Ga0070673_1000098106 272
302 3300005366 Ga0070659_100002375 Ga0070659_10000237510 272
303 3300005441 Ga0070700_100008919 Ga0070700_1000089196 272
304 3300005455 Ga0070663_100000001 Ga0070663_10000000111 272
305 3300005457 Ga0070662_100004399 Ga0070662_10000439911 272
306 3300005543 Ga0070672_100088590 Ga0070672_1000885902 272
307 3300005564 Ga0070664_100000016 Ga0070664_10000001612 272
308 3300005578 Ga0068854_100000124 Ga0068854_10000012440 272
309 3300005614 Ga0068856_100001285 Ga0068856_10000128518 272
310 3300005616 Ga0068852_100167513 Ga0068852_1001675133 272
311 3300005617 Ga0068859_100010331 Ga0068859_1000103313 272
312 3300005618 Ga0068864_100003722 Ga0068864_1000037226 272
313 3300005618 Ga0068864_100203480 Ga0068864_1002034802 272
314 3300005718 Ga0068866_10025814 Ga0068866_100258144 272
315 3300005719 Ga0068861_100005129 Ga0068861_1000051294 272
316 3300005840 Ga0068870_10084946 Ga0068870_100849462 272
317 3300005840 Ga0068870_10110975 Ga0068870_101109752 272
318 3300005841 Ga0068863_100011848 Ga0068863_1000118485 272
319 3300005841 Ga0068863_100096296 Ga0068863_1000962962 272
320 3300005842 Ga0068858_100002455 Ga0068858_1000024553 272
321 3300005842 Ga0068858_100067199 Ga0068858_1000671994 272
322 3300005843 Ga0068860_100007353 Ga0068860_1000073533 272
323 3300005844 Ga0068862_100104274 Ga0068862_1001042743 272
324 3300006237 Ga0097621_100265849 Ga0097621_1002658491 272
325 3300006237 Ga0097621_100403683 Ga0097621_1004036832 272
326 3300006931 Ga0097620_100010330 Ga0097620_1000103303 272
327 3300009093 Ga0105240_10257633 Ga0105240_102576331 272
328 3300009174 Ga0105241_10205886 Ga0105241_102058862 272
329 3300009177 Ga0105248_10018741 Ga0105248_100187416 272
330 3300009553 Ga0105249_10235839 Ga0105249_102358392 272
331 3300013102 Ga0157371_10001722 Ga0157371_100017229 272
332 3300013296 Ga0157374_10310568 Ga0157374_103105682 272
333 3300013297 Ga0157378_10014200 Ga0157378_100142007 272
334 3300013297 Ga0157378_10247741 Ga0157378_102477412 272
335 3300013306 Ga0163162_10026322 Ga0163162_100263222 272
336 3300013306 Ga0163162_10060107 Ga0163162_100601072 272
337 3300013307 Ga0157372_10005008 Ga0157372_1000500812 272
338 3300013308 Ga0157375_10043226 Ga0157375_100432261 272
339 3300013308 Ga0157375_10083172 Ga0157375_100831722 272
340 3300013308 Ga0157375_10120230 Ga0157375_101202304 272
341 3300014325 Ga0163163_10061111 Ga0163163_100611112 272
342 3300014326 Ga0157380_10004965 Ga0157380_1000496511 272
343 3300014497 Ga0182008_10007906 Ga0182008_100079067 272
344 3300014968 Ga0157379_10024519 Ga0157379_100245196 272
345 3300014968 Ga0157379_10077870 Ga0157379_100778702 272
346 3300015261 Ga0182006_1001760 Ga0182006_100176011 272
347 3300015261 Ga0182006_1006994 Ga0182006_10069947 272
348 3300015262 Ga0182007_10001066 Ga0182007_100010663 272
349 3300017792 Ga0163161_10086947 Ga0163161_100869472 272
350 3300020610 Ga0154015_1243737 Ga0154015_12437374 272
351 3300025225 Ga0209566_100526 Ga0209566_10052614 272
352 3300025226 Ga0209674_100430 Ga0209674_10043010 272
353 3300025226 Ga0209674_104368 Ga0209674_1043682 272
354 3300025228 Ga0209672_100110 Ga0209672_10011061 272
355 3300025228 Ga0209672_100785 Ga0209672_1007853 272
356 3300025229 Ga0209147_100018 Ga0209147_100018284 272
357 3300025230 Ga0209563_100022 Ga0209563_100022307 272
358 3300025242 Ga0209258_100028 Ga0209258_100028284 272
359 3300025246 Ga0209646_1000043 Ga0209646_1000043303 272
360 3300025253 Ga0209677_104501 Ga0209677_1045012 272
361 3300025254 Ga0209148_1000151 Ga0209148_1000151139 272
362 3300025256 Ga0209759_1002186 Ga0209759_10021869 272
363 3300025272 Ga0209455_1000065 Ga0209455_1000065284 272
364 3300025893 Ga0207682_10023179 Ga0207682_100231792 272
365 3300025903 Ga0207680_10002714 Ga0207680_100027147 272
366 3300025909 Ga0207705_10146773 Ga0207705_101467732 272
367 3300025913 Ga0207695_10000872 Ga0207695_1000087220 272
368 3300025919 Ga0207657_10293988 Ga0207657_102939882 272
369 3300025920 Ga0207649_10000200 Ga0207649_1000020040 272
370 3300025923 Ga0207681_10016094 Ga0207681_100160947 272
371 3300025931 Ga0207644_10001367 Ga0207644_100013676 272
372 3300025931 Ga0207644_10106828 Ga0207644_101068282 272
373 3300025933 Ga0207706_10009137 Ga0207706_100091372 272
374 3300025933 Ga0207706_10180709 Ga0207706_101807093 272
375 3300025937 Ga0207669_10123832 Ga0207669_101238323 272
376 3300025938 Ga0207704_10126748 Ga0207704_101267482 272
377 3300025940 Ga0207691_10026183 Ga0207691_100261834 272
378 3300025942 Ga0207689_10017611 Ga0207689_100176113 272
379 3300025942 Ga0207689_10174074 Ga0207689_101740742 272
380 3300025945 Ga0207679_10000012 Ga0207679_10000012290 272
381 3300025960 Ga0207651_10486077 Ga0207651_104860771 272
382 3300025961 Ga0207712_10036885 Ga0207712_100368853 272
383 3300025972 Ga0207668_10030789 Ga0207668_100307894 272
384 3300025981 Ga0207640_10000047 Ga0207640_1000004723 272
385 3300026023 Ga0207677_10012571 Ga0207677_100125713 272
386 3300026023 Ga0207677_10078835 Ga0207677_100788354 272
387 3300026067 Ga0207678_10000028 Ga0207678_1000002811 272
388 3300026075 Ga0207708_10021499 Ga0207708_100214996 272
389 3300026078 Ga0207702_10000255 Ga0207702_1000025511 272
390 3300026088 Ga0207641_10001478 Ga0207641_1000147819 272
391 3300026095 Ga0207676_10001292 Ga0207676_100012926 272
392 3300026116 Ga0207674_10188463 Ga0207674_101884632 272
393 3300026118 Ga0207675_100008238 Ga0207675_1000082385 272
394 3300026121 Ga0207683_10029719 Ga0207683_100297193 272
395 3300026121 Ga0207683_10126664 Ga0207683_101266643 272
396 3300026142 Ga0207698_10171800 Ga0207698_101718002 272
397 3300027876 Ga0209974_10020142 Ga0209974_100201422 272
398 3300028381 Ga0268264_10013863 Ga0268264_100138637 272
399 3300028381 Ga0268264_10040493 Ga0268264_100404934 272
400 3300037312 Ga0395899_0010134 Ga0395899_0010134_1804_2697 272
401 3300037418 Ga0395900_0000600 Ga0395900_0000600_31141_32034 272
402 3300037418 Ga0395900_0003997 Ga0395900_0003997_6105_6986 272
403 3300037418 Ga0395900_0014004 Ga0395900_0014004_743_1636 272
404 3300039447 Ga0436361_0698521 Ga0436361_0698521_114_995 272
405 3300039450 Ga0436363_0253358 Ga0436363_0253358_12_899 272
406 3300042005 Ga0439448_0074444 Ga0439448_0074444_169_1071 272
407 3300042012 Ga0439455_0005529 Ga0439455_0005529_1496_2398 272
408 3300044650 Ga0466986_0013751 Ga0466986_0013751_2701_3582 272
409 3300044684 Ga0466966_0006300 Ga0466966_0006300_2596_3489 272
410 3300044684 Ga0466966_0094162 Ga0466966_0094162_432_1325 272
411 3300044693 Ga0466961_0045161 Ga0466961_0045161_1572_2465 272
412 3300044693 Ga0466961_0105327 Ga0466961_0105327_273_1229 272
413 3300044719 Ga0466971_0054966 Ga0466971_0054966_234_1127 272
414 3300044842 Ga0466957_0009294 Ga0466957_0009294_138_1031 272
415 3300045049 Ga0466959_0032214 Ga0466959_0032214_1305_2198 272
416 3300045976 Ga0466967_0072385 Ga0466967_0072385_766_1647 272
417 3300046454 Ga0495592_0004992 Ga0495592_0004992_8348_9232 272
418 3300046457 Ga0495590_0019584 Ga0495590_0019584_1114_2007 272
419 3300046474 Ga0495605_0000118 Ga0495605_0000118_58919_59812 272
420 3300046491 Ga0495584_0013018 Ga0495584_0013018_727_1623 272
421 3300046500 Ga0495596_0009550 Ga0495596_0009550_1305_2201 272
422 3300046501 Ga0495607_0001981 Ga0495607_0001981_12745_13638 272
423 3300046506 Ga0495583_0025428 Ga0495583_0025428_975_1871 272
424 3300046513 Ga0495616_0048893 Ga0495616_0048893_956_1891 272
425 3300046514 Ga0495618_0035582 Ga0495618_0035582_1456_2340 272
426 3300046522 Ga0495643_0001777 Ga0495643_0001777_12745_13638 272
427 3300046542 Ga0495597_0012183 Ga0495597_0012183_2100_2996 272
428 3300046542 Ga0495597_0038654 Ga0495597_0038654_1069_1953 272
429 3300046665 Ga0495661_0002001 Ga0495661_0002001_2668_3561 272
430 3300046665 Ga0495661_0020080 Ga0495661_0020080_182_1066 272
431 3300046665 Ga0495661_0074424 Ga0495661_0074424_780_1679 272
432 3300046794 Ga0495589_0000136 Ga0495589_0000136_39411_40304 272
433 3300046810 Ga0495660_0000068 Ga0495660_0000068_35231_36124 272
434 3300046810 Ga0495660_0036972 Ga0495660_0036972_91_1032 272
435 3300047320 Ga0495672_0000631 Ga0495672_0000631_21922_22815 272
436 3300047443 Ga0495687_001265 Ga0495687_001265_6398_7291 272
437 3300047443 Ga0495687_006574 Ga0495687_006574_113_997 272
438 3300047445 Ga0495677_0000754 Ga0495677_0000754_4028_4921 272
439 3300048091 Ga0495626_0000149 Ga0495626_0000149_82912_83805 272
440 3300048911 Ga0496108_0083318 Ga0496108_0083318_1227_2120 272
441 3300048914 Ga0496111_0059683 Ga0496111_0059683_524_1417 272
442 3300048916 Ga0496113_0430127 Ga0496113_0430127_35_970 272
443 3300048926 Ga0496123_0004020 Ga0496123_0004020_4976_5911 272
444 3300053148 Ga0500590_003071 Ga0500590_003071_258_1142 272

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

38

97

0.93

PF03466

LysR_substrate

LysR substrate binding domain

121

319

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xxp-assembly1.cif.gz_B crystal structure of cbnr_dbd-dna complex 0.9063 9 76
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.9061 9 76
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.9055 9 76
4iht-assembly2.cif.gz_C crystal structure of benm_dbd/bena site 1 dna complex 0.9028 9 76
4iht-assembly1.cif.gz_A crystal structure of benm_dbd/bena site 1 dna complex 0.899 9 76
ID Description Score Start End Superfamily
af_P9WMF3_10_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9373 12 76 1.10.10.10
af_Q58520_10_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9302 7 75 1.10.10.10
af_P0ACR0_3_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9272 10 76 1.10.10.10
af_Q2G0C6_1_82_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9237 9 76 1.10.10.10
af_Q2G1Q6_4_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9191 9 76 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A833N481-F1-model_v4 deleted 0.9394 9 76
AF-A0A2Y6EL52-F1-model_v4 LYSR-type transcriptional regulator 0.9098 7 76 GO:0003700
GO:0006351
GO:0043565
AF-A0A7Y8B7Z0-F1-model_v4 deleted 0.9075 5 76
AF-A0A418R260-F1-model_v4 LysR family transcriptional regulator 0.8919 1 76 GO:0003700
AF-A0A377TUX1-F1-model_v4 DNA-binding transcriptional activator TdcA 0.8799 5 76 GO:0003677
GO:0003700
GO:0005829

Feature Viewer

pLDDT pTM Quality
86.06 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map