F445325

General Info

Members Datasets Scaffolds Average Seq Length
444 264 888 254

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0791244|Ga0436364_0791244_5540_6424
Length 294
Sequence MKDHARAVFPAGTGIAHSSLVHHCPTDRAGKDNGMDLNLRGKTALVTGASKGIGRASAEALAEEGVNVILVSRTHADLDAVRDSIAARWNVRVEVHAFDISDSANVDRLAALHPDIDILVNNAGAIPGGNLQEVDERRWREAWDLKVYGYINMCRRFYALMKQRGRGVIINILGMAGERMDVGYIAGSAGNAGLMAFTRTLGGAASADNLRVVGINPGAIATDRLVTIMKKRAQDRLGDAGRWEELMQPLPFGRAGTPEEIGSMVAFLSSDKSAYTTGTIITIDGGAANRGPMF

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
101 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
102 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
157 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
164 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
165 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
166 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
167 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
182 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
183 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
186 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
198 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
199 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
202 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
205 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
206 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
207 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
210 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
211 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
212 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
215 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
216 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
219 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
225 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
233 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
234 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
235 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
236 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
237 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
240 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
241 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
242 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
243 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
244 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
245 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
246 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
247 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
248 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
251 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
256 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
257 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
259 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
260 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
261 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
262 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
263 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
264 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.42
Metatranscriptomes 0
Isolates 1.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.83
Nodule 0
Rhizoplane 0.9
Rhizosphere 92.57
Stem 0
Stem Tuber 0
Unclassified 3.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0791244 3300037853 Bacteria 7761
2 rootH1_10362135 3300003323 Bacteria 2048
3 Ga0065707_10011384 3300005295 Bacteria 3181
4 Ga0070658_10025736 3300005327 Bacteria 4717
5 Ga0070683_100137867 3300005329 Bacteria 2311
6 Ga0070683_100614817 3300005329 Bacteria 1040
7 Ga0070690_100001285 3300005330 Bacteria 13046
8 Ga0070690_100082118 3300005330 Bacteria 2110
9 Ga0068869_100006971 3300005334 Bacteria 7193
10 Ga0070680_100218347 3300005336 Bacteria 1609
11 Ga0070682_100217373 3300005337 Unclassified 1358
12 Ga0068868_100110066 3300005338 Bacteria 2238
13 Ga0070689_100002710 3300005340 Bacteria 11597
14 Ga0070689_100103954 3300005340 Bacteria 2252
15 Ga0070689_100149134 3300005340 Bacteria 1885
16 Ga0070689_100247175 3300005340 Bacteria 1471
17 Ga0070691_10037041 3300005341 Bacteria 2300
18 Ga0070661_100363077 3300005344 Bacteria 1138
19 Ga0070692_10049261 3300005345 Bacteria 2185
20 Ga0070692_10064038 3300005345 Bacteria 1944
21 Ga0070668_100451438 3300005347 Bacteria 1105
22 Ga0070675_100088213 3300005354 Bacteria 2595
23 Ga0070675_100291167 3300005354 Bacteria 1437
24 Ga0070675_100406829 3300005354 Bacteria 1215
25 Ga0070674_100262936 3300005356 Unclassified 1360
26 Ga0070673_100638087 3300005364 Bacteria 974
27 Ga0070659_100050422 3300005366 Bacteria 3272
28 Ga0070714_100017355 3300005435 Bacteria 5829
29 Ga0070713_100056501 3300005436 Bacteria 3265
30 Ga0070710_10202872 3300005437 Bacteria 1253
31 Ga0070701_10131669 3300005438 Bacteria 1421
32 Ga0070711_100309894 3300005439 Bacteria 1258
33 Ga0070705_100038896 3300005440 Bacteria 2696
34 Ga0070700_100001566 3300005441 Bacteria 11409
35 Ga0070700_100326976 3300005441 Bacteria 1128
36 Ga0070700_100331292 3300005441 Bacteria 1122
37 Ga0070694_100010450 3300005444 Bacteria 5728
38 Ga0070694_100105544 3300005444 Bacteria 1999
39 Ga0070694_100160746 3300005444 Bacteria 1648
40 Ga0070694_100220713 3300005444 Bacteria 1421
41 Ga0070678_100029867 3300005456 Bacteria 3739
42 Ga0070678_100141254 3300005456 Bacteria 1927
43 Ga0070662_100130383 3300005457 Bacteria 1938
44 Ga0070681_10023435 3300005458 Bacteria 6207
45 Ga0070681_10255324 3300005458 Bacteria 1665
46 Ga0068867_100007546 3300005459 Bacteria 7694
47 Ga0070707_100120467 3300005468 Bacteria 2547
48 Ga0070707_100647764 3300005468 Bacteria 1019
49 Ga0070698_100017628 3300005471 Bacteria 7524
50 Ga0070699_100204595 3300005518 Bacteria 1756
51 Ga0070699_100259601 3300005518 Bacteria 1554
52 Ga0070679_100045173 3300005530 Bacteria 4390
53 Ga0070679_100181332 3300005530 Bacteria 2078
54 Ga0070679_100214137 3300005530 Bacteria 1889
55 Ga0070697_100303013 3300005536 Bacteria 1374
56 Ga0068853_100003905 3300005539 Bacteria 11429
57 Ga0068853_100413638 3300005539 Bacteria 1264
58 Ga0068853_100624687 3300005539 Bacteria 1024
59 Ga0070695_100009851 3300005545 Bacteria 5693
60 Ga0070695_100250631 3300005545 Bacteria 1289
61 Ga0070695_100251024 3300005545 Unclassified 1288
62 Ga0070696_100204497 3300005546 Bacteria 1475
63 Ga0070696_100483047 3300005546 Bacteria 983
64 Ga0070693_100234387 3300005547 Unclassified 1209
65 Ga0070693_100371408 3300005547 Bacteria 984
66 Ga0070665_100478402 3300005548 Bacteria 1256
67 Ga0070704_100012262 3300005549 Bacteria 5292
68 Ga0070704_100134083 3300005549 Bacteria 1924
69 Ga0070704_100143831 3300005549 Bacteria 1866
70 Ga0070704_100179765 3300005549 Bacteria 1691
71 Ga0070704_100274104 3300005549 Bacteria 1395
72 Ga0068855_100053404 3300005563 Bacteria 4754
73 Ga0068855_100148961 3300005563 Bacteria 2661
74 Ga0068855_100252250 3300005563 Bacteria 1968
75 Ga0068855_100261374 3300005563 Bacteria 1928
76 Ga0068855_100451518 3300005563 Bacteria 1403
77 Ga0070664_100235583 3300005564 Bacteria 1642
78 Ga0070664_100558307 3300005564 Unclassified 1059
79 Ga0068857_100118893 3300005577 Bacteria 2378
80 Ga0068857_100143991 3300005577 Bacteria 2156
81 Ga0068856_100093284 3300005614 Bacteria 2996
82 Ga0068856_100269613 3300005614 Bacteria 1718
83 Ga0068856_100299792 3300005614 Bacteria 1625
84 Ga0068856_100630284 3300005614 Bacteria 1093
85 Ga0070702_100000237 3300005615 Bacteria 18638
86 Ga0070702_100126981 3300005615 Bacteria 1605
87 Ga0070702_100434719 3300005615 Bacteria 948
88 Ga0068852_100018400 3300005616 Bacteria 5503
89 Ga0068852_100129924 3300005616 Bacteria 2318
90 Ga0068852_100630562 3300005616 Bacteria 1078
91 Ga0068859_100013168 3300005617 Bacteria 8307
92 Ga0068859_100092838 3300005617 Bacteria 3070
93 Ga0068859_100106055 3300005617 Bacteria 2869
94 Ga0068864_100358464 3300005618 Bacteria 1377
95 Ga0068866_10002731 3300005718 Bacteria 7280
96 Ga0068866_10114527 3300005718 Bacteria 1510
97 Ga0068861_100729414 3300005719 Bacteria 924
98 Ga0068863_100159056 3300005841 Bacteria 2164
99 Ga0068863_100518460 3300005841 Bacteria 1175
100 Ga0068863_100655913 3300005841 Bacteria 1041
101 Ga0068858_100039659 3300005842 Bacteria 4367
102 Ga0068858_100369953 3300005842 Unclassified 1374
103 Ga0068860_100317767 3300005843 Bacteria 1528
104 Ga0068862_100007234 3300005844 Bacteria 9216
105 Ga0068862_100118531 3300005844 Bacteria 2330
106 Ga0068862_100213762 3300005844 Bacteria 1743
107 Ga0081538_10050028 3300005981 Bacteria 2529
108 Ga0070717_10052286 3300006028 Bacteria 3365
109 Ga0070717_10095075 3300006028 Bacteria 2522
110 Ga0075365_10070467 3300006038 Bacteria 2351
111 Ga0075365_10134770 3300006038 Bacteria 1711
112 Ga0075368_10040451 3300006042 Bacteria 1831
113 Ga0075363_100028057 3300006048 Bacteria 2892
114 Ga0075364_10000241 3300006051 Bacteria 26213
115 Ga0075364_10026214 3300006051 Bacteria 3716
116 Ga0070712_100019293 3300006175 Bacteria 4446
117 Ga0075367_10117475 3300006178 Bacteria 1637
118 Ga0097621_100054741 3300006237 Unclassified 3255
119 Ga0075370_10047195 3300006353 Bacteria 2439
120 Ga0068871_100004155 3300006358 Bacteria 10022
121 Ga0068871_100229223 3300006358 Bacteria 1612
122 Ga0075428_100062352 3300006844 Bacteria 4082
123 Ga0075430_100015812 3300006846 Bacteria 6426
124 Ga0075431_100000345 3300006847 Bacteria 36593
125 Ga0075431_100092424 3300006847 Bacteria 3123
126 Ga0075434_100016926 3300006871 Bacteria 7013
127 Ga0075429_100008907 3300006880 Bacteria 8722
128 Ga0075429_100139138 3300006880 Bacteria 2125
129 Ga0068865_100018161 3300006881 Bacteria 4535
130 Ga0097620_100013168 3300006931 Bacteria 8307
131 Ga0097620_100092838 3300006931 Bacteria 3070
132 Ga0097620_100106056 3300006931 Bacteria 2869
133 Ga0075435_100066028 3300007076 Bacteria 2942
134 Ga0075435_100150535 3300007076 Bacteria 1956
135 Ga0075435_100305072 3300007076 Bacteria 1362
136 Ga0111539_10037614 3300009094 Bacteria 5843
137 Ga0111539_10122500 3300009094 Bacteria 3047
138 Ga0111539_11269060 3300009094 Bacteria 855
139 Ga0105245_10001256 3300009098 Bacteria 22910
140 Ga0105245_10150347 3300009098 Bacteria 2201
141 Ga0105247_10145517 3300009101 Bacteria 1557
142 Ga0105247_10188450 3300009101 Bacteria 1380
143 Ga0114129_10016707 3300009147 Bacteria 10452
144 Ga0114129_10025697 3300009147 Bacteria 8342
145 Ga0114129_10315265 3300009147 Bacteria 2080
146 Ga0114129_10357984 3300009147 Bacteria 1931
147 Ga0105243_10002945 3300009148 Bacteria 14074
148 Ga0105243_10070629 3300009148 Bacteria 2820
149 Ga0105243_10096667 3300009148 Bacteria 2444
150 Ga0105241_10024794 3300009174 Bacteria 4455
151 Ga0105241_10165119 3300009174 Bacteria 1824
152 Ga0105242_10005883 3300009176 Bacteria 9453
153 Ga0105242_10129260 3300009176 Bacteria 2178
154 Ga0105248_10125263 3300009177 Bacteria 2898
155 Ga0105248_10126240 3300009177 Bacteria 2886
156 Ga0105248_10395056 3300009177 Bacteria 1557
157 Ga0105237_10052902 3300009545 Bacteria 4074
158 Ga0105237_10450660 3300009545 Bacteria 1293
159 Ga0105239_10084845 3300010375 Bacteria 3489
160 Ga0105239_10119348 3300010375 Bacteria 2927
161 Ga0105246_10228760 3300011119 Unclassified 1463
162 Ga0157371_10034562 3300013102 Bacteria 3625
163 Ga0157369_10127325 3300013105 Bacteria 2699
164 Ga0157369_10153003 3300013105 Bacteria 2438
165 Ga0157374_10412702 3300013296 Unclassified 1348
166 Ga0157378_10010883 3300013297 Bacteria 7956
167 Ga0157378_10163178 3300013297 Bacteria 2085
168 Ga0157378_10222064 3300013297 Bacteria 1797
169 Ga0163162_10203572 3300013306 Bacteria 2108
170 Ga0163162_10305949 3300013306 Bacteria 1722
171 Ga0163162_10504341 3300013306 Bacteria 1340
172 Ga0157372_10420866 3300013307 Bacteria 1557
173 Ga0157375_10053895 3300013308 Bacteria 3960
174 Ga0157375_10379800 3300013308 Bacteria 1580
175 Ga0163163_10459131 3300014325 Bacteria 1334
176 Ga0157380_10027371 3300014326 Bacteria 4336
177 Ga0157380_10037204 3300014326 Bacteria 3769
178 Ga0182008_10010870 3300014497 Bacteria 4856
179 Ga0157379_10025335 3300014968 Bacteria 5269
180 Ga0157379_10314638 3300014968 Bacteria 1429
181 Ga0157379_10580009 3300014968 Bacteria 1045
182 Ga0157376_10021851 3300014969 Bacteria 4975
183 Ga0157376_10120371 3300014969 Bacteria 2326
184 Ga0157376_10558426 3300014969 Unclassified 1134
185 Ga0163161_10294169 3300017792 Bacteria 1277
186 Ga0213872_10045318 3300021361 Bacteria 2001
187 Ga0213875_10019036 3300021388 Bacteria 3305
188 Ga0209025_1043690 3300025294 Bacteria 1884
189 Ga0207642_10037565 3300025899 Bacteria 2088
190 Ga0207642_10123692 3300025899 Bacteria 1339
191 Ga0207710_10161695 3300025900 Bacteria 1091
192 Ga0207685_10174906 3300025905 Bacteria 991
193 Ga0207699_10327010 3300025906 Bacteria 1077
194 Ga0207645_10185288 3300025907 Unclassified 1366
195 Ga0207643_10008619 3300025908 Bacteria 5468
196 Ga0207705_10003527 3300025909 Bacteria 11915
197 Ga0207684_10150418 3300025910 Bacteria 2003
198 Ga0207654_10104047 3300025911 Bacteria 1754
199 Ga0207707_10027093 3300025912 Bacteria 5011
200 Ga0207707_10037546 3300025912 Unclassified 4234
201 Ga0207707_10357101 3300025912 Bacteria 1258
202 Ga0207693_10058627 3300025915 Bacteria 3016
203 Ga0207663_10029222 3300025916 Bacteria 3235
204 Ga0207663_10359291 3300025916 Bacteria 1105
205 Ga0207662_10496419 3300025918 Bacteria 840
206 Ga0207652_10337141 3300025921 Bacteria 1361
207 Ga0207652_10342131 3300025921 Bacteria 1350
208 Ga0207652_10400188 3300025921 Bacteria 1239
209 Ga0207681_10668839 3300025923 Bacteria 862
210 Ga0207694_10091126 3300025924 Bacteria 2406
211 Ga0207659_10313731 3300025926 Bacteria 1292
212 Ga0207687_10349989 3300025927 Bacteria 1203
213 Ga0207700_10409350 3300025928 Bacteria 1190
214 Ga0207664_10263985 3300025929 Bacteria 1506
215 Ga0207706_10180899 3300025933 Bacteria 1852
216 Ga0207706_10417738 3300025933 Bacteria 1162
217 Ga0207686_10075836 3300025934 Bacteria 2178
218 Ga0207686_10133399 3300025934 Bacteria 1706
219 Ga0207709_10039940 3300025935 Bacteria 2806
220 Ga0207709_10254106 3300025935 Bacteria 1285
221 Ga0207670_10025421 3300025936 Bacteria 3716
222 Ga0207670_10043420 3300025936 Bacteria 2969
223 Ga0207670_10047857 3300025936 Bacteria 2851
224 Ga0207670_10137729 3300025936 Bacteria 1797
225 Ga0207670_10464318 3300025936 Bacteria 1023
226 Ga0207669_10033605 3300025937 Bacteria 2897
227 Ga0207691_10286426 3300025940 Bacteria 1417
228 Ga0207689_10000519 3300025942 Bacteria 36612
229 Ga0207689_10021940 3300025942 Bacteria 5369
230 Ga0207667_10096026 3300025949 Bacteria 3059
231 Ga0207667_10178598 3300025949 Bacteria 2180
232 Ga0207667_10222543 3300025949 Bacteria 1933
233 Ga0207651_10434638 3300025960 Bacteria 1123
234 Ga0207712_10074792 3300025961 Bacteria 2447
235 Ga0207658_10433104 3300025986 Bacteria 1162
236 Ga0207677_10127689 3300026023 Bacteria 1925
237 Ga0207677_10376906 3300026023 Bacteria 1196
238 Ga0207703_10276705 3300026035 Bacteria 1523
239 Ga0207703_10405804 3300026035 Bacteria 1265
240 Ga0207639_10003694 3300026041 Bacteria 10289
241 Ga0207639_10564687 3300026041 Bacteria 1046
242 Ga0207708_10001346 3300026075 Bacteria 18481
243 Ga0207708_10140751 3300026075 Bacteria 1892
244 Ga0207708_10398505 3300026075 Bacteria 1138
245 Ga0207702_10036799 3300026078 Bacteria 4095
246 Ga0207641_10506765 3300026088 Bacteria 1173
247 Ga0207641_10612487 3300026088 Bacteria 1067
248 Ga0207648_10000461 3300026089 Bacteria 45235
249 Ga0207676_10385824 3300026095 Bacteria 1305
250 Ga0207674_10032514 3300026116 Bacteria 5472
251 Ga0207674_10479848 3300026116 Bacteria 1202
252 Ga0207675_100001140 3300026118 Bacteria 26326
253 Ga0207675_100044721 3300026118 Bacteria 4138
254 Ga0207675_100285103 3300026118 Bacteria 1605
255 Ga0207683_10213032 3300026121 Bacteria 1759
256 Ga0207698_10025235 3300026142 Bacteria 4183
257 Ga0207698_10143871 3300026142 Unclassified 2059
258 Ga0207698_10266466 3300026142 Bacteria 1577
259 Ga0207698_10594017 3300026142 Bacteria 1091
260 Ga0207428_10094110 3300027907 Bacteria 2323
261 Ga0268266_10318517 3300028379 Bacteria 1455
262 Ga0268266_10555677 3300028379 Bacteria 1100
263 Ga0268264_10161183 3300028381 Unclassified 2020
264 Ga0268264_10229342 3300028381 Bacteria 1714
265 Ga0268264_10492329 3300028381 Bacteria 1194
266 Ga0265318_10023172 3300028577 Bacteria 2476
267 Ga0265338_10025620 3300028800 Bacteria 5979
268 Ga0265320_10138470 3300031240 Bacteria 1103
269 Ga0265340_10036728 3300031247 Bacteria 2427
270 Ga0307408_100354090 3300031548 Bacteria 1247
271 Ga0307408_100796244 3300031548 Bacteria 857
272 Ga0316575_10002967 3300031665 Bacteria 5773
273 Ga0316575_10014233 3300031665 Bacteria 2983
274 Ga0265314_10227927 3300031711 Bacteria 1083
275 Ga0316576_10120792 3300031727 Bacteria 1967
276 Ga0316578_10002596 3300031728 Bacteria 7997
277 Ga0307413_10266874 3300031824 Bacteria 1279
278 Ga0307412_10445078 3300031911 Bacteria 1066
279 Ga0373934_0214821 3300035086 Bacteria 793
280 Ga0373923_0222566 3300035111 Bacteria 877
281 Ga0373936_0097233 3300035113 Bacteria 1239
282 Ga0373936_0105099 3300035113 Bacteria 1194
283 Ga0373936_0165752 3300035113 Bacteria 964
284 Ga0373954_0062680 3300035118 Bacteria 1757
285 Ga0373956_0018596 3300035119 Bacteria 2943
286 Ga0373942_0005350 3300035207 Bacteria 2979
287 Ga0373961_0019652 3300035241 Bacteria 1777
288 Ga0373924_0027155 3300035410 Bacteria 2275
289 Ga0373931_0275758 3300035691 Bacteria 1031
290 Ga0373935_0015849 3300035692 Bacteria 4561
291 Ga0373935_0054720 3300035692 Bacteria 2542
292 Ga0373935_0183844 3300035692 Bacteria 1436
293 Ga0373935_0448006 3300035692 Bacteria 932
294 Ga0373927_0147416 3300035695 Bacteria 1541
295 Ga0373927_0253312 3300035695 Bacteria 1157
296 Ga0373933_0054448 3300035724 Bacteria 2398
297 Ga0373933_0162209 3300035724 Bacteria 1420
298 Ga0373933_0216323 3300035724 Bacteria 1229
299 Ga0373933_0265997 3300035724 Bacteria 1106
300 Ga0373947_0012320 3300035725 Bacteria 4901
301 Ga0373937_0001833 3300036401 Bacteria 17856
302 Ga0373937_0004886 3300036401 Bacteria 11394
303 Ga0373937_0016991 3300036401 Bacteria 6471
304 Ga0373937_0061173 3300036401 Bacteria 3461
305 Ga0373937_0077515 3300036401 Bacteria 3071
306 Ga0373937_0134153 3300036401 Bacteria 2314
307 Ga0373937_0354152 3300036401 Bacteria 1391
308 Ga0316584_0008110 3300036712 Bacteria 7216
309 Ga0373925_0066811 3300037068 Bacteria 2711
310 Ga0373925_0068203 3300037068 Bacteria 2684
311 Ga0373925_0093927 3300037068 Bacteria 2296
312 Ga0395898_0336745 3300037466 Bacteria 1439
313 Ga0316581_0013720 3300037588 Bacteria 2301
314 Ga0395901_0015644 3300038443 Bacteria 7727
315 Ga0395901_0018973 3300038443 Bacteria 7032
316 Ga0400483_177006 3300039062 Bacteria 4117
317 Ga0436365_0939926 3300039437 Bacteria 2074
318 Ga0436361_0529066 3300039447 Bacteria 3432
319 Ga0439441_001040 3300042001 Bacteria 3439
320 Ga0439441_017846 3300042001 Bacteria 1279
321 Ga0495592_0006664 3300046454 Bacteria 8608
322 Ga0495629_0431999 3300046459 Bacteria 893
323 Ga0495651_0007983 3300046462 Bacteria 8115
324 Ga0495651_0224182 3300046462 Bacteria 1299
325 Ga0495653_0113420 3300046463 Bacteria 1944
326 Ga0495653_0174070 3300046463 Bacteria 1483
327 Ga0495582_0257296 3300046473 Bacteria 1001
328 Ga0495582_0314455 3300046473 Bacteria 901
329 Ga0495639_0057187 3300046475 Bacteria 1782
330 Ga0495662_0007371 3300046476 Bacteria 5436
331 Ga0495664_0010758 3300046477 Bacteria 5142
332 Ga0495594_0303793 3300046499 Bacteria 909
333 Ga0495608_0004164 3300046511 Bacteria 10369
334 Ga0495608_0038620 3300046511 Bacteria 3205
335 Ga0495618_0002241 3300046514 Bacteria 12565
336 Ga0495628_0004512 3300046516 Bacteria 12336
337 Ga0495628_0035410 3300046516 Bacteria 4012
338 Ga0495628_0085334 3300046516 Bacteria 2450
339 Ga0495630_0003325 3300046517 Bacteria 11202
340 Ga0495630_0389866 3300046517 Bacteria 1067
341 Ga0495652_0038487 3300046529 Bacteria 4143
342 Ga0495640_0019946 3300046533 Bacteria 4944
343 Ga0495640_0034762 3300046533 Bacteria 3569
344 Ga0495586_0000357 3300046535 Bacteria 28588
345 Ga0495586_0056110 3300046535 Bacteria 2136
346 Ga0495621_0013302 3300046539 Bacteria 2583
347 Ga0495645_0004710 3300046543 Bacteria 9317
348 Ga0495645_0026596 3300046543 Bacteria 4201
349 Ga0495667_0003174 3300046559 Bacteria 11019
350 Ga0495667_0016308 3300046559 Bacteria 5020
351 Ga0495667_0028696 3300046559 Bacteria 3747
352 Ga0495634_0009887 3300046642 Bacteria 7014
353 Ga0495635_0015581 3300046663 Bacteria 5313
354 Ga0495659_0145172 3300046664 Bacteria 950
355 Ga0495657_0108505 3300046675 Bacteria 1761
356 Ga0495599_0003567 3300046678 Bacteria 9116
357 Ga0495599_0006228 3300046678 Bacteria 7191
358 Ga0495646_0176689 3300046680 Bacteria 1174
359 Ga0495658_0000597 3300046683 Bacteria 19759
360 Ga0495613_0003374 3300046689 Bacteria 11935
361 Ga0495624_0035269 3300046690 Bacteria 3230
362 Ga0495600_0008355 3300046809 Bacteria 6357
363 Ga0495600_0066393 3300046809 Bacteria 2358
364 Ga0495604_0005484 3300047317 Bacteria 10058
365 Ga0495604_0007829 3300047317 Bacteria 8458
366 Ga0495674_0097461 3300047319 Bacteria 2505
367 Ga0495674_0299821 3300047319 Bacteria 1313
368 Ga0495676_0063361 3300047321 Bacteria 2882
369 Ga0495680_0045703 3300047322 Bacteria 3457
370 Ga0495680_0074066 3300047322 Bacteria 2586
371 Ga0495680_0187059 3300047322 Bacteria 1491
372 Ga0495675_0005689 3300047444 Bacteria 7618
373 Ga0495675_0189240 3300047444 Bacteria 1257
374 Ga0495684_0038559 3300047471 Bacteria 3663
375 Ga0495593_0174966 3300047673 Bacteria 1081
376 Ga0495602_0015039 3300048088 Bacteria 7826
377 Ga0495602_0044926 3300048088 Bacteria 4002
378 Ga0495602_0476347 3300048088 Bacteria 877
379 Ga0496102_0088234 3300048905 Bacteria 2867
380 Ga0496110_0275855 3300048913 Bacteria 1531
381 Ga0496112_0464017 3300048915 Bacteria 1204
382 Ga0496114_0330899 3300048917 Bacteria 1347
383 Ga0496119_0021389 3300048922 Bacteria 4678
384 Ga0496122_0065319 3300048925 Bacteria 2639
385 Ga0501032_0051044 3300049569 Bacteria 2789
386 Ga0501034_0082778 3300049571 Bacteria 3211
387 Ga0501038_0159835 3300049574 Bacteria 1832
388 Ga0501039_0056841 3300049575 Bacteria 3031
389 Ga0501039_0232265 3300049575 Bacteria 1450
390 Ga0501041_0078474 3300049577 Bacteria 2032
391 Ga0501047_0006890 3300049581 Bacteria 10679
392 Ga0501068_0269251 3300049584 Bacteria 1087
393 Ga0501071_0011462 3300049587 Bacteria 5973
394 Ga0501072_0008383 3300049588 Bacteria 7845
395 Ga0501073_0024485 3300049589 Bacteria 4335
396 Ga0501073_0155127 3300049589 Bacteria 1587
397 Ga0501073_0320907 3300049589 Bacteria 1069
398 Ga0501074_0163891 3300049590 Bacteria 1587
399 Ga0501075_0062647 3300049591 Bacteria 2803
400 Ga0501076_0061554 3300049592 Bacteria 2987
401 Ga0501079_0015839 3300049741 Bacteria 5761
402 Ga0501079_0483149 3300049741 Unclassified 974
403 Ga0501080_0004531 3300049742 Bacteria 12383
404 Ga0501080_0231344 3300049742 Bacteria 1689
405 Ga0501080_0539104 3300049742 Bacteria 1040
406 Ga0501081_0112537 3300049743 Bacteria 1932
407 Ga0501083_0004063 3300049744 Bacteria 10295
408 Ga0501083_0108377 3300049744 Bacteria 1827
409 nmdc:mga03683_19664_c1 3300050489 Bacteria 2580
410 nmdc:mga03n38_13513_c1 3300050490 Bacteria 3104
411 nmdc:mga00v17_11498_c1 3300050491 Bacteria 4864
412 nmdc:mga00v17_141_c1 3300050491 Bacteria 41598
413 nmdc:mga0yw44_164435_c1 3300050492 Bacteria 1454
414 nmdc:mga0yw44_45121_c1 3300050492 Bacteria 2641
415 nmdc:mga06z11_104995_c1 3300050494 Bacteria 1556
416 nmdc:mga07m45_20769_c2 3300050496 Bacteria 3183
417 nmdc:mga05p37_1971_c1 3300050507 Bacteria 23923
418 nmdc:mga05p37_42418_c1 3300050507 Bacteria 5589
419 nmdc:mga05p37_752152_c1 3300050507 Bacteria 1074
420 nmdc:mga09592_1325_c1 3300050508 Bacteria 19875
421 nmdc:mga09592_46867_c1 3300050508 Bacteria 2178
422 nmdc:mga09592_87527_c1 3300050508 Bacteria 2659
423 nmdc:mga0qj67_189408_c1 3300050509 Bacteria 1672
424 nmdc:mga06r32_106425_c1 3300050510 Bacteria 2756
425 nmdc:mga06r32_26639_c1 3300050510 Bacteria 5393
426 nmdc:mga06r32_39520_c1 3300050510 Bacteria 4477
427 nmdc:mga06r32_74966_c1 3300050510 Bacteria 3281
428 nmdc:mga08y16_26724_c1 3300050511 Bacteria 6082
429 nmdc:mga08y16_551536_c1 3300050511 Bacteria 1166
430 nmdc:mga0rr50_4776_c1 3300050513 Bacteria 7995
431 Ga0495601_0006347 3300053077 Bacteria 6909
432 Ga0495601_0015635 3300053077 Bacteria 4588
433 Ga0495595_0013421 3300053084 Bacteria 3461
434 Ga0495595_0033483 3300053084 Bacteria 2319
435 Ga0501084_0127818 3300054114 Bacteria 2139
436 Ga0501082_0000202 3300060353 Bacteria 52074
437 Ga0501082_0036876 3300060353 Bacteria 4212
438 2599103346 2597490356 Bacteria 7030811
439 2846953230 2846952575 Bacteria 6587527
440 2848860663 2848858292 Bacteria 7391279
441 2898795668 2898795034 Bacteria 4294459
442 2904434954 2904434214 Bacteria 6230908
443 8054566587 8054563764 Bacteria 5592885
444 8054567509 8054563764 Bacteria 5592885
445 Ga0436364_0791244
446 rootH1_10362135
447 Ga0065707_10011384
448 Ga0070658_10025736
449 Ga0070683_100137867
450 Ga0070683_100614817
451 Ga0070690_100001285
452 Ga0070690_100082118
453 Ga0068869_100006971
454 Ga0070680_100218347
455 Ga0070682_100217373
456 Ga0068868_100110066
457 Ga0070689_100002710
458 Ga0070689_100103954
459 Ga0070689_100149134
460 Ga0070689_100247175
461 Ga0070691_10037041
462 Ga0070661_100363077
463 Ga0070692_10049261
464 Ga0070692_10064038
465 Ga0070668_100451438
466 Ga0070675_100088213
467 Ga0070675_100291167
468 Ga0070675_100406829
469 Ga0070674_100262936
470 Ga0070673_100638087
471 Ga0070659_100050422
472 Ga0070714_100017355
473 Ga0070713_100056501
474 Ga0070710_10202872
475 Ga0070701_10131669
476 Ga0070711_100309894
477 Ga0070705_100038896
478 Ga0070700_100001566
479 Ga0070700_100326976
480 Ga0070700_100331292
481 Ga0070694_100010450
482 Ga0070694_100105544
483 Ga0070694_100160746
484 Ga0070694_100220713
485 Ga0070678_100029867
486 Ga0070678_100141254
487 Ga0070662_100130383
488 Ga0070681_10023435
489 Ga0070681_10255324
490 Ga0068867_100007546
491 Ga0070707_100120467
492 Ga0070707_100647764
493 Ga0070698_100017628
494 Ga0070699_100204595
495 Ga0070699_100259601
496 Ga0070679_100045173
497 Ga0070679_100181332
498 Ga0070679_100214137
499 Ga0070697_100303013
500 Ga0068853_100003905
501 Ga0068853_100413638
502 Ga0068853_100624687
503 Ga0070695_100009851
504 Ga0070695_100250631
505 Ga0070695_100251024
506 Ga0070696_100204497
507 Ga0070696_100483047
508 Ga0070693_100234387
509 Ga0070693_100371408
510 Ga0070665_100478402
511 Ga0070704_100012262
512 Ga0070704_100134083
513 Ga0070704_100143831
514 Ga0070704_100179765
515 Ga0070704_100274104
516 Ga0068855_100053404
517 Ga0068855_100148961
518 Ga0068855_100252250
519 Ga0068855_100261374
520 Ga0068855_100451518
521 Ga0070664_100235583
522 Ga0070664_100558307
523 Ga0068857_100118893
524 Ga0068857_100143991
525 Ga0068856_100093284
526 Ga0068856_100269613
527 Ga0068856_100299792
528 Ga0068856_100630284
529 Ga0070702_100000237
530 Ga0070702_100126981
531 Ga0070702_100434719
532 Ga0068852_100018400
533 Ga0068852_100129924
534 Ga0068852_100630562
535 Ga0068859_100013168
536 Ga0068859_100092838
537 Ga0068859_100106055
538 Ga0068864_100358464
539 Ga0068866_10002731
540 Ga0068866_10114527
541 Ga0068861_100729414
542 Ga0068863_100159056
543 Ga0068863_100518460
544 Ga0068863_100655913
545 Ga0068858_100039659
546 Ga0068858_100369953
547 Ga0068860_100317767
548 Ga0068862_100007234
549 Ga0068862_100118531
550 Ga0068862_100213762
551 Ga0081538_10050028
552 Ga0070717_10052286
553 Ga0070717_10095075
554 Ga0075365_10070467
555 Ga0075365_10134770
556 Ga0075368_10040451
557 Ga0075363_100028057
558 Ga0075364_10000241
559 Ga0075364_10026214
560 Ga0070712_100019293
561 Ga0075367_10117475
562 Ga0097621_100054741
563 Ga0075370_10047195
564 Ga0068871_100004155
565 Ga0068871_100229223
566 Ga0075428_100062352
567 Ga0075430_100015812
568 Ga0075431_100000345
569 Ga0075431_100092424
570 Ga0075434_100016926
571 Ga0075429_100008907
572 Ga0075429_100139138
573 Ga0068865_100018161
574 Ga0097620_100013168
575 Ga0097620_100092838
576 Ga0097620_100106056
577 Ga0075435_100066028
578 Ga0075435_100150535
579 Ga0075435_100305072
580 Ga0111539_10037614
581 Ga0111539_10122500
582 Ga0111539_11269060
583 Ga0105245_10001256
584 Ga0105245_10150347
585 Ga0105247_10145517
586 Ga0105247_10188450
587 Ga0114129_10016707
588 Ga0114129_10025697
589 Ga0114129_10315265
590 Ga0114129_10357984
591 Ga0105243_10002945
592 Ga0105243_10070629
593 Ga0105243_10096667
594 Ga0105241_10024794
595 Ga0105241_10165119
596 Ga0105242_10005883
597 Ga0105242_10129260
598 Ga0105248_10125263
599 Ga0105248_10126240
600 Ga0105248_10395056
601 Ga0105237_10052902
602 Ga0105237_10450660
603 Ga0105239_10084845
604 Ga0105239_10119348
605 Ga0105246_10228760
606 Ga0157371_10034562
607 Ga0157369_10127325
608 Ga0157369_10153003
609 Ga0157374_10412702
610 Ga0157378_10010883
611 Ga0157378_10163178
612 Ga0157378_10222064
613 Ga0163162_10203572
614 Ga0163162_10305949
615 Ga0163162_10504341
616 Ga0157372_10420866
617 Ga0157375_10053895
618 Ga0157375_10379800
619 Ga0163163_10459131
620 Ga0157380_10027371
621 Ga0157380_10037204
622 Ga0182008_10010870
623 Ga0157379_10025335
624 Ga0157379_10314638
625 Ga0157379_10580009
626 Ga0157376_10021851
627 Ga0157376_10120371
628 Ga0157376_10558426
629 Ga0163161_10294169
630 Ga0213872_10045318
631 Ga0213875_10019036
632 Ga0209025_1043690
633 Ga0207642_10037565
634 Ga0207642_10123692
635 Ga0207710_10161695
636 Ga0207685_10174906
637 Ga0207699_10327010
638 Ga0207645_10185288
639 Ga0207643_10008619
640 Ga0207705_10003527
641 Ga0207684_10150418
642 Ga0207654_10104047
643 Ga0207707_10027093
644 Ga0207707_10037546
645 Ga0207707_10357101
646 Ga0207693_10058627
647 Ga0207663_10029222
648 Ga0207663_10359291
649 Ga0207662_10496419
650 Ga0207652_10337141
651 Ga0207652_10342131
652 Ga0207652_10400188
653 Ga0207681_10668839
654 Ga0207694_10091126
655 Ga0207659_10313731
656 Ga0207687_10349989
657 Ga0207700_10409350
658 Ga0207664_10263985
659 Ga0207706_10180899
660 Ga0207706_10417738
661 Ga0207686_10075836
662 Ga0207686_10133399
663 Ga0207709_10039940
664 Ga0207709_10254106
665 Ga0207670_10025421
666 Ga0207670_10043420
667 Ga0207670_10047857
668 Ga0207670_10137729
669 Ga0207670_10464318
670 Ga0207669_10033605
671 Ga0207691_10286426
672 Ga0207689_10000519
673 Ga0207689_10021940
674 Ga0207667_10096026
675 Ga0207667_10178598
676 Ga0207667_10222543
677 Ga0207651_10434638
678 Ga0207712_10074792
679 Ga0207658_10433104
680 Ga0207677_10127689
681 Ga0207677_10376906
682 Ga0207703_10276705
683 Ga0207703_10405804
684 Ga0207639_10003694
685 Ga0207639_10564687
686 Ga0207708_10001346
687 Ga0207708_10140751
688 Ga0207708_10398505
689 Ga0207702_10036799
690 Ga0207641_10506765
691 Ga0207641_10612487
692 Ga0207648_10000461
693 Ga0207676_10385824
694 Ga0207674_10032514
695 Ga0207674_10479848
696 Ga0207675_100001140
697 Ga0207675_100044721
698 Ga0207675_100285103
699 Ga0207683_10213032
700 Ga0207698_10025235
701 Ga0207698_10143871
702 Ga0207698_10266466
703 Ga0207698_10594017
704 Ga0207428_10094110
705 Ga0268266_10318517
706 Ga0268266_10555677
707 Ga0268264_10161183
708 Ga0268264_10229342
709 Ga0268264_10492329
710 Ga0265318_10023172
711 Ga0265338_10025620
712 Ga0265320_10138470
713 Ga0265340_10036728
714 Ga0307408_100354090
715 Ga0307408_100796244
716 Ga0316575_10002967
717 Ga0316575_10014233
718 Ga0265314_10227927
719 Ga0316576_10120792
720 Ga0316578_10002596
721 Ga0307413_10266874
722 Ga0307412_10445078
723 Ga0373934_0214821
724 Ga0373923_0222566
725 Ga0373936_0097233
726 Ga0373936_0105099
727 Ga0373936_0165752
728 Ga0373954_0062680
729 Ga0373956_0018596
730 Ga0373942_0005350
731 Ga0373961_0019652
732 Ga0373924_0027155
733 Ga0373931_0275758
734 Ga0373935_0015849
735 Ga0373935_0054720
736 Ga0373935_0183844
737 Ga0373935_0448006
738 Ga0373927_0147416
739 Ga0373927_0253312
740 Ga0373933_0054448
741 Ga0373933_0162209
742 Ga0373933_0216323
743 Ga0373933_0265997
744 Ga0373947_0012320
745 Ga0373937_0001833
746 Ga0373937_0004886
747 Ga0373937_0016991
748 Ga0373937_0061173
749 Ga0373937_0077515
750 Ga0373937_0134153
751 Ga0373937_0354152
752 Ga0316584_0008110
753 Ga0373925_0066811
754 Ga0373925_0068203
755 Ga0373925_0093927
756 Ga0395898_0336745
757 Ga0316581_0013720
758 Ga0395901_0015644
759 Ga0395901_0018973
760 Ga0400483_177006
761 Ga0436365_0939926
762 Ga0436361_0529066
763 Ga0439441_001040
764 Ga0439441_017846
765 Ga0495592_0006664
766 Ga0495629_0431999
767 Ga0495651_0007983
768 Ga0495651_0224182
769 Ga0495653_0113420
770 Ga0495653_0174070
771 Ga0495582_0257296
772 Ga0495582_0314455
773 Ga0495639_0057187
774 Ga0495662_0007371
775 Ga0495664_0010758
776 Ga0495594_0303793
777 Ga0495608_0004164
778 Ga0495608_0038620
779 Ga0495618_0002241
780 Ga0495628_0004512
781 Ga0495628_0035410
782 Ga0495628_0085334
783 Ga0495630_0003325
784 Ga0495630_0389866
785 Ga0495652_0038487
786 Ga0495640_0019946
787 Ga0495640_0034762
788 Ga0495586_0000357
789 Ga0495586_0056110
790 Ga0495621_0013302
791 Ga0495645_0004710
792 Ga0495645_0026596
793 Ga0495667_0003174
794 Ga0495667_0016308
795 Ga0495667_0028696
796 Ga0495634_0009887
797 Ga0495635_0015581
798 Ga0495659_0145172
799 Ga0495657_0108505
800 Ga0495599_0003567
801 Ga0495599_0006228
802 Ga0495646_0176689
803 Ga0495658_0000597
804 Ga0495613_0003374
805 Ga0495624_0035269
806 Ga0495600_0008355
807 Ga0495600_0066393
808 Ga0495604_0005484
809 Ga0495604_0007829
810 Ga0495674_0097461
811 Ga0495674_0299821
812 Ga0495676_0063361
813 Ga0495680_0045703
814 Ga0495680_0074066
815 Ga0495680_0187059
816 Ga0495675_0005689
817 Ga0495675_0189240
818 Ga0495684_0038559
819 Ga0495593_0174966
820 Ga0495602_0015039
821 Ga0495602_0044926
822 Ga0495602_0476347
823 Ga0496102_0088234
824 Ga0496110_0275855
825 Ga0496112_0464017
826 Ga0496114_0330899
827 Ga0496119_0021389
828 Ga0496122_0065319
829 Ga0501032_0051044
830 Ga0501034_0082778
831 Ga0501038_0159835
832 Ga0501039_0056841
833 Ga0501039_0232265
834 Ga0501041_0078474
835 Ga0501047_0006890
836 Ga0501068_0269251
837 Ga0501071_0011462
838 Ga0501072_0008383
839 Ga0501073_0024485
840 Ga0501073_0155127
841 Ga0501073_0320907
842 Ga0501074_0163891
843 Ga0501075_0062647
844 Ga0501076_0061554
845 Ga0501079_0015839
846 Ga0501079_0483149
847 Ga0501080_0004531
848 Ga0501080_0231344
849 Ga0501080_0539104
850 Ga0501081_0112537
851 Ga0501083_0004063
852 Ga0501083_0108377
853 nmdc:mga03683_19664_c1
854 nmdc:mga03n38_13513_c1
855 nmdc:mga00v17_11498_c1
856 nmdc:mga00v17_141_c1
857 nmdc:mga0yw44_164435_c1
858 nmdc:mga0yw44_45121_c1
859 nmdc:mga06z11_104995_c1
860 nmdc:mga07m45_20769_c2
861 nmdc:mga05p37_1971_c1
862 nmdc:mga05p37_42418_c1
863 nmdc:mga05p37_752152_c1
864 nmdc:mga09592_1325_c1
865 nmdc:mga09592_46867_c1
866 nmdc:mga09592_87527_c1
867 nmdc:mga0qj67_189408_c1
868 nmdc:mga06r32_106425_c1
869 nmdc:mga06r32_26639_c1
870 nmdc:mga06r32_39520_c1
871 nmdc:mga06r32_74966_c1
872 nmdc:mga08y16_26724_c1
873 nmdc:mga08y16_551536_c1
874 nmdc:mga0rr50_4776_c1
875 Ga0495601_0006347
876 Ga0495601_0015635
877 Ga0495595_0013421
878 Ga0495595_0033483
879 Ga0501084_0127818
880 Ga0501082_0000202
881 Ga0501082_0036876
882 2599103346
883 2846953230
884 2848860663
885 2898795668
886 2904434954
887 8054566587
888 8054567509

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

42

233

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

48

288

0.89

PF08659

KR

KR domain

42

214

0.86

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

44

146

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4y98-assembly1.cif.gz_A crystal structure of ligd-apo form from sphingobium sp. strain syk-6 0.9484 4 166
5vps-assembly1.cif.gz_A crystal structure of an sdr from burkholderia ambifaria in complex with nadph with a tcep adduct 0.9402 1 239
5vps-assembly1.cif.gz_A crystal structure of an sdr from burkholderia ambifaria in complex with nadph with a tcep adduct 0.9365 1 239
5va8-assembly1.cif.gz_D crystal structure of short-chain dehydrogenase/reductase sdr from burkholderia phymatum in complex with nadp 0.9305 1 239
6jhb-assembly1.cif.gz_B-2 crystal structure of nadph and 4-hydroxyphenylpyruvic acid bound aerf from microcystis aeruginosa 0.9294 1 236
ID Description Score Start End Superfamily
4y98A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9484 4 166 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9482 71 171 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9418 5 176 3.40.50.720
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9378 65 234 3.40.50.720
af_Q53GQ0_49_275_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9308 7 174 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4R1IQH4-F1-model_v4 deleted 0.9714 1 238
AF-A0A1H1KN24-F1-model_v4 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family 0.9701 1 239 GO:0016491
AF-A0A7Z0FCU5-F1-model_v4 deleted 0.9693 96 238
AF-A0A1H1KN24-F1-model_v4 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family 0.9662 1 239 GO:0016491
AF-A0A6F8NHQ1-F1-model_v4 deleted 0.9647 1 238

Map