F445287

General Info

Members Datasets Scaffolds Average Seq Length
444 244 886 366

Family's Representative Sequence

Representative Sequence 3300025912|Ga0207707_10247282|Ga0207707_102472821
Length 424
Sequence MSNGLPLKAPKPKLQAPEKHQISSTKTVTGADCDLVLGVSLELGLWSFIDRHSSLDTGAPFCYQTGVRRELLKDISRVVVKLGTGVLTDSRKQPDLAQLEQLVAQIAGQRKAGREVVIVSSGAVGAGMGALGYEKRPAELAELQACAAVGQSRLMSIYEKLFAKHDLHVAQVLLTHDDLEHHERHLNARNTLVTLLRHGVVPIINENDAISFTELKFGDNDRLSALVASLLPADLLLILTTVDGVIENFGKSNPKTISVIEHIDGAIEKMAGGTDSVTAVGGMKSKIEAAKIVVRSGIPLVIGSGKKKSLLARVIDGEDEGTLFVPQLTKLQGRKRWIAFFHYPKGALFVDEGAKQALREKGKSLLPPGIARCEGNFAAEDVVRICDLNGTEFARGIAAFSSSEINARTLQRVEVVHRDNLVIL

Samples

Sample ID Description Type Environment
1 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
70 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
71 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
74 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
109 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
110 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
111 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
112 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
113 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
114 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
115 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
116 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
117 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
118 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
119 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
120 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
121 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
122 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
123 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
124 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
125 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
130 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
137 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
138 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
139 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
140 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
141 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
142 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
143 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
144 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
154 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
155 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
156 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
157 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
158 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
159 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
160 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
161 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
162 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
163 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
168 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
169 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
170 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
171 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
172 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
173 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
174 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
179 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
180 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
181 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
182 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
188 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
189 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
190 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
194 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
195 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
196 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
199 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
200 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
201 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
202 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
203 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
204 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
205 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
208 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
209 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
210 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
211 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
212 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
226 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
227 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
228 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
229 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
231 2643221559 Lysobacter sp. Root559 Isolate Unclassified
232 2643221573 Lysobacter sp. Root604 Isolate Unclassified
233 2643221586 Lysobacter sp. Root667 Isolate Unclassified
234 2643221593 Lysobacter sp. Root690 Isolate Unclassified
235 2643221695 Lysobacter sp. Root494 Isolate Unclassified
236 2643221720 Lysobacter sp. Root916 Isolate Unclassified
237 2738543009 Luteibacter sp. OK325 Isolate Unclassified
238 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
239 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
240 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
241 2919404418 Luteibacter sp. 3190 Isolate Unclassified
242 2919513703 Luteimonas sp. 3794 Isolate Unclassified
243 2919675420 Luteimonas terrae 4099 Isolate Unclassified
244 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.85
Metatranscriptomes 0
Isolates 3.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.99
Nodule 0
Rhizoplane 0.45
Rhizosphere 72.97
Stem 0
Stem Tuber 0
Unclassified 6.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207707_10247282 3300025912 Bacteria 1549
2 JGI25151J46595_10000032 3300003187 Bacteria 195408
3 JGI25151J46595_10015363 3300003187 Bacteria 3376
4 rootH2_10018598 3300003320 Bacteria 12285
5 rootH2_10086489 3300003320 Bacteria 2289
6 rootH1_10016988 3300003323 Bacteria 2598
7 rootH1_10094619 3300003323 Bacteria 6320
8 Ga0055526_1001840 3300003771 Bacteria 14675
9 Ga0055537_1000231 3300003773 Bacteria 40770
10 Ga0055524_1004408 3300003775 Bacteria 6494
11 Ga0055536_1001751 3300003781 Bacteria 12804
12 Ga0055536_1002005 3300003781 Bacteria 11676
13 Ga0055536_1003816 3300003781 Bacteria 7937
14 Ga0055536_1005072 3300003781 Bacteria 6534
15 Ga0055536_1015435 3300003781 Bacteria 2614
16 Ga0055534_1000026 3300003784 Bacteria 130908
17 Ga0055530_10002120 3300003791 Bacteria 13190
18 Ga0055530_10002124 3300003791 Bacteria 13177
19 Ga0055530_10002491 3300003791 Bacteria 11791
20 Ga0055531_10004847 3300003794 Bacteria 8028
21 Ga0055531_10005009 3300003794 Bacteria 7856
22 Ga0055531_10008561 3300003794 Bacteria 5370
23 Ga0055531_10008966 3300003794 Bacteria 5179
24 Ga0055531_10010451 3300003794 Bacteria 4609
25 Ga0055531_10011021 3300003794 Bacteria 4417
26 Ga0055531_10011065 3300003794 Bacteria 4403
27 Ga0055531_10011668 3300003794 Bacteria 4210
28 Ga0055531_10012793 3300003794 Bacteria 3915
29 Ga0055531_10014051 3300003794 Bacteria 3638
30 Ga0065165_1002100 3300005262 Bacteria 18232
31 Ga0065704_10070476 3300005289 Bacteria 23424
32 Ga0065704_10070915 3300005289 Bacteria 14696
33 Ga0070683_100182490 3300005329 Unclassified 1992
34 Ga0070690_100001178 3300005330 Bacteria 13454
35 Ga0070670_100029829 3300005331 Bacteria 4697
36 Ga0070666_10000005 3300005335 Bacteria 343092
37 Ga0070666_10058462 3300005335 Unclassified 2607
38 Ga0070660_100098463 3300005339 Bacteria 2315
39 Ga0070689_100000377 3300005340 Bacteria 26255
40 Ga0070689_100315882 3300005340 Unclassified 1303
41 Ga0070688_100022738 3300005365 Bacteria 3679
42 Ga0070667_100016300 3300005367 Bacteria 6147
43 Ga0070714_100080588 3300005435 Bacteria 2833
44 Ga0070711_100001874 3300005439 Bacteria 11750
45 Ga0070700_100159117 3300005441 Unclassified 1553
46 Ga0070708_100116784 3300005445 Bacteria 2457
47 Ga0070662_100116784 3300005457 Bacteria 2040
48 Ga0070681_10081759 3300005458 Bacteria 3186
49 Ga0068867_100152430 3300005459 Bacteria 1817
50 Ga0070685_10116079 3300005466 Bacteria 1656
51 Ga0070707_100060749 3300005468 Bacteria 3625
52 Ga0070699_100119662 3300005518 Bacteria 2315
53 Ga0068853_100073458 3300005539 Bacteria 2982
54 Ga0070686_100034981 3300005544 Bacteria 3100
55 Ga0070686_100093006 3300005544 Bacteria 2021
56 Ga0070686_100100510 3300005544 Bacteria 1953
57 Ga0070686_100104235 3300005544 Bacteria 1921
58 Ga0070686_100153813 3300005544 Unclassified 1613
59 Ga0070665_100000211 3300005548 Bacteria 100358
60 Ga0070665_100053747 3300005548 Bacteria 4039
61 Ga0070704_100003254 3300005549 Bacteria 9284
62 Ga0068855_100001359 3300005563 Bacteria 30323
63 Ga0068855_100008226 3300005563 Bacteria 12611
64 Ga0068856_100000172 3300005614 Bacteria 67506
65 Ga0068856_100162031 3300005614 Bacteria 2247
66 Ga0068856_100385314 3300005614 Bacteria 1421
67 Ga0070702_100193186 3300005615 Unclassified 1341
68 Ga0068859_100020653 3300005617 Bacteria 6609
69 Ga0068863_100021291 3300005841 Bacteria 6188
70 Ga0068858_100030619 3300005842 Bacteria 4997
71 Ga0068858_100138298 3300005842 Bacteria 2286
72 Ga0068860_100134833 3300005843 Bacteria 2371
73 Ga0068862_100046360 3300005844 Bacteria 3709
74 Ga0081539_10000597 3300005985 Bacteria 73805
75 Ga0075364_10113853 3300006051 Bacteria 1807
76 Ga0097621_100019204 3300006237 Bacteria 5242
77 Ga0097621_100053428 3300006237 Bacteria 3294
78 Ga0097620_100020652 3300006931 Bacteria 6609
79 Ga0075435_100098279 3300007076 Bacteria 2423
80 Ga0099794_10125644 3300007265 Bacteria 1293
81 Ga0105251_10000437 3300009011 Bacteria 40388
82 Ga0105240_10005588 3300009093 Bacteria 18681
83 Ga0105240_10072011 3300009093 Bacteria 4273
84 Ga0105240_10113239 3300009093 Unclassified 3278
85 Ga0105240_10297781 3300009093 Bacteria 1846
86 Ga0111539_10006264 3300009094 Bacteria 15359
87 Ga0111539_10061432 3300009094 Bacteria 4452
88 Ga0111539_10157307 3300009094 Bacteria 2659
89 Ga0105245_10074377 3300009098 Bacteria 3092
90 Ga0105247_10012056 3300009101 Bacteria 5193
91 Ga0105247_10024169 3300009101 Bacteria 3661
92 Ga0105242_10021648 3300009176 Bacteria 5050
93 Ga0105237_10395779 3300009545 Bacteria 1386
94 Ga0105238_10003835 3300009551 Bacteria 14930
95 Ga0105238_10004550 3300009551 Bacteria 13724
96 Ga0105238_10013121 3300009551 Bacteria 8362
97 Ga0105238_10021458 3300009551 Bacteria 6578
98 Ga0105238_10037805 3300009551 Bacteria 4905
99 Ga0105238_10099046 3300009551 Bacteria 2898
100 Ga0105238_10148272 3300009551 Bacteria 2322
101 Ga0105249_10030490 3300009553 Bacteria 4876
102 Ga0099796_10061667 3300010159 Unclassified 1331
103 Ga0105246_10056026 3300011119 Bacteria 2723
104 Ga0157371_10000400 3300013102 Bacteria 54327
105 Ga0157374_10080308 3300013296 Bacteria 3093
106 Ga0163162_10000489 3300013306 Bacteria 36741
107 Ga0157372_10069210 3300013307 Bacteria 3970
108 Ga0157375_10000045 3300013308 Bacteria 151387
109 Ga0163163_10000239 3300014325 Bacteria 56166
110 Ga0163163_10005152 3300014325 Bacteria 11269
111 Ga0163163_10153163 3300014325 Bacteria 2349
112 Ga0157380_10011386 3300014326 Bacteria 6428
113 Ga0157379_10148439 3300014968 Bacteria 2115
114 Ga0157379_10219001 3300014968 Bacteria 1725
115 Ga0182006_1000085 3300015261 Bacteria 117595
116 Ga0182007_10000098 3300015262 Bacteria 61202
117 Ga0182005_1000606 3300015265 Bacteria 17393
118 Ga0163161_10013348 3300017792 Bacteria 5715
119 Ga0163161_10064333 3300017792 Bacteria 2675
120 Ga0207425_1004886 3300025245 Bacteria 3926
121 Ga0209565_1000022 3300025263 Bacteria 390888
122 Ga0209673_1000110 3300025273 Bacteria 181173
123 Ga0209675_1000060 3300025291 Bacteria 184316
124 Ga0209675_1008691 3300025291 Bacteria 3688
125 Ga0209675_1014152 3300025291 Bacteria 2445
126 Ga0209676_1000034 3300025292 Bacteria 460125
127 Ga0209676_1000219 3300025292 Bacteria 125330
128 Ga0209676_1001097 3300025292 Bacteria 30146
129 Ga0209676_1001110 3300025292 Bacteria 29893
130 Ga0209676_1003546 3300025292 Bacteria 9477
131 Ga0209676_1004172 3300025292 Bacteria 8213
132 Ga0209676_1004330 3300025292 Bacteria 7965
133 Ga0209676_1004424 3300025292 Bacteria 7842
134 Ga0209025_1000005 3300025294 Bacteria 1272149
135 Ga0209025_1001408 3300025294 Bacteria 31877
136 Ga0209025_1017654 3300025294 Bacteria 4100
137 Ga0209564_1000304 3300025295 Bacteria 97304
138 Ga0209564_1005424 3300025295 Bacteria 7290
139 Ga0209050_1001060 3300025298 Bacteria 33818
140 Ga0209050_1001440 3300025298 Bacteria 25569
141 Ga0209050_1009770 3300025298 Bacteria 4843
142 Ga0209256_1001956 3300025299 Bacteria 18677
143 Ga0209256_1003717 3300025299 Bacteria 10342
144 Ga0209256_1020436 3300025299 Bacteria 2066
145 Ga0209051_1000763 3300025303 Bacteria 34226
146 Ga0209051_1008672 3300025303 Bacteria 5351
147 Ga0209257_1000255 3300025304 Bacteria 123098
148 Ga0209257_1000283 3300025304 Bacteria 113507
149 Ga0209257_1000942 3300025304 Bacteria 40190
150 Ga0209257_1003658 3300025304 Bacteria 12895
151 Ga0209257_1005663 3300025304 Bacteria 8625
152 Ga0209257_1005877 3300025304 Bacteria 8283
153 Ga0209257_1007996 3300025304 Bacteria 6176
154 Ga0209257_1008731 3300025304 Bacteria 5644
155 Ga0207713_1000792 3300025735 Bacteria 29285
156 Ga0207710_10035638 3300025900 Bacteria 2190
157 Ga0207688_10024490 3300025901 Bacteria 3310
158 Ga0207680_10000005 3300025903 Bacteria 660983
159 Ga0207680_10044565 3300025903 Unclassified 2610
160 Ga0207695_10132823 3300025913 Bacteria 2445
161 Ga0207693_10264571 3300025915 Bacteria 1348
162 Ga0207663_10044211 3300025916 Unclassified 2733
163 Ga0207657_10189081 3300025919 Unclassified 1662
164 Ga0207694_10002498 3300025924 Bacteria 14951
165 Ga0207694_10003754 3300025924 Bacteria 12036
166 Ga0207694_10009159 3300025924 Bacteria 7472
167 Ga0207694_10013114 3300025924 Bacteria 6241
168 Ga0207694_10053164 3300025924 Bacteria 3140
169 Ga0207694_10065492 3300025924 Bacteria 2833
170 Ga0207650_10019045 3300025925 Bacteria 4824
171 Ga0207664_10111633 3300025929 Bacteria 2275
172 Ga0207686_10075233 3300025934 Unclassified 2185
173 Ga0207670_10000636 3300025936 Bacteria 18770
174 Ga0207670_10118649 3300025936 Unclassified 1919
175 Ga0207670_10139882 3300025936 Unclassified 1784
176 Ga0207667_10000933 3300025949 Bacteria 37283
177 Ga0207667_10015959 3300025949 Bacteria 8505
178 Ga0207712_10057386 3300025961 Bacteria 2747
179 Ga0207658_10009494 3300025986 Bacteria 6602
180 Ga0207677_10069929 3300026023 Bacteria 2471
181 Ga0207703_10033368 3300026035 Bacteria 4080
182 Ga0207708_10158535 3300026075 Bacteria 1786
183 Ga0207702_10004142 3300026078 Bacteria 12999
184 Ga0207674_10101338 3300026116 Bacteria 2860
185 Ga0268266_10000001 3300028379 Bacteria 4040580
186 Ga0268266_10000004 3300028379 Bacteria 1495817
187 Ga0268265_10128623 3300028380 Unclassified 2101
188 Ga0268264_10270549 3300028381 Bacteria 1587
189 Ga0265337_1001358 3300028556 Bacteria 12067
190 Ga0265337_1001384 3300028556 Bacteria 11913
191 Ga0265337_1004040 3300028556 Bacteria 6195
192 Ga0265337_1004847 3300028556 Bacteria 5498
193 Ga0265326_10005487 3300028558 Bacteria 3998
194 Ga0265326_10032884 3300028558 Unclassified 1477
195 Ga0265326_10033192 3300028558 Unclassified 1469
196 Ga0265319_1000051 3300028563 Bacteria 97169
197 Ga0265319_1028402 3300028563 Unclassified 1973
198 Ga0265334_10013758 3300028573 Bacteria 3382
199 Ga0265318_10051444 3300028577 Bacteria 1547
200 Ga0265323_10000237 3300028653 Bacteria 32647
201 Ga0265323_10001702 3300028653 Bacteria 10498
202 Ga0265322_10000313 3300028654 Bacteria 20460
203 Ga0265336_10000985 3300028666 Bacteria 14044
204 Ga0265336_10017303 3300028666 Bacteria 2348
205 Ga0265336_10023262 3300028666 Bacteria 1967
206 Ga0265338_10000029 3300028800 Bacteria 271824
207 Ga0265338_10000096 3300028800 Bacteria 164859
208 Ga0265338_10000197 3300028800 Bacteria 113587
209 Ga0265338_10000433 3300028800 Bacteria 75181
210 Ga0265338_10001868 3300028800 Bacteria 33087
211 Ga0265338_10002793 3300028800 Bacteria 25528
212 Ga0265338_10004653 3300028800 Bacteria 18438
213 Ga0265338_10006124 3300028800 Bacteria 15438
214 Ga0265338_10006293 3300028800 Bacteria 15174
215 Ga0265338_10006514 3300028800 Bacteria 14844
216 Ga0265338_10011251 3300028800 Bacteria 10362
217 Ga0265338_10017391 3300028800 Bacteria 7752
218 Ga0265338_10029314 3300028800 Bacteria 5457
219 Ga0265338_10029847 3300028800 Bacteria 5395
220 Ga0265338_10039145 3300028800 Bacteria 4479
221 Ga0265338_10040249 3300028800 Bacteria 4394
222 Ga0265338_10046024 3300028800 Bacteria 4003
223 Ga0265338_10061676 3300028800 Bacteria 3285
224 Ga0265338_10091833 3300028800 Bacteria 2506
225 Ga0265338_10103495 3300028800 Bacteria 2312
226 Ga0265338_10221026 3300028800 Bacteria 1415
227 Ga0265324_10000998 3300029957 Bacteria 17403
228 Ga0265324_10002564 3300029957 Bacteria 9174
229 Ga0265324_10004454 3300029957 Bacteria 6323
230 Ga0265324_10011492 3300029957 Bacteria 3371
231 Ga0265324_10016664 3300029957 Bacteria 2678
232 Ga0265324_10044384 3300029957 Bacteria 1532
233 Ga0316183_1029479 3300030742 Bacteria 1455
234 Ga0265332_10017223 3300031238 Bacteria 3188
235 Ga0265320_10000583 3300031240 Bacteria 28117
236 Ga0265320_10006602 3300031240 Bacteria 7292
237 Ga0265320_10010692 3300031240 Bacteria 5446
238 Ga0265320_10023263 3300031240 Bacteria 3300
239 Ga0265325_10019045 3300031241 Bacteria 3800
240 Ga0265325_10020358 3300031241 Bacteria 3657
241 Ga0265329_10001249 3300031242 Bacteria 12429
242 Ga0265329_10010089 3300031242 Bacteria 3486
243 Ga0265329_10012103 3300031242 Bacteria 3114
244 Ga0265340_10002492 3300031247 Bacteria 10465
245 Ga0265340_10015286 3300031247 Bacteria 3991
246 Ga0265339_10005661 3300031249 Bacteria 8294
247 Ga0265339_10015638 3300031249 Bacteria 4544
248 Ga0265339_10064640 3300031249 Bacteria 1963
249 Ga0265339_10109961 3300031249 Unclassified 1426
250 Ga0265331_10077702 3300031250 Bacteria 1546
251 Ga0265327_10001514 3300031251 Bacteria 28735
252 Ga0265327_10014271 3300031251 Bacteria 5205
253 Ga0265316_10004124 3300031344 Bacteria 14548
254 Ga0265316_10005037 3300031344 Bacteria 12965
255 Ga0265316_10006096 3300031344 Bacteria 11568
256 Ga0265316_10007560 3300031344 Bacteria 10225
257 Ga0265316_10014977 3300031344 Bacteria 6801
258 Ga0265316_10024937 3300031344 Bacteria 4999
259 Ga0265316_10040171 3300031344 Bacteria 3752
260 Ga0307408_100043152 3300031548 Bacteria 3208
261 Ga0307408_100108644 3300031548 Bacteria 2127
262 Ga0307408_100190917 3300031548 Bacteria 1650
263 Ga0265313_10001134 3300031595 Bacteria 25446
264 Ga0265313_10001377 3300031595 Bacteria 22818
265 Ga0265313_10012697 3300031595 Bacteria 5116
266 Ga0265313_10033157 3300031595 Bacteria 2628
267 Ga0307508_10003624 3300031616 Bacteria 15507
268 Ga0265314_10000148 3300031711 Bacteria 105207
269 Ga0265314_10009693 3300031711 Bacteria 8104
270 Ga0265314_10009981 3300031711 Bacteria 7965
271 Ga0265314_10012067 3300031711 Bacteria 7081
272 Ga0265314_10020102 3300031711 Bacteria 5157
273 Ga0265342_10005423 3300031712 Bacteria 9732
274 Ga0265342_10006026 3300031712 Bacteria 9104
275 Ga0265342_10009283 3300031712 Bacteria 6947
276 Ga0265342_10135788 3300031712 Unclassified 1375
277 Ga0307516_10001159 3300031730 Bacteria 36887
278 Ga0307413_10000718 3300031824 Bacteria 11373
279 Ga0307413_10080553 3300031824 Bacteria 2085
280 Ga0307406_10058820 3300031901 Bacteria 2471
281 Ga0307406_10118240 3300031901 Bacteria 1837
282 Ga0307510_10005230 3300033180 Bacteria 15426
283 Ga0307510_10021816 3300033180 Bacteria 7452
284 Ga0373930_0017996 3300034816 Bacteria 1353
285 Ga0373928_0000004 3300035084 Bacteria 45792
286 Ga0373929_0000339 3300035085 Bacteria 8701
287 Ga0373944_0000023 3300035089 Bacteria 27187
288 Ga0373949_0015098 3300035090 Bacteria 1722
289 Ga0373951_0014402 3300035091 Bacteria 1778
290 Ga0373932_0000001 3300035112 Bacteria 1459067
291 Ga0373945_0029108 3300035116 Bacteria 1939
292 Ga0373954_0025307 3300035118 Unclassified 2712
293 Ga0373962_0000262 3300035242 Bacteria 11256
294 Ga0373931_0000008 3300035691 Bacteria 362269
295 Ga0373935_0211744 3300035692 Bacteria 1343
296 Ga0373927_0024417 3300035695 Bacteria 3954
297 Ga0373947_0018885 3300035725 Bacteria 3972
298 Ga0373937_0193345 3300036401 Bacteria 1912
299 Ga0373925_0000077 3300037068 Bacteria 105383
300 Ga0373925_0004248 3300037068 Bacteria 10853
301 Ga0373925_0100077 3300037068 Bacteria 2227
302 Ga0373925_0158961 3300037068 Bacteria 1779
303 Ga0237819_00013 3300038705 Bacteria 59823
304 Ga0439439_0011861 3300041406 Bacteria 2101
305 Ga0439447_000596 3300041407 Bacteria 13491
306 Ga0439465_0029514 3300041413 Bacteria 1742
307 Ga0451791_0263420 3300041451 Bacteria 2856
308 Ga0451807_0681147 3300041486 Bacteria 3088
309 Ga0439445_0007409 3300042004 Bacteria 2545
310 Ga0439432_003311 3300042006 Bacteria 5989
311 Ga0439449_0000069 3300042007 Bacteria 32108
312 Ga0439449_0002047 3300042007 Bacteria 7940
313 Ga0450894_009519 3300042131 Bacteria 1261
314 Ga0451577_0000223 3300042876 Bacteria 116763
315 Ga0451577_0000302 3300042876 Bacteria 95860
316 Ga0451577_0007183 3300042876 Bacteria 10980
317 Ga0451577_0013657 3300042876 Bacteria 7594
318 Ga0451577_0195006 3300042876 Bacteria 1828
319 Ga0453684_0000722 3300044712 Bacteria 116763
320 Ga0453684_0001577 3300044712 Bacteria 63055
321 Ga0453684_0006245 3300044712 Bacteria 22828
322 Ga0453684_0021165 3300044712 Bacteria 9742
323 Ga0453684_0033381 3300044712 Bacteria 7178
324 Ga0451576_0008164 3300045051 Bacteria 12326
325 Ga0451576_0082107 3300045051 Bacteria 3352
326 Ga0451576_0095140 3300045051 Bacteria 3098
327 Ga0451576_0275157 3300045051 Bacteria 1760
328 Ga0451576_0434528 3300045051 Bacteria 1378
329 Ga0451576_0650092 3300045051 Bacteria 1108
330 Ga0495592_0000633 3300046454 Bacteria 24512
331 Ga0495638_0036914 3300046460 Bacteria 3110
332 Ga0495650_0000247 3300046471 Bacteria 106616
333 Ga0495582_0007386 3300046473 Bacteria 6086
334 Ga0495664_0176469 3300046477 Bacteria 1296
335 Ga0495607_0000120 3300046501 Bacteria 82667
336 Ga0495606_0043668 3300046507 Bacteria 2987
337 Ga0495608_0140454 3300046511 Bacteria 1542
338 Ga0495610_0005449 3300046512 Bacteria 9036
339 Ga0495618_0109248 3300046514 Unclassified 1771
340 Ga0495628_0040754 3300046516 Bacteria 3709
341 Ga0495630_0000135 3300046517 Bacteria 58009
342 Ga0495630_0006017 3300046517 Bacteria 8587
343 Ga0495630_0027377 3300046517 Bacteria 4229
344 Ga0495630_0041602 3300046517 Bacteria 3432
345 Ga0495630_0132250 3300046517 Unclassified 1895
346 Ga0495631_0001288 3300046518 Bacteria 15397
347 Ga0495632_0000004 3300046519 Bacteria 381372
348 Ga0495666_0005709 3300046526 Bacteria 6272
349 Ga0495666_0071565 3300046526 Bacteria 1648
350 Ga0495586_0000033 3300046535 Bacteria 89808
351 Ga0495586_0003878 3300046535 Bacteria 8010
352 Ga0495609_0007444 3300046538 Bacteria 5467
353 Ga0495645_0062242 3300046543 Bacteria 2703
354 Ga0495645_0097529 3300046543 Bacteria 2093
355 Ga0495667_0112152 3300046559 Unclassified 1762
356 Ga0495656_0009765 3300046615 Bacteria 3462
357 Ga0495668_0003460 3300046616 Bacteria 11788
358 Ga0495634_0005152 3300046642 Bacteria 10092
359 Ga0495625_0005535 3300046660 Bacteria 11474
360 Ga0495625_0027839 3300046660 Bacteria 4246
361 Ga0495657_0044518 3300046675 Bacteria 3019
362 Ga0495599_0020240 3300046678 Unclassified 4144
363 Ga0495658_0028671 3300046683 Bacteria 3007
364 Ga0495658_0049459 3300046683 Bacteria 2375
365 Ga0495613_0140075 3300046689 Bacteria 1729
366 Ga0495671_0000492 3300046692 Bacteria 30463
367 Ga0495660_0000092 3300046810 Bacteria 96197
368 Ga0495660_0000583 3300046810 Bacteria 29142
369 Ga0495581_0072607 3300047315 Unclassified 1991
370 Ga0495636_0012391 3300047318 Bacteria 3375
371 Ga0495674_0001612 3300047319 Bacteria 22109
372 Ga0495674_0025026 3300047319 Bacteria 5478
373 Ga0495674_0047086 3300047319 Bacteria 3825
374 Ga0495672_0000527 3300047320 Bacteria 43714
375 Ga0495672_0059425 3300047320 Bacteria 2212
376 Ga0495676_0011983 3300047321 Bacteria 7822
377 Ga0495673_0000004 3300047469 Bacteria 1354526
378 Ga0496116_0023354 3300048919 Bacteria 4607
379 Ga0496117_0002719 3300048920 Bacteria 21740
380 Ga0496117_0014855 3300048920 Bacteria 6681
381 Ga0496118_0000497 3300048921 Bacteria 65119
382 Ga0496118_0020892 3300048921 Bacteria 5789
383 Ga0496118_0055531 3300048921 Bacteria 2987
384 Ga0496118_0080933 3300048921 Bacteria 2283
385 Ga0496119_0001795 3300048922 Bacteria 24973
386 Ga0496119_0004827 3300048922 Bacteria 13209
387 Ga0496120_0001136 3300048923 Bacteria 34341
388 Ga0496120_0002058 3300048923 Bacteria 21712
389 Ga0496121_0002194 3300048924 Bacteria 30543
390 Ga0496121_0118618 3300048924 Bacteria 2002
391 Ga0496122_0002792 3300048925 Bacteria 24001
392 Ga0496122_0006517 3300048925 Bacteria 13369
393 Ga0496123_0000436 3300048926 Bacteria 74963
394 Ga0496123_0037964 3300048926 Bacteria 3393
395 Ga0496124_0000813 3300048927 Bacteria 50733
396 Ga0496124_0006068 3300048927 Bacteria 13293
397 Ga0496124_0022699 3300048927 Bacteria 5746
398 Ga0496124_0037232 3300048927 Bacteria 4233
399 Ga0496124_0060597 3300048927 Bacteria 3174
400 Ga0496124_0080477 3300048927 Bacteria 2681
401 Ga0496124_0120374 3300048927 Bacteria 2098
402 Ga0496125_0001835 3300048928 Bacteria 29344
403 Ga0496125_0014271 3300048928 Bacteria 7743
404 Ga0496125_0014514 3300048928 Bacteria 7668
405 Ga0496126_0002251 3300048929 Bacteria 26628
406 Ga0501042_0384042 3300049578 Unclassified 1017
407 Ga0501043_0007450 3300049579 Bacteria 8691
408 Ga0501225_0005742 3300049705 Bacteria 3633
409 Ga0501083_0044760 3300049744 Bacteria 2996
410 Ga0501035_0330402 3300049822 Bacteria 1279
411 Ga0501044_0010418 3300049823 Bacteria 10089
412 nmdc:mga00v17_137924_c1 3300050491 Bacteria 1563
413 nmdc:mga00v17_29478_c1 3300050491 Bacteria 3221
414 nmdc:mga00v17_43065_c1 3300050491 Bacteria 2718
415 nmdc:mga00v17_48108_c1 3300050491 Bacteria 2584
416 nmdc:mga00v17_87224_c1 3300050491 Bacteria 1956
417 nmdc:mga05p37_183516_c1 3300050507 Bacteria 2544
418 nmdc:mga09592_210362_c1 3300050508 Unclassified 1685
419 nmdc:mga06r32_275636_c1 3300050510 Bacteria 1669
420 nmdc:mga08y16_195924_c1 3300050511 Bacteria 2094
421 nmdc:mga08y16_24719_c1 3300050511 Bacteria 6340
422 nmdc:mga0rr50_108693_c1 3300050513 Bacteria 2191
423 nmdc:mga0a205_86291_c2 3300050515 Bacteria 1797
424 Ga0500643_001826 3300053087 Bacteria 11631
425 Ga0500651_0001118 3300053093 Bacteria 13279
426 Ga0500650_0017118 3300053098 Unclassified 3124
427 Ga0500555_000973 3300053103 Bacteria 9908
428 Ga0500568_0005219 3300053139 Bacteria 6764
429 Ga0530510_0142880 3300061734 Unclassified 1764
430 2643818825 2643221559 Bacteria 4424915
431 2643878494 2643221573 Bacteria 4784121
432 2643941078 2643221586 Bacteria 4446529
433 2643975932 2643221593 Bacteria 6296053
434 2644528982 2643221695 Bacteria 3441323
435 2644659802 2643221720 Bacteria 4694283
436 2739229458 2738543009 Bacteria 4944499
437 2894415237 2894414249 Bacteria 4405451
438 2895498953 2895498888 Bacteria 5283788
439 2895524942 2895522137 Bacteria 3284416
440 2919406070 2919404418 Bacteria 4232372
441 2919516230 2919513703 Bacteria 3844312
442 2919676925 2919675420 Bacteria 3969095
443 8003016223 8003014200 Bacteria 4059994
444 Ga0207707_10247282
445 JGI25151J46595_10000032
446 JGI25151J46595_10015363
447 rootH2_10018598
448 rootH2_10086489
449 rootH1_10016988
450 rootH1_10094619
451 Ga0055526_1001840
452 Ga0055537_1000231
453 Ga0055524_1004408
454 Ga0055536_1001751
455 Ga0055536_1002005
456 Ga0055536_1003816
457 Ga0055536_1005072
458 Ga0055536_1015435
459 Ga0055534_1000026
460 Ga0055530_10002120
461 Ga0055530_10002124
462 Ga0055530_10002491
463 Ga0055531_10004847
464 Ga0055531_10005009
465 Ga0055531_10008561
466 Ga0055531_10008966
467 Ga0055531_10010451
468 Ga0055531_10011021
469 Ga0055531_10011065
470 Ga0055531_10011668
471 Ga0055531_10012793
472 Ga0055531_10014051
473 Ga0065165_1002100
474 Ga0065704_10070476
475 Ga0065704_10070915
476 Ga0070683_100182490
477 Ga0070690_100001178
478 Ga0070670_100029829
479 Ga0070666_10000005
480 Ga0070666_10058462
481 Ga0070660_100098463
482 Ga0070689_100000377
483 Ga0070689_100315882
484 Ga0070688_100022738
485 Ga0070667_100016300
486 Ga0070714_100080588
487 Ga0070711_100001874
488 Ga0070700_100159117
489 Ga0070708_100116784
490 Ga0070662_100116784
491 Ga0070681_10081759
492 Ga0068867_100152430
493 Ga0070685_10116079
494 Ga0070707_100060749
495 Ga0070699_100119662
496 Ga0068853_100073458
497 Ga0070686_100034981
498 Ga0070686_100093006
499 Ga0070686_100100510
500 Ga0070686_100104235
501 Ga0070686_100153813
502 Ga0070665_100000211
503 Ga0070665_100053747
504 Ga0070704_100003254
505 Ga0068855_100001359
506 Ga0068855_100008226
507 Ga0068856_100000172
508 Ga0068856_100162031
509 Ga0068856_100385314
510 Ga0070702_100193186
511 Ga0068859_100020653
512 Ga0068863_100021291
513 Ga0068858_100030619
514 Ga0068858_100138298
515 Ga0068860_100134833
516 Ga0068862_100046360
517 Ga0081539_10000597
518 Ga0075364_10113853
519 Ga0097621_100019204
520 Ga0097621_100053428
521 Ga0097620_100020652
522 Ga0075435_100098279
523 Ga0099794_10125644
524 Ga0105251_10000437
525 Ga0105240_10005588
526 Ga0105240_10072011
527 Ga0105240_10113239
528 Ga0105240_10297781
529 Ga0111539_10006264
530 Ga0111539_10061432
531 Ga0111539_10157307
532 Ga0105245_10074377
533 Ga0105247_10012056
534 Ga0105247_10024169
535 Ga0105242_10021648
536 Ga0105237_10395779
537 Ga0105238_10003835
538 Ga0105238_10004550
539 Ga0105238_10013121
540 Ga0105238_10021458
541 Ga0105238_10037805
542 Ga0105238_10099046
543 Ga0105238_10148272
544 Ga0105249_10030490
545 Ga0099796_10061667
546 Ga0105246_10056026
547 Ga0157371_10000400
548 Ga0157374_10080308
549 Ga0163162_10000489
550 Ga0157372_10069210
551 Ga0157375_10000045
552 Ga0163163_10000239
553 Ga0163163_10005152
554 Ga0163163_10153163
555 Ga0157380_10011386
556 Ga0157379_10148439
557 Ga0157379_10219001
558 Ga0182006_1000085
559 Ga0182007_10000098
560 Ga0182005_1000606
561 Ga0163161_10013348
562 Ga0163161_10064333
563 Ga0207425_1004886
564 Ga0209565_1000022
565 Ga0209673_1000110
566 Ga0209675_1000060
567 Ga0209675_1008691
568 Ga0209675_1014152
569 Ga0209676_1000034
570 Ga0209676_1000219
571 Ga0209676_1001097
572 Ga0209676_1001110
573 Ga0209676_1003546
574 Ga0209676_1004172
575 Ga0209676_1004330
576 Ga0209676_1004424
577 Ga0209025_1000005
578 Ga0209025_1001408
579 Ga0209025_1017654
580 Ga0209564_1000304
581 Ga0209564_1005424
582 Ga0209050_1001060
583 Ga0209050_1001440
584 Ga0209050_1009770
585 Ga0209256_1001956
586 Ga0209256_1003717
587 Ga0209256_1020436
588 Ga0209051_1000763
589 Ga0209051_1008672
590 Ga0209257_1000255
591 Ga0209257_1000283
592 Ga0209257_1000942
593 Ga0209257_1003658
594 Ga0209257_1005663
595 Ga0209257_1005877
596 Ga0209257_1007996
597 Ga0209257_1008731
598 Ga0207713_1000792
599 Ga0207710_10035638
600 Ga0207688_10024490
601 Ga0207680_10000005
602 Ga0207680_10044565
603 Ga0207695_10132823
604 Ga0207693_10264571
605 Ga0207663_10044211
606 Ga0207657_10189081
607 Ga0207694_10002498
608 Ga0207694_10003754
609 Ga0207694_10009159
610 Ga0207694_10013114
611 Ga0207694_10053164
612 Ga0207694_10065492
613 Ga0207650_10019045
614 Ga0207664_10111633
615 Ga0207686_10075233
616 Ga0207670_10000636
617 Ga0207670_10118649
618 Ga0207670_10139882
619 Ga0207667_10000933
620 Ga0207667_10015959
621 Ga0207712_10057386
622 Ga0207658_10009494
623 Ga0207677_10069929
624 Ga0207703_10033368
625 Ga0207708_10158535
626 Ga0207702_10004142
627 Ga0207674_10101338
628 Ga0268266_10000001
629 Ga0268266_10000004
630 Ga0268265_10128623
631 Ga0268264_10270549
632 Ga0265337_1001358
633 Ga0265337_1001384
634 Ga0265337_1004040
635 Ga0265337_1004847
636 Ga0265326_10005487
637 Ga0265326_10032884
638 Ga0265326_10033192
639 Ga0265319_1000051
640 Ga0265319_1028402
641 Ga0265334_10013758
642 Ga0265318_10051444
643 Ga0265323_10000237
644 Ga0265323_10001702
645 Ga0265322_10000313
646 Ga0265336_10000985
647 Ga0265336_10017303
648 Ga0265336_10023262
649 Ga0265338_10000029
650 Ga0265338_10000096
651 Ga0265338_10000197
652 Ga0265338_10000433
653 Ga0265338_10001868
654 Ga0265338_10002793
655 Ga0265338_10004653
656 Ga0265338_10006124
657 Ga0265338_10006293
658 Ga0265338_10006514
659 Ga0265338_10011251
660 Ga0265338_10017391
661 Ga0265338_10029314
662 Ga0265338_10029847
663 Ga0265338_10039145
664 Ga0265338_10040249
665 Ga0265338_10046024
666 Ga0265338_10061676
667 Ga0265338_10091833
668 Ga0265338_10103495
669 Ga0265338_10221026
670 Ga0265324_10000998
671 Ga0265324_10002564
672 Ga0265324_10004454
673 Ga0265324_10011492
674 Ga0265324_10016664
675 Ga0265324_10044384
676 Ga0316183_1029479
677 Ga0265332_10017223
678 Ga0265320_10000583
679 Ga0265320_10006602
680 Ga0265320_10010692
681 Ga0265320_10023263
682 Ga0265325_10019045
683 Ga0265325_10020358
684 Ga0265329_10001249
685 Ga0265329_10010089
686 Ga0265329_10012103
687 Ga0265340_10002492
688 Ga0265340_10015286
689 Ga0265339_10005661
690 Ga0265339_10015638
691 Ga0265339_10064640
692 Ga0265339_10109961
693 Ga0265331_10077702
694 Ga0265327_10001514
695 Ga0265327_10014271
696 Ga0265316_10004124
697 Ga0265316_10005037
698 Ga0265316_10006096
699 Ga0265316_10007560
700 Ga0265316_10014977
701 Ga0265316_10024937
702 Ga0265316_10040171
703 Ga0307408_100043152
704 Ga0307408_100108644
705 Ga0307408_100190917
706 Ga0265313_10001134
707 Ga0265313_10001377
708 Ga0265313_10012697
709 Ga0265313_10033157
710 Ga0307508_10003624
711 Ga0265314_10000148
712 Ga0265314_10009693
713 Ga0265314_10009981
714 Ga0265314_10012067
715 Ga0265314_10020102
716 Ga0265342_10005423
717 Ga0265342_10006026
718 Ga0265342_10009283
719 Ga0265342_10135788
720 Ga0307516_10001159
721 Ga0307413_10000718
722 Ga0307413_10080553
723 Ga0307406_10058820
724 Ga0307406_10118240
725 Ga0307510_10005230
726 Ga0307510_10021816
727 Ga0373930_0017996
728 Ga0373928_0000004
729 Ga0373929_0000339
730 Ga0373944_0000023
731 Ga0373949_0015098
732 Ga0373951_0014402
733 Ga0373932_0000001
734 Ga0373945_0029108
735 Ga0373954_0025307
736 Ga0373962_0000262
737 Ga0373931_0000008
738 Ga0373935_0211744
739 Ga0373927_0024417
740 Ga0373947_0018885
741 Ga0373937_0193345
742 Ga0373925_0000077
743 Ga0373925_0004248
744 Ga0373925_0100077
745 Ga0373925_0158961
746 Ga0237819_00013
747 Ga0439439_0011861
748 Ga0439447_000596
749 Ga0439465_0029514
750 Ga0451791_0263420
751 Ga0451807_0681147
752 Ga0439445_0007409
753 Ga0439432_003311
754 Ga0439449_0000069
755 Ga0439449_0002047
756 Ga0450894_009519
757 Ga0451577_0000223
758 Ga0451577_0000302
759 Ga0451577_0007183
760 Ga0451577_0013657
761 Ga0451577_0195006
762 Ga0453684_0000722
763 Ga0453684_0001577
764 Ga0453684_0006245
765 Ga0453684_0021165
766 Ga0453684_0033381
767 Ga0451576_0008164
768 Ga0451576_0082107
769 Ga0451576_0095140
770 Ga0451576_0275157
771 Ga0451576_0434528
772 Ga0451576_0650092
773 Ga0495592_0000633
774 Ga0495638_0036914
775 Ga0495650_0000247
776 Ga0495582_0007386
777 Ga0495664_0176469
778 Ga0495607_0000120
779 Ga0495606_0043668
780 Ga0495608_0140454
781 Ga0495610_0005449
782 Ga0495618_0109248
783 Ga0495628_0040754
784 Ga0495630_0000135
785 Ga0495630_0006017
786 Ga0495630_0027377
787 Ga0495630_0041602
788 Ga0495630_0132250
789 Ga0495631_0001288
790 Ga0495632_0000004
791 Ga0495666_0005709
792 Ga0495666_0071565
793 Ga0495586_0000033
794 Ga0495586_0003878
795 Ga0495609_0007444
796 Ga0495645_0062242
797 Ga0495645_0097529
798 Ga0495667_0112152
799 Ga0495656_0009765
800 Ga0495668_0003460
801 Ga0495634_0005152
802 Ga0495625_0005535
803 Ga0495625_0027839
804 Ga0495657_0044518
805 Ga0495599_0020240
806 Ga0495658_0028671
807 Ga0495658_0049459
808 Ga0495613_0140075
809 Ga0495671_0000492
810 Ga0495660_0000092
811 Ga0495660_0000583
812 Ga0495581_0072607
813 Ga0495636_0012391
814 Ga0495674_0001612
815 Ga0495674_0025026
816 Ga0495674_0047086
817 Ga0495672_0000527
818 Ga0495672_0059425
819 Ga0495676_0011983
820 Ga0495673_0000004
821 Ga0496116_0023354
822 Ga0496117_0002719
823 Ga0496117_0014855
824 Ga0496118_0000497
825 Ga0496118_0020892
826 Ga0496118_0055531
827 Ga0496118_0080933
828 Ga0496119_0001795
829 Ga0496119_0004827
830 Ga0496120_0001136
831 Ga0496120_0002058
832 Ga0496121_0002194
833 Ga0496121_0118618
834 Ga0496122_0002792
835 Ga0496122_0006517
836 Ga0496123_0000436
837 Ga0496123_0037964
838 Ga0496124_0000813
839 Ga0496124_0006068
840 Ga0496124_0022699
841 Ga0496124_0037232
842 Ga0496124_0060597
843 Ga0496124_0080477
844 Ga0496124_0120374
845 Ga0496125_0001835
846 Ga0496125_0014271
847 Ga0496125_0014514
848 Ga0496126_0002251
849 Ga0501042_0384042
850 Ga0501043_0007450
851 Ga0501225_0005742
852 Ga0501083_0044760
853 Ga0501035_0330402
854 Ga0501044_0010418
855 nmdc:mga00v17_137924_c1
856 nmdc:mga00v17_29478_c1
857 nmdc:mga00v17_43065_c1
858 nmdc:mga00v17_48108_c1
859 nmdc:mga00v17_87224_c1
860 nmdc:mga05p37_183516_c1
861 nmdc:mga09592_210362_c1
862 nmdc:mga06r32_275636_c1
863 nmdc:mga08y16_195924_c1
864 nmdc:mga08y16_24719_c1
865 nmdc:mga0rr50_108693_c1
866 nmdc:mga0a205_86291_c2
867 Ga0500643_001826
868 Ga0500651_0001118
869 Ga0500650_0017118
870 Ga0500555_000973
871 Ga0500568_0005219
872 Ga0530510_0142880
873 2643818825
874 2643878494
875 2643941078
876 2643975932
877 2644528982
878 2644659802
879 2739229458
880 2894415237
881 2895498953
882 2895524942
883 2919406070
884 2919516230
885 2919676925
886 8003016223

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00696

AA_kinase

Amino acid kinase family

76

304

0.94

PF01472

PUA

PUA domain

346

418

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ako-assembly2.cif.gz_D crystal structure of glutamate 5-kinase from campylobacter jejuni 0.9172 23 271
2ako-assembly2.cif.gz_D crystal structure of glutamate 5-kinase from campylobacter jejuni 0.9062 23 271
2w21-assembly1.cif.gz_A-2 crystal structure of the aminoacid kinase domain of the glutamate 5 kinase of escherichia coli. 0.9003 20 274
2w21-assembly1.cif.gz_A-2 crystal structure of the aminoacid kinase domain of the glutamate 5 kinase of escherichia coli. 0.8968 20 274
7v9a-assembly1.cif.gz_C biogenesis module of human telomerase holoenzyme 0.8791 291 354
ID Description Score Start End Superfamily
2j5tB02 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain 0.9768 291 385 2.30.130.10
2j5tB02 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain 0.9566 291 385 2.30.130.10
af_O13810_285_387_2.30.130.10 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain 0.9497 284 385 2.30.130.10
af_Q54LB6_223_322_2.30.130.10 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain 0.9376 285 385 2.30.130.10
af_P38690_314_419_2.30.130.10 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain 0.9335 290 383 2.30.130.10
ID Description Score Start End GO Terms
AF-A0A2J1D516-F1-model_v4 deleted 0.9812 288 385
AF-A0A2M6ZVJ6-F1-model_v4 Glutamate 5-kinase 0.9751 274 385 GO:0003723
GO:0004349
GO:0005524
GO:0005829
GO:0006561
AF-X2JRI1-F1-model_v4 deleted 0.9705 277 385
AF-A0A376VPC5-F1-model_v4 Glutamate 5-kinase (EC 2.7.2.11) 0.9694 283 388 GO:0003723
GO:0004349
GO:0005524
GO:0005829
GO:0006561
AF-A0A534U6K2-F1-model_v4 Glutamate 5-kinase (EC 2.7.2.11) 0.9642 282 388 GO:0003723
GO:0004349
GO:0005524
GO:0005829
GO:0006561

Map