F445289

General Info

Members Datasets Scaffolds Average Seq Length
444 200 888 292

Family's Representative Sequence

Representative Sequence 3300025920|Ga0207649_10154049|Ga0207649_101540493
Length 330
Sequence MFSIIGILVVFGAVVAGYLMEHGNLKVLIQPAELVIIGGAAIGTVLVANPLHILKKIAGGCASVFGGSKFTQKRYVETLKMMYLLLNQARKDGLVALEAHIEDPAKSSILSKYPAFTKDHHVRDFVCDTLRMAVSGGVEPFDLDQMMELDMEVHHHDATQPVQALSTMADSLPGLGIVAAVLGVVITMGALGGPPEEIGHKVAAALVGTFLGILLCYGLVGPLAGNMAKLAEDEHAFYHVLRVLMASFMKGAPPIMAVEMARRAIPGHVRPSFKEVEKNCRTGDAAPAAAAAIQGSREGPLGRFDRPAATMQPSPETRVAQPTLLPRDWL

Samples

Sample ID Description Type Environment
1 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
121 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
122 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
123 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
124 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
129 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
130 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
131 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
132 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
134 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
135 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
143 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.63
Rhizosphere 92.57
Stem 0
Stem Tuber 0
Unclassified 5.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207649_10154049 3300025920 Bacteria 1586
2 rootH2_10132221 3300003320 Bacteria 4254
3 rootH2_10159057 3300003320 Bacteria 2274
4 Ga0065712_10113251 3300005290 Bacteria 1786
5 Ga0065715_10025694 3300005293 Bacteria 2206
6 Ga0070683_100028961 3300005329 Bacteria 5009
7 Ga0070683_100068458 3300005329 Bacteria 3308
8 Ga0070683_100140348 3300005329 Bacteria 2289
9 Ga0070670_100019285 3300005331 Bacteria 5851
10 Ga0068869_100002381 3300005334 Bacteria 11322
11 Ga0068869_100018010 3300005334 Bacteria 4800
12 Ga0070680_100090779 3300005336 Unclassified 2529
13 Ga0070680_100285511 3300005336 Bacteria 1399
14 Ga0070682_100303792 3300005337 Bacteria 1172
15 Ga0070682_100309772 3300005337 Bacteria 1162
16 Ga0068868_100002059 3300005338 Bacteria 13819
17 Ga0068868_100117307 3300005338 Bacteria 2168
18 Ga0068868_100169332 3300005338 Bacteria 1808
19 Ga0070660_100066441 3300005339 Bacteria 2807
20 Ga0070687_100095867 3300005343 Bacteria 1650
21 Ga0070661_100001260 3300005344 Bacteria 17789
22 Ga0070661_100061465 3300005344 Bacteria 2757
23 Ga0070661_100068559 3300005344 Bacteria 2607
24 Ga0070661_100071567 3300005344 Bacteria 2552
25 Ga0070661_100105992 3300005344 Bacteria 2096
26 Ga0070671_100001739 3300005355 Bacteria 16532
27 Ga0070688_100385398 3300005365 Bacteria 1034
28 Ga0070667_100004796 3300005367 Bacteria 11329
29 Ga0070709_10076028 3300005434 Bacteria 2180
30 Ga0070714_100001316 3300005435 Bacteria 17938
31 Ga0070710_10077946 3300005437 Bacteria 1927
32 Ga0070711_100000204 3300005439 Bacteria 31420
33 Ga0070711_100034182 3300005439 Unclassified 3390
34 Ga0070663_100039412 3300005455 Bacteria 3300
35 Ga0068867_100034883 3300005459 Bacteria 3648
36 Ga0070706_100289324 3300005467 Bacteria 1529
37 Ga0070679_100036457 3300005530 Bacteria 4880
38 Ga0070679_100076896 3300005530 Bacteria 3326
39 Ga0070684_100003799 3300005535 Bacteria 11409
40 Ga0070684_100004476 3300005535 Bacteria 10640
41 Ga0070684_100041002 3300005535 Bacteria 3989
42 Ga0070684_100116983 3300005535 Unclassified 2395
43 Ga0070684_100139081 3300005535 Bacteria 2195
44 Ga0070697_100000221 3300005536 Bacteria 46854
45 Ga0068853_100000025 3300005539 Bacteria 136123
46 Ga0070693_100058124 3300005547 Bacteria 2238
47 Ga0070665_100013968 3300005548 Bacteria 8076
48 Ga0070665_100155092 3300005548 Bacteria 2292
49 Ga0070665_100204332 3300005548 Bacteria 1976
50 Ga0068855_100047215 3300005563 Bacteria 5087
51 Ga0068855_100063716 3300005563 Bacteria 4301
52 Ga0068855_100081329 3300005563 Bacteria 3755
53 Ga0068855_100120539 3300005563 Bacteria 3002
54 Ga0068855_100143072 3300005563 Unclassified 2724
55 Ga0068855_100398294 3300005563 Unclassified 1509
56 Ga0068857_100002925 3300005577 Bacteria 14083
57 Ga0068857_100008354 3300005577 Bacteria 8943
58 Ga0068854_100008205 3300005578 Bacteria 6700
59 Ga0068854_100248495 3300005578 Bacteria 1419
60 Ga0068856_100002495 3300005614 Bacteria 18937
61 Ga0068856_100005984 3300005614 Bacteria 11973
62 Ga0068856_100006141 3300005614 Bacteria 11792
63 Ga0068856_100058276 3300005614 Bacteria 3814
64 Ga0068856_100462736 3300005614 Bacteria 1289
65 Ga0068852_100000014 3300005616 Bacteria 139457
66 Ga0068852_100004033 3300005616 Bacteria 10322
67 Ga0068852_100071955 3300005616 Bacteria 3038
68 Ga0068852_100110891 3300005616 Bacteria 2494
69 Ga0068852_100138478 3300005616 Unclassified 2250
70 Ga0068859_100007798 3300005617 Bacteria 10865
71 Ga0068859_100020304 3300005617 Bacteria 6669
72 Ga0068864_100008454 3300005618 Bacteria 8494
73 Ga0068866_10070262 3300005718 Bacteria 1848
74 Ga0068851_10020654 3300005834 Bacteria 3191
75 Ga0068851_10022212 3300005834 Bacteria 3087
76 Ga0068851_10095334 3300005834 Bacteria 1572
77 Ga0068863_100002984 3300005841 Bacteria 16734
78 Ga0068863_100057252 3300005841 Unclassified 3689
79 Ga0068863_100125201 3300005841 Bacteria 2452
80 Ga0068863_100132586 3300005841 Bacteria 2379
81 Ga0068863_100146055 3300005841 Bacteria 2262
82 Ga0068858_100014872 3300005842 Bacteria 7320
83 Ga0068858_100018035 3300005842 Bacteria 6610
84 Ga0068860_100002519 3300005843 Bacteria 19210
85 Ga0068860_100018797 3300005843 Bacteria 6713
86 Ga0068860_100030370 3300005843 Bacteria 5197
87 Ga0068862_100035112 3300005844 Bacteria 4244
88 Ga0070715_10012052 3300006163 Bacteria 3132
89 Ga0070716_100103846 3300006173 Bacteria 1748
90 Ga0070712_100001469 3300006175 Bacteria 14378
91 Ga0097621_100002167 3300006237 Bacteria 13438
92 Ga0097621_100003353 3300006237 Bacteria 11019
93 Ga0097621_100060078 3300006237 Bacteria 3114
94 Ga0068871_100003167 3300006358 Bacteria 11305
95 Ga0068871_100010898 3300006358 Bacteria 6655
96 Ga0068871_100015162 3300006358 Bacteria 5761
97 Ga0068871_100238372 3300006358 Bacteria 1581
98 Ga0075431_100046278 3300006847 Bacteria 4486
99 Ga0068865_100006543 3300006881 Bacteria 7119
100 Ga0075436_100042142 3300006914 Bacteria 3148
101 Ga0097620_100007798 3300006931 Bacteria 10865
102 Ga0097620_100020304 3300006931 Bacteria 6669
103 Ga0105240_10000177 3300009093 Bacteria 129109
104 Ga0105240_10000409 3300009093 Bacteria 79827
105 Ga0105240_10006056 3300009093 Bacteria 17867
106 Ga0105240_10011628 3300009093 Bacteria 12242
107 Ga0105240_10048745 3300009093 Bacteria 5351
108 Ga0105240_10068985 3300009093 Bacteria 4377
109 Ga0105240_10080693 3300009093 Bacteria 4000
110 Ga0105240_10516277 3300009093 Bacteria 1326
111 Ga0105240_10874783 3300009093 Unclassified 968
112 Ga0105245_10003437 3300009098 Bacteria 14194
113 Ga0105245_10007348 3300009098 Bacteria 9645
114 Ga0105245_10024156 3300009098 Bacteria 5336
115 Ga0105245_10135732 3300009098 Bacteria 2312
116 Ga0105245_10237237 3300009098 Bacteria 1766
117 Ga0105247_10002321 3300009101 Bacteria 12994
118 Ga0105247_10112263 3300009101 Bacteria 1756
119 Ga0114129_10812735 3300009147 Bacteria 1192
120 Ga0105241_10000044 3300009174 Bacteria 103625
121 Ga0105241_10001120 3300009174 Bacteria 20418
122 Ga0105241_10002011 3300009174 Bacteria 15387
123 Ga0105241_10006757 3300009174 Bacteria 8438
124 Ga0105241_10018527 3300009174 Bacteria 5121
125 Ga0105241_10054798 3300009174 Bacteria 3053
126 Ga0105241_10072392 3300009174 Bacteria 2679
127 Ga0105241_10235480 3300009174 Bacteria 1545
128 Ga0105248_10001093 3300009177 Bacteria 30034
129 Ga0105248_10016467 3300009177 Bacteria 8137
130 Ga0105248_10117613 3300009177 Unclassified 2998
131 Ga0105248_10228427 3300009177 Bacteria 2095
132 Ga0105248_10824458 3300009177 Bacteria 1047
133 Ga0105237_10000382 3300009545 Bacteria 63115
134 Ga0105237_10007371 3300009545 Bacteria 12050
135 Ga0105238_10000056 3300009551 Bacteria 139227
136 Ga0105238_10001716 3300009551 Bacteria 22085
137 Ga0105238_10002986 3300009551 Bacteria 16893
138 Ga0105238_10008127 3300009551 Bacteria 10492
139 Ga0105238_10017192 3300009551 Bacteria 7346
140 Ga0105238_10017799 3300009551 Bacteria 7224
141 Ga0105238_10035242 3300009551 Bacteria 5089
142 Ga0105238_10074334 3300009551 Bacteria 3391
143 Ga0105249_10028725 3300009553 Bacteria 5020
144 Ga0105249_10405324 3300009553 Bacteria 1395
145 Ga0105239_10000398 3300010375 Bacteria 63879
146 Ga0105239_10002177 3300010375 Bacteria 25173
147 Ga0105239_10012035 3300010375 Bacteria 9646
148 Ga0105239_10024525 3300010375 Bacteria 6645
149 Ga0105239_10028191 3300010375 Bacteria 6177
150 Ga0105239_10046853 3300010375 Bacteria 4737
151 Ga0105246_10001307 3300011119 Bacteria 14641
152 Ga0157373_10038905 3300013100 Bacteria 3407
153 Ga0157370_10001078 3300013104 Bacteria 34148
154 Ga0157370_10106856 3300013104 Bacteria 2619
155 Ga0157369_10000255 3300013105 Bacteria 73072
156 Ga0157369_10000527 3300013105 Bacteria 50543
157 Ga0157369_10003185 3300013105 Bacteria 19576
158 Ga0157369_10008279 3300013105 Bacteria 11918
159 Ga0157369_10015084 3300013105 Bacteria 8721
160 Ga0157369_10026239 3300013105 Bacteria 6465
161 Ga0157369_10044610 3300013105 Bacteria 4824
162 Ga0157369_10087685 3300013105 Bacteria 3323
163 Ga0157369_10177329 3300013105 Bacteria 2243
164 Ga0157369_10222992 3300013105 Unclassified 1973
165 Ga0157374_10000706 3300013296 Bacteria 29314
166 Ga0157374_10004082 3300013296 Bacteria 12258
167 Ga0157374_10006452 3300013296 Bacteria 9959
168 Ga0157374_10007806 3300013296 Bacteria 9134
169 Ga0157374_10012688 3300013296 Bacteria 7338
170 Ga0157374_10204445 3300013296 Unclassified 1935
171 Ga0157378_10002824 3300013297 Bacteria 15489
172 Ga0157378_10008674 3300013297 Bacteria 8846
173 Ga0157378_10013509 3300013297 Bacteria 7142
174 Ga0157378_10023259 3300013297 Bacteria 5453
175 Ga0157378_10081817 3300013297 Bacteria 2919
176 Ga0157378_10104311 3300013297 Bacteria 2591
177 Ga0157378_10161471 3300013297 Bacteria 2096
178 Ga0163162_10001457 3300013306 Bacteria 21994
179 Ga0163162_10003215 3300013306 Bacteria 15622
180 Ga0163162_10010666 3300013306 Bacteria 8935
181 Ga0163162_10023422 3300013306 Bacteria 6094
182 Ga0163162_10096989 3300013306 Bacteria 3036
183 Ga0157372_10002675 3300013307 Bacteria 19284
184 Ga0157372_10004836 3300013307 Bacteria 14322
185 Ga0157372_10008605 3300013307 Bacteria 10844
186 Ga0157372_10022002 3300013307 Bacteria 6893
187 Ga0157372_10052879 3300013307 Bacteria 4525
188 Ga0157372_10196640 3300013307 Bacteria 2335
189 Ga0157375_10003708 3300013308 Bacteria 13266
190 Ga0157375_10010033 3300013308 Bacteria 8326
191 Ga0163163_10022818 3300014325 Bacteria 5932
192 Ga0157379_10002174 3300014968 Bacteria 16306
193 Ga0157379_10067445 3300014968 Bacteria 3198
194 Ga0157379_10073705 3300014968 Bacteria 3056
195 Ga0157379_10155958 3300014968 Bacteria 2060
196 Ga0157376_10002000 3300014969 Bacteria 13658
197 Ga0157376_10014452 3300014969 Bacteria 5928
198 Ga0157376_10041270 3300014969 Bacteria 3777
199 Ga0157376_10094562 3300014969 Bacteria 2597
200 Ga0213876_10047511 3300021384 Bacteria 2269
201 Ga0207656_10024792 3300025321 Bacteria 2429
202 Ga0207656_10037321 3300025321 Unclassified 2044
203 Ga0207656_10070273 3300025321 Bacteria 1554
204 Ga0207642_10085015 3300025899 Bacteria 1547
205 Ga0207710_10001375 3300025900 Bacteria 12192
206 Ga0207647_10002133 3300025904 Bacteria 15123
207 Ga0207684_10250355 3300025910 Bacteria 1529
208 Ga0207654_10000033 3300025911 Bacteria 115194
209 Ga0207654_10000714 3300025911 Bacteria 18556
210 Ga0207654_10001524 3300025911 Bacteria 12194
211 Ga0207654_10014795 3300025911 Bacteria 4038
212 Ga0207654_10068509 3300025911 Bacteria 2099
213 Ga0207654_10107448 3300025911 Bacteria 1730
214 Ga0207707_10239757 3300025912 Unclassified 1577
215 Ga0207695_10000086 3300025913 Bacteria 278055
216 Ga0207695_10000531 3300025913 Bacteria 79831
217 Ga0207695_10000605 3300025913 Bacteria 71982
218 Ga0207695_10004652 3300025913 Bacteria 18595
219 Ga0207695_10022894 3300025913 Bacteria 7077
220 Ga0207695_10042832 3300025913 Bacteria 4829
221 Ga0207695_10107621 3300025913 Bacteria 2773
222 Ga0207695_10264220 3300025913 Bacteria 1618
223 Ga0207695_10502440 3300025913 Bacteria 1095
224 Ga0207671_10000085 3300025914 Bacteria 142417
225 Ga0207671_10001234 3300025914 Bacteria 30219
226 Ga0207671_10441691 3300025914 Bacteria 1036
227 Ga0207693_10000039 3300025915 Bacteria 108357
228 Ga0207663_10000522 3300025916 Bacteria 16880
229 Ga0207663_10123409 3300025916 Bacteria 1777
230 Ga0207657_10000647 3300025919 Bacteria 37065
231 Ga0207649_10007479 3300025920 Bacteria 5939
232 Ga0207649_10053692 3300025920 Bacteria 2505
233 Ga0207649_10273629 3300025920 Bacteria 1225
234 Ga0207649_10375996 3300025920 Bacteria 1058
235 Ga0207652_10138175 3300025921 Unclassified 2177
236 Ga0207652_10278381 3300025921 Bacteria 1509
237 Ga0207694_10000058 3300025924 Bacteria 144429
238 Ga0207694_10000802 3300025924 Bacteria 28221
239 Ga0207694_10026823 3300025924 Bacteria 4386
240 Ga0207694_10041396 3300025924 Bacteria 3550
241 Ga0207694_10068406 3300025924 Unclassified 2773
242 Ga0207694_10106266 3300025924 Bacteria 2229
243 Ga0207694_10148653 3300025924 Bacteria 1887
244 Ga0207694_10158495 3300025924 Bacteria 1827
245 Ga0207650_10011581 3300025925 Bacteria 6073
246 Ga0207687_10001528 3300025927 Bacteria 15872
247 Ga0207687_10071537 3300025927 Bacteria 2478
248 Ga0207687_10080434 3300025927 Bacteria 2352
249 Ga0207700_10004093 3300025928 Bacteria 8554
250 Ga0207664_10036983 3300025929 Bacteria 3775
251 Ga0207644_10039786 3300025931 Bacteria 3320
252 Ga0207706_10030768 3300025933 Bacteria 4787
253 Ga0207704_10015345 3300025938 Bacteria 3902
254 Ga0207665_10133165 3300025939 Bacteria 1766
255 Ga0207711_10001489 3300025941 Bacteria 21812
256 Ga0207711_10047012 3300025941 Bacteria 3689
257 Ga0207711_10049137 3300025941 Bacteria 3611
258 Ga0207711_10056412 3300025941 Bacteria 3376
259 Ga0207711_10138673 3300025941 Bacteria 2186
260 Ga0207689_10001596 3300025942 Bacteria 21455
261 Ga0207689_10005016 3300025942 Bacteria 11924
262 Ga0207661_10005087 3300025944 Bacteria 9226
263 Ga0207661_10034149 3300025944 Bacteria 3953
264 Ga0207661_10079585 3300025944 Unclassified 2701
265 Ga0207679_10108974 3300025945 Bacteria 2182
266 Ga0207679_10205714 3300025945 Bacteria 1647
267 Ga0207667_10021194 3300025949 Bacteria 7206
268 Ga0207667_10054314 3300025949 Bacteria 4214
269 Ga0207712_10056295 3300025961 Bacteria 2770
270 Ga0207712_10270772 3300025961 Bacteria 1381
271 Ga0207640_10042853 3300025981 Bacteria 2888
272 Ga0207658_10001635 3300025986 Bacteria 17195
273 Ga0207677_10001336 3300026023 Bacteria 13232
274 Ga0207677_10057255 3300026023 Bacteria 2675
275 Ga0207703_10011358 3300026035 Bacteria 6929
276 Ga0207703_10045033 3300026035 Bacteria 3548
277 Ga0207703_10503164 3300026035 Bacteria 1137
278 Ga0207639_10000030 3300026041 Bacteria 172820
279 Ga0207639_10021339 3300026041 Bacteria 4651
280 Ga0207639_10109332 3300026041 Unclassified 2249
281 Ga0207678_10195676 3300026067 Bacteria 1728
282 Ga0207678_10226025 3300026067 Bacteria 1602
283 Ga0207702_10002773 3300026078 Bacteria 16407
284 Ga0207702_10039435 3300026078 Bacteria 3957
285 Ga0207702_10041231 3300026078 Bacteria 3871
286 Ga0207702_10078192 3300026078 Bacteria 2863
287 Ga0207641_10003676 3300026088 Bacteria 13507
288 Ga0207641_10010074 3300026088 Bacteria 7771
289 Ga0207641_10022604 3300026088 Bacteria 5177
290 Ga0207641_10075222 3300026088 Bacteria 2916
291 Ga0207641_10198426 3300026088 Bacteria 1849
292 Ga0207648_10024239 3300026089 Bacteria 5419
293 Ga0207676_10003259 3300026095 Bacteria 11551
294 Ga0207676_10160915 3300026095 Bacteria 1945
295 Ga0207674_10002695 3300026116 Bacteria 22168
296 Ga0207674_10008552 3300026116 Bacteria 11806
297 Ga0207674_10046512 3300026116 Bacteria 4455
298 Ga0207698_10000030 3300026142 Bacteria 114965
299 Ga0207698_10046264 3300026142 Bacteria 3284
300 Ga0207698_10137824 3300026142 Bacteria 2096
301 Ga0207698_10160813 3300026142 Bacteria 1963
302 Ga0268266_10025193 3300028379 Bacteria 5063
303 Ga0268266_10232119 3300028379 Bacteria 1700
304 Ga0268264_10001399 3300028381 Bacteria 22544
305 Ga0268264_10289651 3300028381 Bacteria 1537
306 Ga0265336_10005101 3300028666 Bacteria 4886
307 Ga0265338_10016531 3300028800 Bacteria 8017
308 Ga0265338_10030966 3300028800 Bacteria 5255
309 Ga0265338_10039582 3300028800 Bacteria 4444
310 Ga0265338_10129268 3300028800 Bacteria 1998
311 Ga0265338_10141430 3300028800 Bacteria 1884
312 Ga0265770_1019126 3300030878 Bacteria 1072
313 Ga0265330_10000420 3300031235 Bacteria 28845
314 Ga0265330_10050761 3300031235 Bacteria 1819
315 Ga0265332_10016751 3300031238 Unclassified 3234
316 Ga0265328_10003389 3300031239 Bacteria 7045
317 Ga0265320_10003269 3300031240 Bacteria 10948
318 Ga0265325_10000297 3300031241 Bacteria 34848
319 Ga0265325_10024850 3300031241 Bacteria 3255
320 Ga0265340_10001619 3300031247 Bacteria 12935
321 Ga0265340_10096848 3300031247 Bacteria 1374
322 Ga0265339_10000046 3300031249 Bacteria 114399
323 Ga0265339_10000351 3300031249 Bacteria 36605
324 Ga0265339_10004150 3300031249 Bacteria 9968
325 Ga0265339_10027504 3300031249 Bacteria 3246
326 Ga0265339_10060651 3300031249 Unclassified 2038
327 Ga0265339_10068051 3300031249 Bacteria 1904
328 Ga0265316_10003087 3300031344 Bacteria 16969
329 Ga0265316_10013504 3300031344 Bacteria 7248
330 Ga0265316_10017190 3300031344 Bacteria 6257
331 Ga0265316_10046407 3300031344 Bacteria 3443
332 Ga0265316_10143338 3300031344 Unclassified 1793
333 Ga0265313_10010548 3300031595 Bacteria 5827
334 Ga0265313_10051250 3300031595 Bacteria 1976
335 Ga0265314_10000867 3300031711 Bacteria 35938
336 Ga0265314_10018434 3300031711 Bacteria 5441
337 Ga0265314_10047157 3300031711 Bacteria 3034
338 Ga0265314_10077056 3300031711 Bacteria 2213
339 Ga0265314_10078086 3300031711 Bacteria 2193
340 Ga0265342_10001502 3300031712 Bacteria 21616
341 Ga0265342_10004648 3300031712 Bacteria 10690
342 Ga0265342_10008019 3300031712 Bacteria 7644
343 Ga0265342_10013649 3300031712 Bacteria 5436
344 Ga0265342_10038011 3300031712 Bacteria 2933
345 Ga0265342_10040445 3300031712 Bacteria 2827
346 Ga0265342_10053630 3300031712 Bacteria 2399
347 Ga0373934_0012170 3300035086 Bacteria 3247
348 Ga0373923_0013705 3300035111 Unclassified 3026
349 Ga0373953_0008358 3300035117 Bacteria 3513
350 Ga0373954_0001856 3300035118 Bacteria 8729
351 Ga0373935_0073956 3300035692 Unclassified 2202
352 Ga0373927_0172084 3300035695 Bacteria 1420
353 Ga0373933_0045527 3300035724 Bacteria 2602
354 Ga0373933_0047678 3300035724 Bacteria 2549
355 Ga0373933_0074182 3300035724 Bacteria 2074
356 Ga0373937_0014919 3300036401 Bacteria 6864
357 Ga0373937_0020939 3300036401 Bacteria 5865
358 Ga0373937_0031024 3300036401 Bacteria 4840
359 Ga0373937_0050212 3300036401 Bacteria 3820
360 Ga0373937_0549456 3300036401 Unclassified 1097
361 Ga0373925_0267371 3300037068 Bacteria 1375
362 Ga0373925_0441142 3300037068 Bacteria 1065
363 Ga0436364_0186679 3300037853 Bacteria 4468
364 Ga0436364_0279497 3300037853 Bacteria 1514
365 Ga0436364_1069461 3300037853 Bacteria 5007
366 Ga0436365_0834651 3300039437 Bacteria 2773
367 Ga0436363_0461602 3300039450 Bacteria 1715
368 Ga0453683_0287048 3300044673 Bacteria 1051
369 Ga0466963_0185632 3300044694 Bacteria 1452
370 Ga0466967_0002337 3300045976 Bacteria 11728
371 Ga0466967_0071180 3300045976 Bacteria 3113
372 Ga0495629_0081220 3300046459 Bacteria 2263
373 Ga0495580_0022088 3300046472 Bacteria 4689
374 Ga0495580_0055801 3300046472 Bacteria 2782
375 Ga0495664_0047839 3300046477 Bacteria 2539
376 Ga0495645_0004760 3300046543 Bacteria 9277
377 Ga0495634_0263759 3300046642 Bacteria 1050
378 Ga0495635_0221937 3300046663 Bacteria 1278
379 Ga0495646_0026071 3300046680 Bacteria 3672
380 Ga0495613_0074083 3300046689 Bacteria 2480
381 Ga0495680_0063579 3300047322 Bacteria 2834
382 Ga0495675_0150641 3300047444 Bacteria 1437
383 Ga0495684_0272456 3300047471 Bacteria 1224
384 Ga0495593_0049403 3300047673 Bacteria 2232
385 Ga0496100_0259604 3300048903 Bacteria 1288
386 Ga0496101_0003390 3300048904 Bacteria 9941
387 Ga0496101_0265015 3300048904 Bacteria 1341
388 Ga0496102_0000903 3300048905 Bacteria 28173
389 Ga0496102_0141471 3300048905 Bacteria 2256
390 Ga0496102_0596818 3300048905 Bacteria 1027
391 Ga0496104_0028092 3300048907 Bacteria 5212
392 Ga0496104_0077268 3300048907 Bacteria 3172
393 Ga0496104_0131277 3300048907 Bacteria 2406
394 Ga0496104_0332469 3300048907 Bacteria 1432
395 Ga0496105_0201818 3300048908 Bacteria 1623
396 Ga0496105_0216419 3300048908 Bacteria 1560
397 Ga0496106_0021422 3300048909 Unclassified 4800
398 Ga0496106_0175221 3300048909 Bacteria 1701
399 Ga0496107_0007037 3300048910 Bacteria 7750
400 Ga0496107_0017992 3300048910 Bacteria 4973
401 Ga0496108_0160269 3300048911 Bacteria 1944
402 Ga0496109_0201462 3300048912 Bacteria 1871
403 Ga0496110_0024668 3300048913 Bacteria 5128
404 Ga0496111_0056944 3300048914 Bacteria 2829
405 Ga0496112_0005668 3300048915 Bacteria 10848
406 Ga0496112_0080399 3300048915 Bacteria 3223
407 Ga0496112_0325888 3300048915 Bacteria 1480
408 Ga0496114_0241454 3300048917 Bacteria 1589
409 Ga0496115_0003239 3300048918 Bacteria 11687
410 Ga0501032_0000690 3300049569 Bacteria 27425
411 Ga0501032_0022491 3300049569 Bacteria 4369
412 Ga0501033_0003635 3300049570 Bacteria 12573
413 Ga0501034_0022410 3300049571 Bacteria 6436
414 Ga0501034_0149090 3300049571 Bacteria 2315
415 Ga0501036_0000119 3300049572 Bacteria 49192
416 Ga0501037_0000940 3300049573 Bacteria 21614
417 Ga0501038_0000925 3300049574 Bacteria 26081
418 Ga0501039_0004849 3300049575 Bacteria 10185
419 Ga0501043_0006993 3300049579 Bacteria 8986
420 Ga0501046_0001630 3300049580 Bacteria 21493
421 Ga0501047_0026523 3300049581 Bacteria 5575
422 Ga0501048_0056847 3300049582 Bacteria 2776
423 Ga0501067_0000520 3300049583 Bacteria 21092
424 Ga0501068_0000193 3300049584 Bacteria 28741
425 Ga0501069_0001006 3300049585 Bacteria 13423
426 Ga0501070_0014123 3300049586 Bacteria 6722
427 Ga0501070_0128333 3300049586 Bacteria 2095
428 Ga0501072_0000268 3300049588 Bacteria 38010
429 Ga0501073_0035558 3300049589 Bacteria 3540
430 Ga0501073_0110701 3300049589 Bacteria 1905
431 Ga0501074_0078232 3300049590 Bacteria 2373
432 Ga0501076_0275008 3300049592 Bacteria 1379
433 Ga0501077_0001183 3300049593 Bacteria 15738
434 Ga0501079_0034391 3300049741 Bacteria 3899
435 Ga0501080_0000015 3300049742 Bacteria 98057
436 Ga0501080_0225276 3300049742 Bacteria 1715
437 Ga0501083_0009992 3300049744 Bacteria 6693
438 Ga0501035_0140746 3300049822 Bacteria 2098
439 Ga0501044_0023435 3300049823 Bacteria 6565
440 nmdc:mga0qj67_194802_c1 3300050509 Bacteria 1647
441 nmdc:mga06r32_218446_c1 3300050510 Bacteria 1894
442 Ga0501084_0001112 3300054114 Bacteria 20957
443 Ga0501082_0000117 3300060353 Bacteria 62783
444 Ga0501082_0003075 3300060353 Bacteria 14555
445 Ga0207649_10154049
446 rootH2_10132221
447 rootH2_10159057
448 Ga0065712_10113251
449 Ga0065715_10025694
450 Ga0070683_100028961
451 Ga0070683_100068458
452 Ga0070683_100140348
453 Ga0070670_100019285
454 Ga0068869_100002381
455 Ga0068869_100018010
456 Ga0070680_100090779
457 Ga0070680_100285511
458 Ga0070682_100303792
459 Ga0070682_100309772
460 Ga0068868_100002059
461 Ga0068868_100117307
462 Ga0068868_100169332
463 Ga0070660_100066441
464 Ga0070687_100095867
465 Ga0070661_100001260
466 Ga0070661_100061465
467 Ga0070661_100068559
468 Ga0070661_100071567
469 Ga0070661_100105992
470 Ga0070671_100001739
471 Ga0070688_100385398
472 Ga0070667_100004796
473 Ga0070709_10076028
474 Ga0070714_100001316
475 Ga0070710_10077946
476 Ga0070711_100000204
477 Ga0070711_100034182
478 Ga0070663_100039412
479 Ga0068867_100034883
480 Ga0070706_100289324
481 Ga0070679_100036457
482 Ga0070679_100076896
483 Ga0070684_100003799
484 Ga0070684_100004476
485 Ga0070684_100041002
486 Ga0070684_100116983
487 Ga0070684_100139081
488 Ga0070697_100000221
489 Ga0068853_100000025
490 Ga0070693_100058124
491 Ga0070665_100013968
492 Ga0070665_100155092
493 Ga0070665_100204332
494 Ga0068855_100047215
495 Ga0068855_100063716
496 Ga0068855_100081329
497 Ga0068855_100120539
498 Ga0068855_100143072
499 Ga0068855_100398294
500 Ga0068857_100002925
501 Ga0068857_100008354
502 Ga0068854_100008205
503 Ga0068854_100248495
504 Ga0068856_100002495
505 Ga0068856_100005984
506 Ga0068856_100006141
507 Ga0068856_100058276
508 Ga0068856_100462736
509 Ga0068852_100000014
510 Ga0068852_100004033
511 Ga0068852_100071955
512 Ga0068852_100110891
513 Ga0068852_100138478
514 Ga0068859_100007798
515 Ga0068859_100020304
516 Ga0068864_100008454
517 Ga0068866_10070262
518 Ga0068851_10020654
519 Ga0068851_10022212
520 Ga0068851_10095334
521 Ga0068863_100002984
522 Ga0068863_100057252
523 Ga0068863_100125201
524 Ga0068863_100132586
525 Ga0068863_100146055
526 Ga0068858_100014872
527 Ga0068858_100018035
528 Ga0068860_100002519
529 Ga0068860_100018797
530 Ga0068860_100030370
531 Ga0068862_100035112
532 Ga0070715_10012052
533 Ga0070716_100103846
534 Ga0070712_100001469
535 Ga0097621_100002167
536 Ga0097621_100003353
537 Ga0097621_100060078
538 Ga0068871_100003167
539 Ga0068871_100010898
540 Ga0068871_100015162
541 Ga0068871_100238372
542 Ga0075431_100046278
543 Ga0068865_100006543
544 Ga0075436_100042142
545 Ga0097620_100007798
546 Ga0097620_100020304
547 Ga0105240_10000177
548 Ga0105240_10000409
549 Ga0105240_10006056
550 Ga0105240_10011628
551 Ga0105240_10048745
552 Ga0105240_10068985
553 Ga0105240_10080693
554 Ga0105240_10516277
555 Ga0105240_10874783
556 Ga0105245_10003437
557 Ga0105245_10007348
558 Ga0105245_10024156
559 Ga0105245_10135732
560 Ga0105245_10237237
561 Ga0105247_10002321
562 Ga0105247_10112263
563 Ga0114129_10812735
564 Ga0105241_10000044
565 Ga0105241_10001120
566 Ga0105241_10002011
567 Ga0105241_10006757
568 Ga0105241_10018527
569 Ga0105241_10054798
570 Ga0105241_10072392
571 Ga0105241_10235480
572 Ga0105248_10001093
573 Ga0105248_10016467
574 Ga0105248_10117613
575 Ga0105248_10228427
576 Ga0105248_10824458
577 Ga0105237_10000382
578 Ga0105237_10007371
579 Ga0105238_10000056
580 Ga0105238_10001716
581 Ga0105238_10002986
582 Ga0105238_10008127
583 Ga0105238_10017192
584 Ga0105238_10017799
585 Ga0105238_10035242
586 Ga0105238_10074334
587 Ga0105249_10028725
588 Ga0105249_10405324
589 Ga0105239_10000398
590 Ga0105239_10002177
591 Ga0105239_10012035
592 Ga0105239_10024525
593 Ga0105239_10028191
594 Ga0105239_10046853
595 Ga0105246_10001307
596 Ga0157373_10038905
597 Ga0157370_10001078
598 Ga0157370_10106856
599 Ga0157369_10000255
600 Ga0157369_10000527
601 Ga0157369_10003185
602 Ga0157369_10008279
603 Ga0157369_10015084
604 Ga0157369_10026239
605 Ga0157369_10044610
606 Ga0157369_10087685
607 Ga0157369_10177329
608 Ga0157369_10222992
609 Ga0157374_10000706
610 Ga0157374_10004082
611 Ga0157374_10006452
612 Ga0157374_10007806
613 Ga0157374_10012688
614 Ga0157374_10204445
615 Ga0157378_10002824
616 Ga0157378_10008674
617 Ga0157378_10013509
618 Ga0157378_10023259
619 Ga0157378_10081817
620 Ga0157378_10104311
621 Ga0157378_10161471
622 Ga0163162_10001457
623 Ga0163162_10003215
624 Ga0163162_10010666
625 Ga0163162_10023422
626 Ga0163162_10096989
627 Ga0157372_10002675
628 Ga0157372_10004836
629 Ga0157372_10008605
630 Ga0157372_10022002
631 Ga0157372_10052879
632 Ga0157372_10196640
633 Ga0157375_10003708
634 Ga0157375_10010033
635 Ga0163163_10022818
636 Ga0157379_10002174
637 Ga0157379_10067445
638 Ga0157379_10073705
639 Ga0157379_10155958
640 Ga0157376_10002000
641 Ga0157376_10014452
642 Ga0157376_10041270
643 Ga0157376_10094562
644 Ga0213876_10047511
645 Ga0207656_10024792
646 Ga0207656_10037321
647 Ga0207656_10070273
648 Ga0207642_10085015
649 Ga0207710_10001375
650 Ga0207647_10002133
651 Ga0207684_10250355
652 Ga0207654_10000033
653 Ga0207654_10000714
654 Ga0207654_10001524
655 Ga0207654_10014795
656 Ga0207654_10068509
657 Ga0207654_10107448
658 Ga0207707_10239757
659 Ga0207695_10000086
660 Ga0207695_10000531
661 Ga0207695_10000605
662 Ga0207695_10004652
663 Ga0207695_10022894
664 Ga0207695_10042832
665 Ga0207695_10107621
666 Ga0207695_10264220
667 Ga0207695_10502440
668 Ga0207671_10000085
669 Ga0207671_10001234
670 Ga0207671_10441691
671 Ga0207693_10000039
672 Ga0207663_10000522
673 Ga0207663_10123409
674 Ga0207657_10000647
675 Ga0207649_10007479
676 Ga0207649_10053692
677 Ga0207649_10273629
678 Ga0207649_10375996
679 Ga0207652_10138175
680 Ga0207652_10278381
681 Ga0207694_10000058
682 Ga0207694_10000802
683 Ga0207694_10026823
684 Ga0207694_10041396
685 Ga0207694_10068406
686 Ga0207694_10106266
687 Ga0207694_10148653
688 Ga0207694_10158495
689 Ga0207650_10011581
690 Ga0207687_10001528
691 Ga0207687_10071537
692 Ga0207687_10080434
693 Ga0207700_10004093
694 Ga0207664_10036983
695 Ga0207644_10039786
696 Ga0207706_10030768
697 Ga0207704_10015345
698 Ga0207665_10133165
699 Ga0207711_10001489
700 Ga0207711_10047012
701 Ga0207711_10049137
702 Ga0207711_10056412
703 Ga0207711_10138673
704 Ga0207689_10001596
705 Ga0207689_10005016
706 Ga0207661_10005087
707 Ga0207661_10034149
708 Ga0207661_10079585
709 Ga0207679_10108974
710 Ga0207679_10205714
711 Ga0207667_10021194
712 Ga0207667_10054314
713 Ga0207712_10056295
714 Ga0207712_10270772
715 Ga0207640_10042853
716 Ga0207658_10001635
717 Ga0207677_10001336
718 Ga0207677_10057255
719 Ga0207703_10011358
720 Ga0207703_10045033
721 Ga0207703_10503164
722 Ga0207639_10000030
723 Ga0207639_10021339
724 Ga0207639_10109332
725 Ga0207678_10195676
726 Ga0207678_10226025
727 Ga0207702_10002773
728 Ga0207702_10039435
729 Ga0207702_10041231
730 Ga0207702_10078192
731 Ga0207641_10003676
732 Ga0207641_10010074
733 Ga0207641_10022604
734 Ga0207641_10075222
735 Ga0207641_10198426
736 Ga0207648_10024239
737 Ga0207676_10003259
738 Ga0207676_10160915
739 Ga0207674_10002695
740 Ga0207674_10008552
741 Ga0207674_10046512
742 Ga0207698_10000030
743 Ga0207698_10046264
744 Ga0207698_10137824
745 Ga0207698_10160813
746 Ga0268266_10025193
747 Ga0268266_10232119
748 Ga0268264_10001399
749 Ga0268264_10289651
750 Ga0265336_10005101
751 Ga0265338_10016531
752 Ga0265338_10030966
753 Ga0265338_10039582
754 Ga0265338_10129268
755 Ga0265338_10141430
756 Ga0265770_1019126
757 Ga0265330_10000420
758 Ga0265330_10050761
759 Ga0265332_10016751
760 Ga0265328_10003389
761 Ga0265320_10003269
762 Ga0265325_10000297
763 Ga0265325_10024850
764 Ga0265340_10001619
765 Ga0265340_10096848
766 Ga0265339_10000046
767 Ga0265339_10000351
768 Ga0265339_10004150
769 Ga0265339_10027504
770 Ga0265339_10060651
771 Ga0265339_10068051
772 Ga0265316_10003087
773 Ga0265316_10013504
774 Ga0265316_10017190
775 Ga0265316_10046407
776 Ga0265316_10143338
777 Ga0265313_10010548
778 Ga0265313_10051250
779 Ga0265314_10000867
780 Ga0265314_10018434
781 Ga0265314_10047157
782 Ga0265314_10077056
783 Ga0265314_10078086
784 Ga0265342_10001502
785 Ga0265342_10004648
786 Ga0265342_10008019
787 Ga0265342_10013649
788 Ga0265342_10038011
789 Ga0265342_10040445
790 Ga0265342_10053630
791 Ga0373934_0012170
792 Ga0373923_0013705
793 Ga0373953_0008358
794 Ga0373954_0001856
795 Ga0373935_0073956
796 Ga0373927_0172084
797 Ga0373933_0045527
798 Ga0373933_0047678
799 Ga0373933_0074182
800 Ga0373937_0014919
801 Ga0373937_0020939
802 Ga0373937_0031024
803 Ga0373937_0050212
804 Ga0373937_0549456
805 Ga0373925_0267371
806 Ga0373925_0441142
807 Ga0436364_0186679
808 Ga0436364_0279497
809 Ga0436364_1069461
810 Ga0436365_0834651
811 Ga0436363_0461602
812 Ga0453683_0287048
813 Ga0466963_0185632
814 Ga0466967_0002337
815 Ga0466967_0071180
816 Ga0495629_0081220
817 Ga0495580_0022088
818 Ga0495580_0055801
819 Ga0495664_0047839
820 Ga0495645_0004760
821 Ga0495634_0263759
822 Ga0495635_0221937
823 Ga0495646_0026071
824 Ga0495613_0074083
825 Ga0495680_0063579
826 Ga0495675_0150641
827 Ga0495684_0272456
828 Ga0495593_0049403
829 Ga0496100_0259604
830 Ga0496101_0003390
831 Ga0496101_0265015
832 Ga0496102_0000903
833 Ga0496102_0141471
834 Ga0496102_0596818
835 Ga0496104_0028092
836 Ga0496104_0077268
837 Ga0496104_0131277
838 Ga0496104_0332469
839 Ga0496105_0201818
840 Ga0496105_0216419
841 Ga0496106_0021422
842 Ga0496106_0175221
843 Ga0496107_0007037
844 Ga0496107_0017992
845 Ga0496108_0160269
846 Ga0496109_0201462
847 Ga0496110_0024668
848 Ga0496111_0056944
849 Ga0496112_0005668
850 Ga0496112_0080399
851 Ga0496112_0325888
852 Ga0496114_0241454
853 Ga0496115_0003239
854 Ga0501032_0000690
855 Ga0501032_0022491
856 Ga0501033_0003635
857 Ga0501034_0022410
858 Ga0501034_0149090
859 Ga0501036_0000119
860 Ga0501037_0000940
861 Ga0501038_0000925
862 Ga0501039_0004849
863 Ga0501043_0006993
864 Ga0501046_0001630
865 Ga0501047_0026523
866 Ga0501048_0056847
867 Ga0501067_0000520
868 Ga0501068_0000193
869 Ga0501069_0001006
870 Ga0501070_0014123
871 Ga0501070_0128333
872 Ga0501072_0000268
873 Ga0501073_0035558
874 Ga0501073_0110701
875 Ga0501074_0078232
876 Ga0501076_0275008
877 Ga0501077_0001183
878 Ga0501079_0034391
879 Ga0501080_0000015
880 Ga0501080_0225276
881 Ga0501083_0009992
882 Ga0501035_0140746
883 Ga0501044_0023435
884 nmdc:mga0qj67_194802_c1
885 nmdc:mga06r32_218446_c1
886 Ga0501084_0001112
887 Ga0501082_0000117
888 Ga0501082_0003075

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20560

MotA_N

Motility protein A N-terminal

4

93

0.99

PF01618

MotA_ExbB

MotA/TolQ/ExbB proton channel family

117

236

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gqy-assembly1.cif.gz_A cryoem structure of pentameric mota from aquifex aeolicus 0.8524 3 259
6ykp-assembly1.cif.gz_C structure of unplugged c. jejuni motab 0.8399 3 273
6ysl-assembly1.cif.gz_G structure of the flagellar motab stator complex from bacillus subtilis 0.8301 1 273
6ykp-assembly1.cif.gz_C structure of unplugged c. jejuni motab 0.8222 3 273
6ysl-assembly1.cif.gz_G structure of the flagellar motab stator complex from bacillus subtilis 0.8213 1 273
ID Description Score Start End Superfamily
af_P09348_118_240_1.20.58.220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9144 124 239 1.20.58.220
af_P09348_118_240_1.20.58.220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.859 124 239 1.20.58.220
4kb2A01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.5347 141 226 1.10.132.20
1wqhA01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.4839 140 227 1.10.132.20
af_Q99N08_47_207_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4587 52 238 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A5K7XC42-F1-model_v4 Flagellar motor rotation protein MotA 0.9728 1 284 GO:0005886
GO:0006935
GO:0071978
GO:1902600
AF-A0A2V9N7L7-F1-model_v4 Flagellar motor stator protein MotA 0.9722 1 171 GO:0005886
GO:0006935
GO:0071978
AF-A0A2A2QZP7-F1-model_v4 Flagellar motor stator protein MotA 0.9716 1 281 GO:0005886
GO:0006935
GO:0071978
GO:1902600
AF-A0A7C0WBN3-F1-model_v4 Flagellar motor stator protein MotA 0.9714 1 281 GO:0005886
GO:0006935
GO:0071978
GO:1902600
AF-A0A1A6C1Y2-F1-model_v4 Flagellar motor protein MotA 0.9709 3 285 GO:0005886
GO:0006935
GO:0071978
GO:1902600

Map