F445348

General Info

Members Datasets Scaffolds Average Seq Length
444 229 444 252

Family's Representative Sequence

Representative Sequence 3300046663|Ga0495635_0012339|Ga0495635_0012339_51_962
Length 303
Sequence MVDNANEWIWSHEGSDLLNDKKNTSLRERTHRRRHGLRWGNKISIESSAVSKIRRLGLRVALFITCYNDTLFPETGKAVVRLLERLGHMVEFPAGQTCCGQMHWNTGYQAEALPLVGRFVEQFRGAEAVVVPSSSCVAMMRDHYPKMAEEIGDQKLIAEVAELLPRVYEFSEFLTKRLGLEDVGAYYPHRVTYHASCHGLRNLGLGDGPLRLLRAVKGIDLVQIDHMEQCCGFGGTFAVKNADVSSAMLAEKVTAVLNTGAEACTACDNSCLMHIQGALHRQRTGVRTVHLAEILAGTEEATQ

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
125 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
126 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
127 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
128 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
129 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
141 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
148 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
149 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
150 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
154 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
159 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
160 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
163 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
164 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
165 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
166 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
167 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
168 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
171 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
174 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
175 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
176 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
177 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
184 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
193 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
214 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
215 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 0.9
Rhizosphere 98.2
Stem 0
Stem Tuber 0
Unclassified 0.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10044177 3300003320 Bacteria 2740
2 Ga0070658_10000539 3300005327 Bacteria 32873
3 Ga0070658_10057624 3300005327 Bacteria 3160
4 Ga0070658_10190352 3300005327 Bacteria 1729
5 Ga0070676_10076425 3300005328 Bacteria 2022
6 Ga0070683_100031781 3300005329 Bacteria 4804
7 Ga0070690_100130684 3300005330 Bacteria 1696
8 Ga0070670_100000733 3300005331 Bacteria 25485
9 Ga0068869_100058478 3300005334 Bacteria 2819
10 Ga0068869_100070580 3300005334 Bacteria 2585
11 Ga0070666_10365475 3300005335 Bacteria 1034
12 Ga0070680_100000970 3300005336 Bacteria 20307
13 Ga0070680_100039011 3300005336 Bacteria 3842
14 Ga0068868_100022631 3300005338 Bacteria 4747
15 Ga0068868_100029772 3300005338 Bacteria 4183
16 Ga0070660_100011080 3300005339 Bacteria 6394
17 Ga0070660_100019860 3300005339 Bacteria 4930
18 Ga0070660_100185599 3300005339 Bacteria 1684
19 Ga0070691_10136631 3300005341 Bacteria 1246
20 Ga0070661_100005575 3300005344 Bacteria 8674
21 Ga0070661_100036998 3300005344 Bacteria 3550
22 Ga0070661_100041921 3300005344 Bacteria 3340
23 Ga0070661_100107992 3300005344 Unclassified 2076
24 Ga0070661_100138917 3300005344 Bacteria 1830
25 Ga0070692_10040556 3300005345 Bacteria 2382
26 Ga0070668_100349892 3300005347 Bacteria 1250
27 Ga0070675_100005386 3300005354 Bacteria 9782
28 Ga0070675_100240427 3300005354 Bacteria 1582
29 Ga0070671_100075286 3300005355 Bacteria 2820
30 Ga0070671_100258251 3300005355 Bacteria 1481
31 Ga0070674_100067578 3300005356 Bacteria 2514
32 Ga0070674_100161841 3300005356 Bacteria 1698
33 Ga0070659_100007686 3300005366 Bacteria 7843
34 Ga0070659_100030867 3300005366 Bacteria 4148
35 Ga0070659_100068631 3300005366 Bacteria 2812
36 Ga0070667_100000267 3300005367 Bacteria 59181
37 Ga0070667_100040521 3300005367 Bacteria 3906
38 Ga0070714_100037670 3300005435 Bacteria 4065
39 Ga0070713_100047348 3300005436 Bacteria 3534
40 Ga0070700_100090398 3300005441 Bacteria 1997
41 Ga0070663_100125808 3300005455 Bacteria 1941
42 Ga0070663_100366353 3300005455 Bacteria 1170
43 Ga0070681_10001484 3300005458 Bacteria 20733
44 Ga0070681_10201498 3300005458 Bacteria 1908
45 Ga0070685_10230183 3300005466 Bacteria 1218
46 Ga0070679_100000515 3300005530 Bacteria 32892
47 Ga0070679_100027842 3300005530 Bacteria 5568
48 Ga0070684_100003163 3300005535 Bacteria 12304
49 Ga0070684_100048032 3300005535 Bacteria 3702
50 Ga0068853_100000656 3300005539 Bacteria 23758
51 Ga0068853_100004682 3300005539 Bacteria 10611
52 Ga0068853_100020926 3300005539 Bacteria 5443
53 Ga0068853_100164285 3300005539 Bacteria 2005
54 Ga0070665_100011020 3300005548 Bacteria 9138
55 Ga0070665_100022088 3300005548 Bacteria 6401
56 Ga0070665_100817229 3300005548 Bacteria 945
57 Ga0068855_100002084 3300005563 Bacteria 24762
58 Ga0068855_100012577 3300005563 Bacteria 10215
59 Ga0068855_100036589 3300005563 Bacteria 5841
60 Ga0068855_100045723 3300005563 Bacteria 5177
61 Ga0070664_100324234 3300005564 Bacteria 1396
62 Ga0070664_100370154 3300005564 Bacteria 1306
63 Ga0068857_100003203 3300005577 Bacteria 13575
64 Ga0068857_100005858 3300005577 Bacteria 10491
65 Ga0068857_100037321 3300005577 Bacteria 4304
66 Ga0068857_100041149 3300005577 Bacteria 4098
67 Ga0068857_100070535 3300005577 Bacteria 3113
68 Ga0068857_100219483 3300005577 Unclassified 1736
69 Ga0068857_100349883 3300005577 Bacteria 1368
70 Ga0068854_100012992 3300005578 Bacteria 5457
71 Ga0068854_100073400 3300005578 Bacteria 2507
72 Ga0068854_100179428 3300005578 Bacteria 1653
73 Ga0068856_100000382 3300005614 Bacteria 48530
74 Ga0068856_100003704 3300005614 Bacteria 15336
75 Ga0068856_100008038 3300005614 Bacteria 10298
76 Ga0068856_100009954 3300005614 Bacteria 9232
77 Ga0068856_100013765 3300005614 Bacteria 7820
78 Ga0068856_100762175 3300005614 Bacteria 988
79 Ga0070702_100027753 3300005615 Bacteria 3058
80 Ga0070702_100108448 3300005615 Bacteria 1716
81 Ga0068852_100000003 3300005616 Bacteria 246525
82 Ga0068852_100000361 3300005616 Bacteria 30684
83 Ga0068852_100004797 3300005616 Bacteria 9604
84 Ga0068852_100008729 3300005616 Bacteria 7492
85 Ga0068852_100113086 3300005616 Bacteria 2472
86 Ga0068852_100128742 3300005616 Unclassified 2328
87 Ga0068852_100152345 3300005616 Bacteria 2151
88 Ga0068852_100461784 3300005616 Bacteria 1259
89 Ga0068852_100536901 3300005616 Bacteria 1168
90 Ga0068859_100001218 3300005617 Bacteria 26254
91 Ga0068864_100000506 3300005618 Bacteria 33582
92 Ga0068864_100029514 3300005618 Bacteria 4647
93 Ga0068861_100011350 3300005719 Bacteria 6188
94 Ga0068851_10046519 3300005834 Bacteria 2195
95 Ga0068851_10056436 3300005834 Bacteria 2003
96 Ga0068851_10068082 3300005834 Unclassified 1837
97 Ga0068863_100000898 3300005841 Bacteria 29914
98 Ga0068863_100021413 3300005841 Bacteria 6170
99 Ga0068858_100133295 3300005842 Bacteria 2330
100 Ga0068860_100001482 3300005843 Bacteria 25349
101 Ga0068860_100253708 3300005843 Bacteria 1713
102 Ga0068862_100181698 3300005844 Bacteria 1888
103 Ga0068862_100523369 3300005844 Bacteria 1129
104 Ga0081455_10058756 3300005937 Bacteria 3251
105 Ga0070717_10485480 3300006028 Bacteria 1116
106 Ga0070712_100060660 3300006175 Bacteria 2669
107 Ga0070712_100454634 3300006175 Unclassified 1067
108 Ga0097621_100151102 3300006237 Bacteria 1991
109 Ga0068871_100009238 3300006358 Bacteria 7131
110 Ga0075428_100014021 3300006844 Bacteria 8920
111 Ga0075430_100000801 3300006846 Bacteria 24432
112 Ga0075433_10110685 3300006852 Bacteria 2437
113 Ga0075433_10251498 3300006852 Bacteria 1568
114 Ga0075429_100017147 3300006880 Bacteria 6263
115 Ga0075429_100034989 3300006880 Bacteria 4366
116 Ga0097620_100001218 3300006931 Bacteria 26254
117 Ga0075435_100004415 3300007076 Bacteria 9655
118 Ga0105240_10000249 3300009093 Bacteria 107168
119 Ga0105240_10001474 3300009093 Bacteria 40151
120 Ga0105240_10005280 3300009093 Bacteria 19287
121 Ga0105240_10010390 3300009093 Bacteria 13084
122 Ga0105240_10027524 3300009093 Bacteria 7441
123 Ga0105240_10070392 3300009093 Bacteria 4327
124 Ga0105240_10422511 3300009093 Unclassified 1497
125 Ga0105240_10563960 3300009093 Bacteria 1258
126 Ga0105240_10577918 3300009093 Unclassified 1240
127 Ga0105240_10781787 3300009093 Bacteria 1035
128 Ga0111539_10000079 3300009094 Bacteria 97459
129 Ga0111539_10020987 3300009094 Bacteria 8042
130 Ga0105245_10009846 3300009098 Bacteria 8327
131 Ga0105245_10071449 3300009098 Bacteria 3152
132 Ga0105247_10035659 3300009101 Bacteria 3033
133 Ga0114129_10155222 3300009147 Bacteria 3131
134 Ga0114129_10618374 3300009147 Bacteria 1401
135 Ga0105243_10045866 3300009148 Bacteria 3436
136 Ga0105243_10334012 3300009148 Bacteria 1386
137 Ga0105241_10000036 3300009174 Bacteria 115495
138 Ga0105241_10010035 3300009174 Bacteria 6954
139 Ga0105241_10091294 3300009174 Bacteria 2403
140 Ga0105241_10208036 3300009174 Bacteria 1638
141 Ga0105242_10230485 3300009176 Bacteria 1660
142 Ga0105248_10018888 3300009177 Bacteria 7622
143 Ga0105248_10045965 3300009177 Bacteria 4894
144 Ga0105248_10066724 3300009177 Bacteria 4039
145 Ga0105237_10004629 3300009545 Bacteria 15849
146 Ga0105237_10034835 3300009545 Bacteria 5094
147 Ga0105238_10000088 3300009551 Bacteria 103463
148 Ga0105238_10002730 3300009551 Bacteria 17576
149 Ga0105238_10019475 3300009551 Bacteria 6911
150 Ga0105238_10250561 3300009551 Bacteria 1749
151 Ga0105238_10302697 3300009551 Bacteria 1583
152 Ga0105238_11010342 3300009551 Bacteria 853
153 Ga0105249_10044956 3300009553 Bacteria 4016
154 Ga0105249_10059848 3300009553 Bacteria 3494
155 Ga0105249_10405104 3300009553 Bacteria 1395
156 Ga0105239_10004026 3300010375 Bacteria 17797
157 Ga0105239_10053772 3300010375 Bacteria 4415
158 Ga0105239_10311886 3300010375 Bacteria 1773
159 Ga0105239_10672366 3300010375 Bacteria 1183
160 Ga0105239_10702303 3300010375 Bacteria 1156
161 Ga0105239_11381529 3300010375 Bacteria 813
162 Ga0105246_10001970 3300011119 Bacteria 12386
163 Ga0105246_10708418 3300011119 Bacteria 883
164 Ga0157373_10049290 3300013100 Bacteria 3001
165 Ga0157373_10056515 3300013100 Bacteria 2787
166 Ga0157371_10133516 3300013102 Bacteria 1766
167 Ga0157371_10170514 3300013102 Unclassified 1555
168 Ga0157370_10000001 3300013104 Bacteria 529517
169 Ga0157370_10007915 3300013104 Bacteria 11513
170 Ga0157370_10115893 3300013104 Bacteria 2503
171 Ga0157370_10290312 3300013104 Bacteria 1510
172 Ga0157369_10000073 3300013105 Bacteria 139083
173 Ga0157369_10008409 3300013105 Bacteria 11834
174 Ga0157369_10019484 3300013105 Bacteria 7592
175 Ga0157369_10041065 3300013105 Bacteria 5050
176 Ga0157369_10072462 3300013105 Bacteria 3697
177 Ga0157369_10077847 3300013105 Bacteria 3554
178 Ga0157369_10151103 3300013105 Bacteria 2454
179 Ga0157369_10184120 3300013105 Bacteria 2197
180 Ga0157369_10393195 3300013105 Bacteria 1438
181 Ga0157374_10008847 3300013296 Bacteria 8619
182 Ga0157374_10023740 3300013296 Bacteria 5489
183 Ga0157374_10069826 3300013296 Bacteria 3309
184 Ga0157374_10133282 3300013296 Bacteria 2406
185 Ga0157374_10199690 3300013296 Bacteria 1958
186 Ga0157374_10245729 3300013296 Bacteria 1760
187 Ga0157378_10031245 3300013297 Bacteria 4703
188 Ga0157378_10425785 3300013297 Bacteria 1313
189 Ga0163162_10001538 3300013306 Bacteria 21535
190 Ga0163162_10086051 3300013306 Bacteria 3221
191 Ga0163162_10109277 3300013306 Bacteria 2862
192 Ga0163162_10315676 3300013306 Bacteria 1695
193 Ga0157372_10000045 3300013307 Bacteria 151277
194 Ga0157372_10000866 3300013307 Bacteria 32840
195 Ga0157372_10031534 3300013307 Bacteria 5803
196 Ga0157372_10031566 3300013307 Bacteria 5800
197 Ga0157372_10055235 3300013307 Bacteria 4434
198 Ga0157372_10116886 3300013307 Bacteria 3058
199 Ga0157372_10140831 3300013307 Bacteria 2778
200 Ga0157372_10722742 3300013307 Bacteria 1158
201 Ga0157375_10040225 3300013308 Bacteria 4505
202 Ga0157375_10386928 3300013308 Bacteria 1565
203 Ga0163163_10001028 3300014325 Bacteria 23642
204 Ga0157379_10000305 3300014968 Bacteria 38880
205 Ga0157379_10853213 3300014968 Bacteria 862
206 Ga0157376_10001618 3300014969 Bacteria 14899
207 Ga0157376_10091215 3300014969 Bacteria 2639
208 Ga0157376_10382664 3300014969 Bacteria 1356
209 Ga0213872_10000206 3300021361 Bacteria 52479
210 Ga0213872_10034674 3300021361 Bacteria 2309
211 Ga0207710_10002050 3300025900 Bacteria 9571
212 Ga0207680_10041828 3300025903 Bacteria 2677
213 Ga0207647_10017102 3300025904 Bacteria 4937
214 Ga0207647_10158365 3300025904 Bacteria 1321
215 Ga0207645_10045564 3300025907 Bacteria 2802
216 Ga0207705_10001124 3300025909 Bacteria 21762
217 Ga0207705_10013525 3300025909 Bacteria 5888
218 Ga0207705_10057148 3300025909 Bacteria 2814
219 Ga0207705_10106303 3300025909 Bacteria 2070
220 Ga0207654_10000052 3300025911 Bacteria 84058
221 Ga0207654_10001505 3300025911 Bacteria 12289
222 Ga0207654_10015290 3300025911 Bacteria 3980
223 Ga0207654_10244586 3300025911 Bacteria 1200
224 Ga0207707_10050422 3300025912 Unclassified 3626
225 Ga0207695_10000026 3300025913 Bacteria 624558
226 Ga0207695_10000538 3300025913 Bacteria 79042
227 Ga0207695_10000995 3300025913 Bacteria 50150
228 Ga0207695_10002072 3300025913 Bacteria 30560
229 Ga0207695_10015218 3300025913 Bacteria 9072
230 Ga0207695_10122012 3300025913 Bacteria 2573
231 Ga0207695_10298885 3300025913 Unclassified 1501
232 Ga0207695_10319261 3300025913 Bacteria 1443
233 Ga0207695_10420994 3300025913 Unclassified 1220
234 Ga0207671_10001289 3300025914 Bacteria 29494
235 Ga0207671_10001318 3300025914 Bacteria 29039
236 Ga0207657_10001469 3300025919 Bacteria 25204
237 Ga0207657_10002508 3300025919 Bacteria 19865
238 Ga0207657_10131402 3300025919 Bacteria 2052
239 Ga0207649_10002426 3300025920 Bacteria 10438
240 Ga0207649_10061054 3300025920 Bacteria 2371
241 Ga0207649_10186843 3300025920 Bacteria 1454
242 Ga0207652_10001691 3300025921 Bacteria 19300
243 Ga0207694_10000028 3300025924 Bacteria 242395
244 Ga0207694_10004122 3300025924 Bacteria 11415
245 Ga0207694_10004444 3300025924 Bacteria 10959
246 Ga0207694_10007274 3300025924 Bacteria 8401
247 Ga0207650_10020580 3300025925 Bacteria 4655
248 Ga0207659_10040133 3300025926 Bacteria 3270
249 Ga0207687_10024009 3300025927 Bacteria 4068
250 Ga0207687_10613249 3300025927 Bacteria 918
251 Ga0207664_10179714 3300025929 Bacteria 1816
252 Ga0207644_10012042 3300025931 Bacteria 5735
253 Ga0207644_10136807 3300025931 Bacteria 1882
254 Ga0207711_10020128 3300025941 Bacteria 5560
255 Ga0207689_10036443 3300025942 Bacteria 4083
256 Ga0207661_10037116 3300025944 Bacteria 3809
257 Ga0207661_10198158 3300025944 Unclassified 1764
258 Ga0207667_10000079 3300025949 Bacteria 163341
259 Ga0207667_10001066 3300025949 Bacteria 34750
260 Ga0207667_10005791 3300025949 Bacteria 15077
261 Ga0207667_10022234 3300025949 Bacteria 7010
262 Ga0207667_10136375 3300025949 Bacteria 2527
263 Ga0207668_10154479 3300025972 Bacteria 1781
264 Ga0207668_10167670 3300025972 Bacteria 1719
265 Ga0207640_10014244 3300025981 Bacteria 4574
266 Ga0207658_10000163 3300025986 Bacteria 70810
267 Ga0207658_10032133 3300025986 Bacteria 3733
268 Ga0207677_10000076 3300026023 Bacteria 81764
269 Ga0207677_10245112 3300026023 Bacteria 1452
270 Ga0207639_10000043 3300026041 Bacteria 140295
271 Ga0207639_10011559 3300026041 Bacteria 6134
272 Ga0207639_10013689 3300026041 Bacteria 5686
273 Ga0207639_10206600 3300026041 Bacteria 1688
274 Ga0207678_10002507 3300026067 Bacteria 16711
275 Ga0207678_10005634 3300026067 Bacteria 11194
276 Ga0207708_10244390 3300026075 Bacteria 1444
277 Ga0207708_10250930 3300026075 Bacteria 1426
278 Ga0207702_10000834 3300026078 Bacteria 32311
279 Ga0207702_10006030 3300026078 Bacteria 10518
280 Ga0207702_10037588 3300026078 Bacteria 4053
281 Ga0207702_10120334 3300026078 Bacteria 2349
282 Ga0207702_10495178 3300026078 Bacteria 1191
283 Ga0207641_10018780 3300026088 Bacteria 5669
284 Ga0207676_10005173 3300026095 Bacteria 9230
285 Ga0207676_10414878 3300026095 Bacteria 1261
286 Ga0207674_10000408 3300026116 Bacteria 55815
287 Ga0207674_10001795 3300026116 Bacteria 27367
288 Ga0207674_10005564 3300026116 Bacteria 14940
289 Ga0207674_10080294 3300026116 Bacteria 3265
290 Ga0207674_10084460 3300026116 Bacteria 3173
291 Ga0207675_100378978 3300026118 Bacteria 1391
292 Ga0207698_10000046 3300026142 Bacteria 93146
293 Ga0207698_10000057 3300026142 Bacteria 78248
294 Ga0207698_10610251 3300026142 Bacteria 1076
295 Ga0207698_10614283 3300026142 Unclassified 1073
296 Ga0207428_10048792 3300027907 Bacteria 3395
297 Ga0268266_10025029 3300028379 Bacteria 5081
298 Ga0268266_10108382 3300028379 Bacteria 2458
299 Ga0268264_10001422 3300028381 Bacteria 22402
300 Ga0265318_10105679 3300028577 Bacteria 1035
301 Ga0265338_10005165 3300028800 Bacteria 17160
302 Ga0265338_10053983 3300028800 Bacteria 3588
303 Ga0265338_10077320 3300028800 Unclassified 2814
304 Ga0265338_10117838 3300028800 Bacteria 2123
305 Ga0265338_10201580 3300028800 Bacteria 1500
306 Ga0265330_10000702 3300031235 Bacteria 21273
307 Ga0265330_10029575 3300031235 Bacteria 2463
308 Ga0265328_10004478 3300031239 Bacteria 6069
309 Ga0265320_10022715 3300031240 Bacteria 3351
310 Ga0265325_10123847 3300031241 Bacteria 1243
311 Ga0265340_10016287 3300031247 Bacteria 3851
312 Ga0265339_10000041 3300031249 Bacteria 119820
313 Ga0265339_10067882 3300031249 Bacteria 1906
314 Ga0265316_10019533 3300031344 Bacteria 5791
315 Ga0307408_100019318 3300031548 Bacteria 4587
316 Ga0307408_100068739 3300031548 Bacteria 2609
317 Ga0265314_10329397 3300031711 Unclassified 847
318 Ga0265342_10005577 3300031712 Bacteria 9544
319 Ga0265342_10011746 3300031712 Bacteria 5972
320 Ga0265342_10116479 3300031712 Bacteria 1508
321 Ga0307405_10134910 3300031731 Bacteria 1712
322 Ga0307410_10422918 3300031852 Bacteria 1081
323 Ga0307412_10095718 3300031911 Bacteria 2088
324 Ga0307416_100061170 3300032002 Bacteria 3071
325 Ga0307416_100117733 3300032002 Bacteria 2359
326 Ga0307411_10032289 3300032005 Bacteria 3233
327 Ga0307411_10123930 3300032005 Bacteria 1875
328 Ga0307411_10432625 3300032005 Bacteria 1096
329 Ga0307415_100045381 3300032126 Bacteria 2946
330 Ga0307510_10051359 3300033180 Bacteria 4361
331 Ga0373956_0001673 3300035119 Bacteria 9131
332 Ga0373935_0417135 3300035692 Bacteria 966
333 Ga0373927_0000367 3300035695 Bacteria 35127
334 Ga0373937_0188269 3300036401 Bacteria 1939
335 Ga0373937_0256063 3300036401 Bacteria 1650
336 Ga0373937_0606900 3300036401 Bacteria 1039
337 Ga0395899_0000004 3300037312 Bacteria 874267
338 Ga0436365_0069560 3300039437 Bacteria 1434
339 Ga0436360_1307511 3300039438 Bacteria 1380
340 Ga0436361_0079738 3300039447 Bacteria 122121
341 Ga0436361_0868224 3300039447 Bacteria 5551
342 Ga0439450_001420 3300042008 Bacteria 3501
343 Ga0439464_0000455 3300042439 Bacteria 8184
344 Ga0466966_0010963 3300044684 Bacteria 6016
345 Ga0466966_0065634 3300044684 Bacteria 2282
346 Ga0466966_0091515 3300044684 Bacteria 1888
347 Ga0466963_0093649 3300044694 Bacteria 2048
348 Ga0466963_0163493 3300044694 Bacteria 1550
349 Ga0466970_0028269 3300044765 Bacteria 2945
350 Ga0466970_0077723 3300044765 Bacteria 1790
351 Ga0466960_0220721 3300044901 Bacteria 1043
352 Ga0466959_0071013 3300045049 Bacteria 2522
353 Ga0466958_0034548 3300045836 Bacteria 3017
354 Ga0466967_0040718 3300045976 Bacteria 4001
355 Ga0495617_112339 3300046452 Bacteria 881
356 Ga0495592_0043611 3300046454 Bacteria 3355
357 Ga0495590_0059006 3300046457 Bacteria 1342
358 Ga0495629_0006459 3300046459 Bacteria 8685
359 Ga0495629_0009261 3300046459 Bacteria 7204
360 Ga0495651_0018991 3300046462 Bacteria 5326
361 Ga0495653_0057503 3300046463 Bacteria 2959
362 Ga0495580_0070973 3300046472 Bacteria 2433
363 Ga0495582_0007892 3300046473 Bacteria 5883
364 Ga0495639_0009378 3300046475 Bacteria 4197
365 Ga0495662_0004309 3300046476 Bacteria 7153
366 Ga0495664_0027141 3300046477 Bacteria 3337
367 Ga0495664_0121623 3300046477 Bacteria 1579
368 Ga0495594_0000486 3300046499 Bacteria 20257
369 Ga0495594_0000999 3300046499 Bacteria 14708
370 Ga0495594_0027891 3300046499 Bacteria 3044
371 Ga0495606_0043318 3300046507 Bacteria 3003
372 Ga0495618_0098390 3300046514 Bacteria 1872
373 Ga0495628_0035762 3300046516 Bacteria 3990
374 Ga0495644_0000066 3300046523 Bacteria 51723
375 Ga0495652_0007845 3300046529 Bacteria 9801
376 Ga0495665_0000234 3300046531 Bacteria 27908
377 Ga0495640_0013406 3300046533 Bacteria 6227
378 Ga0495609_0012636 3300046538 Bacteria 4004
379 Ga0495609_0036639 3300046538 Bacteria 2214
380 Ga0495645_0055579 3300046543 Bacteria 2874
381 Ga0495633_0091932 3300046558 Bacteria 1410
382 Ga0495634_0011675 3300046642 Bacteria 6389
383 Ga0495625_0010808 3300046660 Bacteria 7513
384 Ga0495635_0012339 3300046663 Bacteria 5987
385 Ga0495623_0122214 3300046679 Bacteria 1566
386 Ga0495669_0002295 3300046684 Bacteria 7848
387 Ga0495613_0000754 3300046689 Bacteria 25353
388 Ga0495624_0025524 3300046690 Bacteria 3878
389 Ga0495600_0010396 3300046809 Bacteria 5778
390 Ga0495604_0009517 3300047317 Bacteria 7681
391 Ga0495604_0087709 3300047317 Bacteria 2317
392 Ga0495674_0009216 3300047319 Bacteria 9379
393 Ga0495674_0093560 3300047319 Bacteria 2565
394 Ga0495676_0011191 3300047321 Bacteria 8110
395 Ga0495680_0046463 3300047322 Bacteria 3423
396 Ga0495680_0126782 3300047322 Bacteria 1879
397 Ga0495677_0039042 3300047445 Bacteria 1735
398 Ga0495614_0008748 3300048089 Bacteria 4495
399 Ga0496104_0019215 3300048907 Bacteria 6248
400 Ga0496112_0491709 3300048915 Bacteria 1163
401 Ga0496114_0045079 3300048917 Bacteria 3662
402 Ga0496115_0262157 3300048918 Bacteria 1421
403 Ga0501031_0093630 3300049568 Bacteria 1960
404 Ga0501032_0006022 3300049569 Bacteria 8947
405 Ga0501033_0009230 3300049570 Bacteria 7595
406 Ga0501033_0118494 3300049570 Bacteria 1923
407 Ga0501034_0002471 3300049571 Bacteria 22256
408 Ga0501036_0014505 3300049572 Bacteria 6563
409 Ga0501037_0001861 3300049573 Bacteria 15321
410 Ga0501037_0031220 3300049573 Bacteria 3934
411 Ga0501038_0036659 3300049574 Bacteria 4302
412 Ga0501038_0207157 3300049574 Bacteria 1571
413 Ga0501041_0001984 3300049577 Bacteria 11499
414 Ga0501043_0002575 3300049579 Bacteria 15339
415 Ga0501046_0003608 3300049580 Bacteria 14173
416 Ga0501047_0005581 3300049581 Bacteria 11844
417 Ga0501047_0034719 3300049581 Bacteria 4868
418 Ga0501047_0057855 3300049581 Bacteria 3747
419 Ga0501048_0080863 3300049582 Bacteria 2292
420 Ga0501068_0003473 3300049584 Bacteria 8490
421 Ga0501070_0079274 3300049586 Bacteria 2717
422 Ga0501071_0000589 3300049587 Bacteria 18773
423 Ga0501072_0004241 3300049588 Bacteria 10869
424 Ga0501073_0031448 3300049589 Bacteria 3787
425 Ga0501073_0057085 3300049589 Bacteria 2729
426 Ga0501074_0039385 3300049590 Bacteria 3423
427 Ga0501076_0063928 3300049592 Bacteria 2932
428 Ga0501077_0047711 3300049593 Bacteria 2721
429 Ga0501079_0006022 3300049741 Bacteria 9085
430 Ga0501083_0063527 3300049744 Bacteria 2462
431 Ga0501035_0003402 3300049822 Bacteria 15219
432 Ga0501044_0000895 3300049823 Bacteria 36008
433 Ga0501044_0158249 3300049823 Bacteria 2244
434 nmdc:mga05p37_109284_c1 3300050507 Bacteria 3402
435 nmdc:mga05p37_13502_c1 3300050507 Bacteria 9789
436 nmdc:mga05p37_73013_c1 3300050507 Bacteria 4222
437 nmdc:mga09592_143495_c1 3300050508 Bacteria 2059
438 nmdc:mga0qj67_58857_c1 3300050509 Bacteria 3046
439 nmdc:mga06r32_20464_c1 3300050510 Bacteria 6094
440 nmdc:mga08y16_581_c1 3300050511 Bacteria 34004
441 nmdc:mga08y16_92195_c1 3300050511 Bacteria 3157
442 Ga0500595_014366 3300053119 Bacteria 3004
443 Ga0501082_0009221 3300060353 Bacteria 8505
444 Ga0530510_0076711 3300061734 Bacteria 2429

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005330 Ga0070690_100130684 Ga0070690_1001306842 242
2 3300005334 Ga0068869_100058478 Ga0068869_1000584782 242
3 3300005338 Ga0068868_100022631 Ga0068868_1000226312 242
4 3300005344 Ga0070661_100138917 Ga0070661_1001389172 242
5 3300005345 Ga0070692_10040556 Ga0070692_100405562 242
6 3300005354 Ga0070675_100240427 Ga0070675_1002404272 242
7 3300005355 Ga0070671_100258251 Ga0070671_1002582512 242
8 3300005356 Ga0070674_100161841 Ga0070674_1001618412 242
9 3300005366 Ga0070659_100068631 Ga0070659_1000686312 242
10 3300005441 Ga0070700_100090398 Ga0070700_1000903982 242
11 3300005466 Ga0070685_10230183 Ga0070685_102301831 242
12 3300005578 Ga0068854_100073400 Ga0068854_1000734002 242
13 3300005615 Ga0070702_100027753 Ga0070702_1000277533 242
14 3300005615 Ga0070702_100108448 Ga0070702_1001084482 242
15 3300005616 Ga0068852_100113086 Ga0068852_1001130862 242
16 3300005719 Ga0068861_100011350 Ga0068861_1000113505 242
17 3300005834 Ga0068851_10046519 Ga0068851_100465192 242
18 3300005842 Ga0068858_100133295 Ga0068858_1001332952 242
19 3300005843 Ga0068860_100253708 Ga0068860_1002537082 242
20 3300005844 Ga0068862_100523369 Ga0068862_1005233691 242
21 3300006175 Ga0070712_100060660 Ga0070712_1000606602 242
22 3300006852 Ga0075433_10251498 Ga0075433_102514982 242
23 3300009098 Ga0105245_10071449 Ga0105245_100714491 242
24 3300009148 Ga0105243_10045866 Ga0105243_100458662 242
25 3300009148 Ga0105243_10334012 Ga0105243_103340122 242
26 3300009176 Ga0105242_10230485 Ga0105242_102304852 242
27 3300009177 Ga0105248_10066724 Ga0105248_100667242 242
28 3300009553 Ga0105249_10044956 Ga0105249_100449563 242
29 3300009553 Ga0105249_10059848 Ga0105249_100598482 242
30 3300010375 Ga0105239_10311886 Ga0105239_103118862 242
31 3300011119 Ga0105246_10708418 Ga0105246_107084182 242
32 3300013297 Ga0157378_10425785 Ga0157378_104257852 242
33 3300013306 Ga0163162_10086051 Ga0163162_100860513 242
34 3300013308 Ga0157375_10386928 Ga0157375_103869281 242
35 3300026075 Ga0207708_10244390 Ga0207708_102443902 242
36 3300050509 nmdc:mga0qj67_58857_c1 nmdc:mga0qj67_58857_c1_1825_2628 242
37 3300046462 Ga0495651_0018991 Ga0495651_0018991_3673_4410 243
38 3300036401 Ga0373937_0188269 Ga0373937_0188269_158_892 244
39 3300046477 Ga0495664_0121623 Ga0495664_0121623_525_1259 244
40 3300047322 Ga0495680_0126782 Ga0495680_0126782_894_1628 244
41 3300005328 Ga0070676_10076425 Ga0070676_100764252 245
42 3300005354 Ga0070675_100005386 Ga0070675_1000053866 245
43 3300005937 Ga0081455_10058756 Ga0081455_100587561 245
44 3300009094 Ga0111539_10020987 Ga0111539_100209874 245
45 3300025907 Ga0207645_10045564 Ga0207645_100455642 245
46 3300025926 Ga0207659_10040133 Ga0207659_100401332 245
47 3300025972 Ga0207668_10154479 Ga0207668_101544792 245
48 3300026075 Ga0207708_10250930 Ga0207708_102509301 245
49 3300026118 Ga0207675_100378978 Ga0207675_1003789782 245
50 3300027907 Ga0207428_10048792 Ga0207428_100487924 245
51 3300033180 Ga0307510_10051359 Ga0307510_100513592 245
52 3300050511 nmdc:mga08y16_92195_c1 nmdc:mga08y16_92195_c1_1404_2141 245
53 3300005327 Ga0070658_10000539 Ga0070658_100005396 246
54 3300005327 Ga0070658_10057624 Ga0070658_100576243 246
55 3300005327 Ga0070658_10190352 Ga0070658_101903522 246
56 3300005329 Ga0070683_100031781 Ga0070683_1000317815 246
57 3300005336 Ga0070680_100039011 Ga0070680_1000390113 246
58 3300005339 Ga0070660_100019860 Ga0070660_1000198605 246
59 3300005339 Ga0070660_100185599 Ga0070660_1001855991 246
60 3300005341 Ga0070691_10136631 Ga0070691_101366312 246
61 3300005344 Ga0070661_100005575 Ga0070661_1000055753 246
62 3300005344 Ga0070661_100041921 Ga0070661_1000419212 246
63 3300005347 Ga0070668_100349892 Ga0070668_1003498921 246
64 3300005366 Ga0070659_100007686 Ga0070659_1000076869 246
65 3300005366 Ga0070659_100030867 Ga0070659_1000308674 246
66 3300005367 Ga0070667_100040521 Ga0070667_1000405213 246
67 3300005436 Ga0070713_100047348 Ga0070713_1000473481 246
68 3300005455 Ga0070663_100125808 Ga0070663_1001258081 246
69 3300005458 Ga0070681_10201498 Ga0070681_102014982 246
70 3300005530 Ga0070679_100027842 Ga0070679_1000278426 246
71 3300005539 Ga0068853_100004682 Ga0068853_1000046822 246
72 3300005548 Ga0070665_100022088 Ga0070665_1000220884 246
73 3300005548 Ga0070665_100817229 Ga0070665_1008172291 246
74 3300005563 Ga0068855_100036589 Ga0068855_1000365892 246
75 3300005563 Ga0068855_100045723 Ga0068855_1000457234 246
76 3300005564 Ga0070664_100324234 Ga0070664_1003242342 246
77 3300005577 Ga0068857_100003203 Ga0068857_1000032036 246
78 3300005577 Ga0068857_100349883 Ga0068857_1003498832 246
79 3300005614 Ga0068856_100013765 Ga0068856_1000137655 246
80 3300005614 Ga0068856_100762175 Ga0068856_1007621751 246
81 3300005616 Ga0068852_100008729 Ga0068852_1000087292 246
82 3300005616 Ga0068852_100128742 Ga0068852_1001287422 246
83 3300005616 Ga0068852_100461784 Ga0068852_1004617842 246
84 3300005618 Ga0068864_100029514 Ga0068864_1000295142 246
85 3300005834 Ga0068851_10068082 Ga0068851_100680822 246
86 3300005841 Ga0068863_100021413 Ga0068863_1000214132 246
87 3300006028 Ga0070717_10485480 Ga0070717_104854801 246
88 3300009093 Ga0105240_10005280 Ga0105240_1000528014 246
89 3300009093 Ga0105240_10070392 Ga0105240_100703922 246
90 3300009093 Ga0105240_10422511 Ga0105240_104225112 246
91 3300009093 Ga0105240_10563960 Ga0105240_105639601 246
92 3300009093 Ga0105240_10781787 Ga0105240_107817871 246
93 3300009174 Ga0105241_10208036 Ga0105241_102080362 246
94 3300009177 Ga0105248_10018888 Ga0105248_100188882 246
95 3300009177 Ga0105248_10045965 Ga0105248_100459652 246
96 3300009551 Ga0105238_10019475 Ga0105238_100194756 246
97 3300009551 Ga0105238_11010342 Ga0105238_110103421 246
98 3300010375 Ga0105239_10702303 Ga0105239_107023031 246
99 3300010375 Ga0105239_11381529 Ga0105239_113815291 246
100 3300013100 Ga0157373_10049290 Ga0157373_100492902 246
101 3300013104 Ga0157370_10115893 Ga0157370_101158932 246
102 3300013104 Ga0157370_10290312 Ga0157370_102903122 246
103 3300013105 Ga0157369_10019484 Ga0157369_100194845 246
104 3300013105 Ga0157369_10077847 Ga0157369_100778472 246
105 3300013105 Ga0157369_10184120 Ga0157369_101841202 246
106 3300013105 Ga0157369_10393195 Ga0157369_103931953 246
107 3300013296 Ga0157374_10008847 Ga0157374_100088475 246
108 3300013296 Ga0157374_10023740 Ga0157374_100237404 246
109 3300013306 Ga0163162_10001538 Ga0163162_1000153815 246
110 3300013306 Ga0163162_10315676 Ga0163162_103156762 246
111 3300013307 Ga0157372_10031534 Ga0157372_100315344 246
112 3300013307 Ga0157372_10055235 Ga0157372_100552354 246
113 3300013307 Ga0157372_10140831 Ga0157372_101408312 246
114 3300013307 Ga0157372_10722742 Ga0157372_107227423 246
115 3300014969 Ga0157376_10091215 Ga0157376_100912152 246
116 3300014969 Ga0157376_10382664 Ga0157376_103826642 246
117 3300025903 Ga0207680_10041828 Ga0207680_100418282 246
118 3300025904 Ga0207647_10017102 Ga0207647_100171022 246
119 3300025904 Ga0207647_10158365 Ga0207647_101583651 246
120 3300025909 Ga0207705_10001124 Ga0207705_1000112410 246
121 3300025909 Ga0207705_10013525 Ga0207705_100135253 246
122 3300025911 Ga0207654_10244586 Ga0207654_102445862 246
123 3300025913 Ga0207695_10015218 Ga0207695_100152183 246
124 3300025913 Ga0207695_10122012 Ga0207695_101220123 246
125 3300025913 Ga0207695_10298885 Ga0207695_102988852 246
126 3300025913 Ga0207695_10319261 Ga0207695_103192612 246
127 3300025919 Ga0207657_10002508 Ga0207657_1000250813 246
128 3300025919 Ga0207657_10131402 Ga0207657_101314021 246
129 3300025920 Ga0207649_10186843 Ga0207649_101868431 246
130 3300025924 Ga0207694_10004444 Ga0207694_100044442 246
131 3300025931 Ga0207644_10012042 Ga0207644_100120424 246
132 3300025944 Ga0207661_10037116 Ga0207661_100371163 246
133 3300025949 Ga0207667_10022234 Ga0207667_100222345 246
134 3300025949 Ga0207667_10136375 Ga0207667_101363753 246
135 3300025972 Ga0207668_10167670 Ga0207668_101676702 246
136 3300025986 Ga0207658_10032133 Ga0207658_100321332 246
137 3300026041 Ga0207639_10013689 Ga0207639_100136894 246
138 3300026067 Ga0207678_10002507 Ga0207678_1000250714 246
139 3300026067 Ga0207678_10005634 Ga0207678_100056345 246
140 3300026078 Ga0207702_10037588 Ga0207702_100375883 246
141 3300026078 Ga0207702_10495178 Ga0207702_104951782 246
142 3300026095 Ga0207676_10414878 Ga0207676_104148782 246
143 3300026116 Ga0207674_10000408 Ga0207674_100004089 246
144 3300026116 Ga0207674_10001795 Ga0207674_1000179522 246
145 3300028379 Ga0268266_10025029 Ga0268266_100250292 246
146 3300028800 Ga0265338_10077320 Ga0265338_100773202 246
147 3300031548 Ga0307408_100068739 Ga0307408_1000687392 246
148 3300035692 Ga0373935_0417135 Ga0373935_0417135_106_852 246
149 3300044684 Ga0466966_0065634 Ga0466966_0065634_978_1796 246
150 3300044684 Ga0466966_0091515 Ga0466966_0091515_771_1511 246
151 3300044765 Ga0466970_0028269 Ga0466970_0028269_148_888 246
152 3300046452 Ga0495617_112339 Ga0495617_112339_32_808 246
153 3300046454 Ga0495592_0043611 Ga0495592_0043611_1331_2077 246
154 3300046457 Ga0495590_0059006 Ga0495590_0059006_121_897 246
155 3300046459 Ga0495629_0006459 Ga0495629_0006459_7598_8344 246
156 3300046459 Ga0495629_0009261 Ga0495629_0009261_2954_3700 246
157 3300046463 Ga0495653_0057503 Ga0495653_0057503_1686_2432 246
158 3300046472 Ga0495580_0070973 Ga0495580_0070973_585_1331 246
159 3300046473 Ga0495582_0007892 Ga0495582_0007892_1686_2432 246
160 3300046475 Ga0495639_0009378 Ga0495639_0009378_2007_2753 246
161 3300046476 Ga0495662_0004309 Ga0495662_0004309_4892_5638 246
162 3300046477 Ga0495664_0027141 Ga0495664_0027141_1559_2305 246
163 3300046499 Ga0495594_0000486 Ga0495594_0000486_15803_16549 246
164 3300046499 Ga0495594_0000999 Ga0495594_0000999_3326_4072 246
165 3300046499 Ga0495594_0027891 Ga0495594_0027891_937_1683 246
166 3300046507 Ga0495606_0043318 Ga0495606_0043318_612_1388 246
167 3300046514 Ga0495618_0098390 Ga0495618_0098390_101_847 246
168 3300046516 Ga0495628_0035762 Ga0495628_0035762_1686_2432 246
169 3300046523 Ga0495644_0000066 Ga0495644_0000066_50113_50859 246
170 3300046529 Ga0495652_0007845 Ga0495652_0007845_388_1134 246
171 3300046531 Ga0495665_0000234 Ga0495665_0000234_23445_24191 246
172 3300046533 Ga0495640_0013406 Ga0495640_0013406_1399_2145 246
173 3300046538 Ga0495609_0012636 Ga0495609_0012636_702_1448 246
174 3300046538 Ga0495609_0036639 Ga0495609_0036639_878_1624 246
175 3300046543 Ga0495645_0055579 Ga0495645_0055579_1663_2409 246
176 3300046558 Ga0495633_0091932 Ga0495633_0091932_598_1344 246
177 3300046642 Ga0495634_0011675 Ga0495634_0011675_1967_2713 246
178 3300046660 Ga0495625_0010808 Ga0495625_0010808_3877_4623 246
179 3300046663 Ga0495635_0012339 Ga0495635_0012339_51_962 246
180 3300046679 Ga0495623_0122214 Ga0495623_0122214_459_1205 246
181 3300046684 Ga0495669_0002295 Ga0495669_0002295_6416_7162 246
182 3300046689 Ga0495613_0000754 Ga0495613_0000754_766_1512 246
183 3300046690 Ga0495624_0025524 Ga0495624_0025524_2330_3076 246
184 3300046809 Ga0495600_0010396 Ga0495600_0010396_135_881 246
185 3300047317 Ga0495604_0009517 Ga0495604_0009517_918_1664 246
186 3300047317 Ga0495604_0087709 Ga0495604_0087709_321_1145 246
187 3300047319 Ga0495674_0009216 Ga0495674_0009216_138_884 246
188 3300047319 Ga0495674_0093560 Ga0495674_0093560_1525_2298 246
189 3300047321 Ga0495676_0011191 Ga0495676_0011191_5640_6386 246
190 3300047322 Ga0495680_0046463 Ga0495680_0046463_1611_2357 246
191 3300047445 Ga0495677_0039042 Ga0495677_0039042_688_1434 246
192 3300048089 Ga0495614_0008748 Ga0495614_0008748_3021_3767 246
193 3300048907 Ga0496104_0019215 Ga0496104_0019215_4029_4853 246
194 3300048915 Ga0496112_0491709 Ga0496112_0491709_52_798 246
195 3300048917 Ga0496114_0045079 Ga0496114_0045079_1727_2500 246
196 3300049573 Ga0501037_0031220 Ga0501037_0031220_154_900 246
197 3300005356 Ga0070674_100067578 Ga0070674_1000675782 247
198 3300005435 Ga0070714_100037670 Ga0070714_1000376703 247
199 3300005455 Ga0070663_100366353 Ga0070663_1003663531 247
200 3300005548 Ga0070665_100011020 Ga0070665_1000110203 247
201 3300005577 Ga0068857_100005858 Ga0068857_1000058582 247
202 3300005577 Ga0068857_100070535 Ga0068857_1000705352 247
203 3300006846 Ga0075430_100000801 Ga0075430_10000080117 247
204 3300006852 Ga0075433_10110685 Ga0075433_101106852 247
205 3300006880 Ga0075429_100017147 Ga0075429_1000171473 247
206 3300007076 Ga0075435_100004415 Ga0075435_1000044156 247
207 3300009094 Ga0111539_10000079 Ga0111539_1000007922 247
208 3300009147 Ga0114129_10155222 Ga0114129_101552222 247
209 3300021361 Ga0213872_10000206 Ga0213872_1000020611 247
210 3300025929 Ga0207664_10179714 Ga0207664_101797142 247
211 3300026116 Ga0207674_10084460 Ga0207674_100844602 247
212 3300028379 Ga0268266_10108382 Ga0268266_101083822 247
213 3300028800 Ga0265338_10005165 Ga0265338_1000516511 247
214 3300031548 Ga0307408_100019318 Ga0307408_1000193184 247
215 3300031852 Ga0307410_10422918 Ga0307410_104229182 247
216 3300031911 Ga0307412_10095718 Ga0307412_100957182 247
217 3300032002 Ga0307416_100061170 Ga0307416_1000611703 247
218 3300032005 Ga0307411_10123930 Ga0307411_101239302 247
219 3300032005 Ga0307411_10432625 Ga0307411_104326252 247
220 3300035119 Ga0373956_0001673 Ga0373956_0001673_3898_4641 247
221 3300035695 Ga0373927_0000367 Ga0373927_0000367_2748_3491 247
222 3300036401 Ga0373937_0256063 Ga0373937_0256063_94_837 247
223 3300037312 Ga0395899_0000004 Ga0395899_0000004_127572_128315 247
224 3300039437 Ga0436365_0069560 Ga0436365_0069560_50_793 247
225 3300039438 Ga0436360_1307511 Ga0436360_1307511_354_1097 247
226 3300039447 Ga0436361_0079738 Ga0436361_0079738_40326_41075 247
227 3300039447 Ga0436361_0868224 Ga0436361_0868224_483_1226 247
228 3300042008 Ga0439450_001420 Ga0439450_001420_1398_2231 247
229 3300042439 Ga0439464_0000455 Ga0439464_0000455_6922_7755 247
230 3300044901 Ga0466960_0220721 Ga0466960_0220721_263_1006 247
231 3300049574 Ga0501038_0207157 Ga0501038_0207157_361_1104 247
232 3300049581 Ga0501047_0005581 Ga0501047_0005581_4411_5154 247
233 3300049823 Ga0501044_0000895 Ga0501044_0000895_6908_7651 247
234 3300050507 nmdc:mga05p37_109284_c1 nmdc:mga05p37_109284_c1_286_1053 247
235 3300050507 nmdc:mga05p37_13502_c1 nmdc:mga05p37_13502_c1_6512_7345 247
236 3300050507 nmdc:mga05p37_73013_c1 nmdc:mga05p37_73013_c1_3394_4146 247
237 3300050511 nmdc:mga08y16_581_c1 nmdc:mga08y16_581_c1_234_1067 247
238 3300005563 Ga0068855_100012577 Ga0068855_1000125773 248
239 3300005577 Ga0068857_100219483 Ga0068857_1002194832 248
240 3300005616 Ga0068852_100000003 Ga0068852_100000003119 248
241 3300009093 Ga0105240_10000249 Ga0105240_1000024971 248
242 3300013102 Ga0157371_10170514 Ga0157371_101705142 248
243 3300013104 Ga0157370_10000001 Ga0157370_10000001328 248
244 3300013105 Ga0157369_10000073 Ga0157369_1000007366 248
245 3300013307 Ga0157372_10000045 Ga0157372_10000045114 248
246 3300025913 Ga0207695_10000026 Ga0207695_10000026238 248
247 3300025944 Ga0207661_10198158 Ga0207661_101981583 248
248 3300025949 Ga0207667_10001066 Ga0207667_1000106634 248
249 3300026142 Ga0207698_10000057 Ga0207698_1000005774 248
250 3300031731 Ga0307405_10134910 Ga0307405_101349101 248
251 3300032002 Ga0307416_100117733 Ga0307416_1001177331 248
252 3300032005 Ga0307411_10032289 Ga0307411_100322891 248
253 3300032126 Ga0307415_100045381 Ga0307415_1000453812 248
254 3300044684 Ga0466966_0010963 Ga0466966_0010963_4590_5369 248
255 3300044694 Ga0466963_0163493 Ga0466963_0163493_333_1112 248
256 3300044765 Ga0466970_0077723 Ga0466970_0077723_996_1775 248
257 3300045049 Ga0466959_0071013 Ga0466959_0071013_1558_2337 248
258 3300045836 Ga0466958_0034548 Ga0466958_0034548_1178_1957 248
259 3300049568 Ga0501031_0093630 Ga0501031_0093630_295_1077 248
260 3300049569 Ga0501032_0006022 Ga0501032_0006022_6893_7675 248
261 3300049570 Ga0501033_0009230 Ga0501033_0009230_5695_6477 248
262 3300049571 Ga0501034_0002471 Ga0501034_0002471_20754_21536 248
263 3300049572 Ga0501036_0014505 Ga0501036_0014505_5190_5972 248
264 3300049573 Ga0501037_0001861 Ga0501037_0001861_1273_2055 248
265 3300049574 Ga0501038_0036659 Ga0501038_0036659_721_1503 248
266 3300049577 Ga0501041_0001984 Ga0501041_0001984_5014_5796 248
267 3300049579 Ga0501043_0002575 Ga0501043_0002575_1206_1988 248
268 3300049580 Ga0501046_0003608 Ga0501046_0003608_721_1503 248
269 3300049581 Ga0501047_0034719 Ga0501047_0034719_1352_2134 248
270 3300049581 Ga0501047_0057855 Ga0501047_0057855_2527_3309 248
271 3300049582 Ga0501048_0080863 Ga0501048_0080863_72_854 248
272 3300049584 Ga0501068_0003473 Ga0501068_0003473_952_1734 248
273 3300049586 Ga0501070_0079274 Ga0501070_0079274_72_854 248
274 3300049587 Ga0501071_0000589 Ga0501071_0000589_7384_8166 248
275 3300049588 Ga0501072_0004241 Ga0501072_0004241_7330_8112 248
276 3300049589 Ga0501073_0031448 Ga0501073_0031448_72_854 248
277 3300049590 Ga0501074_0039385 Ga0501074_0039385_2570_3352 248
278 3300049592 Ga0501076_0063928 Ga0501076_0063928_94_876 248
279 3300049593 Ga0501077_0047711 Ga0501077_0047711_1854_2636 248
280 3300049741 Ga0501079_0006022 Ga0501079_0006022_3654_4436 248
281 3300049744 Ga0501083_0063527 Ga0501083_0063527_1011_1793 248
282 3300049822 Ga0501035_0003402 Ga0501035_0003402_721_1503 248
283 3300053119 Ga0500595_014366 Ga0500595_014366_1829_2578 248
284 3300060353 Ga0501082_0009221 Ga0501082_0009221_6889_7671 248
285 3300061734 Ga0530510_0076711 Ga0530510_0076711_874_1656 248
286 3300009147 Ga0114129_10618374 Ga0114129_106183742 249
287 3300021361 Ga0213872_10034674 Ga0213872_100346742 249
288 3300049570 Ga0501033_0118494 Ga0501033_0118494_561_1313 249
289 3300049589 Ga0501073_0057085 Ga0501073_0057085_129_887 249
290 3300049823 Ga0501044_0158249 Ga0501044_0158249_472_1230 249
291 3300003320 rootH2_10044177 rootH2_100441773 250
292 3300005331 Ga0070670_100000733 Ga0070670_10000073313 250
293 3300005334 Ga0068869_100070580 Ga0068869_1000705803 250
294 3300005335 Ga0070666_10365475 Ga0070666_103654751 250
295 3300005336 Ga0070680_100000970 Ga0070680_1000009704 250
296 3300005338 Ga0068868_100029772 Ga0068868_1000297723 250
297 3300005339 Ga0070660_100011080 Ga0070660_1000110802 250
298 3300005344 Ga0070661_100036998 Ga0070661_1000369983 250
299 3300005344 Ga0070661_100107992 Ga0070661_1001079922 250
300 3300005355 Ga0070671_100075286 Ga0070671_1000752863 250
301 3300005367 Ga0070667_100000267 Ga0070667_10000026742 250
302 3300005458 Ga0070681_10001484 Ga0070681_1000148413 250
303 3300005530 Ga0070679_100000515 Ga0070679_10000051514 250
304 3300005535 Ga0070684_100003163 Ga0070684_10000316310 250
305 3300005535 Ga0070684_100048032 Ga0070684_1000480323 250
306 3300005539 Ga0068853_100000656 Ga0068853_10000065614 250
307 3300005539 Ga0068853_100020926 Ga0068853_1000209264 250
308 3300005539 Ga0068853_100164285 Ga0068853_1001642852 250
309 3300005563 Ga0068855_100002084 Ga0068855_1000020848 250
310 3300005564 Ga0070664_100370154 Ga0070664_1003701542 250
311 3300005577 Ga0068857_100037321 Ga0068857_1000373212 250
312 3300005577 Ga0068857_100041149 Ga0068857_1000411493 250
313 3300005578 Ga0068854_100012992 Ga0068854_1000129924 250
314 3300005578 Ga0068854_100179428 Ga0068854_1001794282 250
315 3300005614 Ga0068856_100000382 Ga0068856_10000038230 250
316 3300005614 Ga0068856_100003704 Ga0068856_1000037045 250
317 3300005614 Ga0068856_100008038 Ga0068856_1000080387 250
318 3300005614 Ga0068856_100009954 Ga0068856_1000099549 250
319 3300005616 Ga0068852_100000361 Ga0068852_1000003619 250
320 3300005616 Ga0068852_100004797 Ga0068852_1000047972 250
321 3300005616 Ga0068852_100152345 Ga0068852_1001523452 250
322 3300005616 Ga0068852_100536901 Ga0068852_1005369012 250
323 3300005617 Ga0068859_100001218 Ga0068859_10000121822 250
324 3300005618 Ga0068864_100000506 Ga0068864_10000050613 250
325 3300005834 Ga0068851_10056436 Ga0068851_100564361 250
326 3300005841 Ga0068863_100000898 Ga0068863_10000089828 250
327 3300005843 Ga0068860_100001482 Ga0068860_1000014829 250
328 3300005844 Ga0068862_100181698 Ga0068862_1001816981 250
329 3300006175 Ga0070712_100454634 Ga0070712_1004546342 250
330 3300006237 Ga0097621_100151102 Ga0097621_1001511022 250
331 3300006358 Ga0068871_100009238 Ga0068871_1000092384 250
332 3300006844 Ga0075428_100014021 Ga0075428_1000140212 250
333 3300006880 Ga0075429_100034989 Ga0075429_1000349892 250
334 3300006931 Ga0097620_100001218 Ga0097620_10000121822 250
335 3300009093 Ga0105240_10001474 Ga0105240_1000147410 250
336 3300009093 Ga0105240_10010390 Ga0105240_100103902 250
337 3300009093 Ga0105240_10027524 Ga0105240_100275244 250
338 3300009093 Ga0105240_10577918 Ga0105240_105779181 250
339 3300009098 Ga0105245_10009846 Ga0105245_100098462 250
340 3300009101 Ga0105247_10035659 Ga0105247_100356592 250
341 3300009174 Ga0105241_10000036 Ga0105241_1000003691 250
342 3300009174 Ga0105241_10010035 Ga0105241_100100354 250
343 3300009174 Ga0105241_10091294 Ga0105241_100912941 250
344 3300009545 Ga0105237_10004629 Ga0105237_1000462910 250
345 3300009545 Ga0105237_10034835 Ga0105237_100348353 250
346 3300009551 Ga0105238_10000088 Ga0105238_1000008898 250
347 3300009551 Ga0105238_10002730 Ga0105238_100027302 250
348 3300009551 Ga0105238_10250561 Ga0105238_102505612 250
349 3300009551 Ga0105238_10302697 Ga0105238_103026972 250
350 3300009553 Ga0105249_10405104 Ga0105249_104051042 250
351 3300010375 Ga0105239_10004026 Ga0105239_100040265 250
352 3300010375 Ga0105239_10053772 Ga0105239_100537722 250
353 3300010375 Ga0105239_10672366 Ga0105239_106723661 250
354 3300011119 Ga0105246_10001970 Ga0105246_100019702 250
355 3300013100 Ga0157373_10056515 Ga0157373_100565152 250
356 3300013102 Ga0157371_10133516 Ga0157371_101335161 250
357 3300013104 Ga0157370_10007915 Ga0157370_100079155 250
358 3300013105 Ga0157369_10008409 Ga0157369_100084094 250
359 3300013105 Ga0157369_10041065 Ga0157369_100410652 250
360 3300013105 Ga0157369_10072462 Ga0157369_100724622 250
361 3300013105 Ga0157369_10151103 Ga0157369_101511032 250
362 3300013296 Ga0157374_10069826 Ga0157374_100698263 250
363 3300013296 Ga0157374_10133282 Ga0157374_101332822 250
364 3300013296 Ga0157374_10199690 Ga0157374_101996902 250
365 3300013296 Ga0157374_10245729 Ga0157374_102457292 250
366 3300013297 Ga0157378_10031245 Ga0157378_100312452 250
367 3300013306 Ga0163162_10109277 Ga0163162_101092772 250
368 3300013307 Ga0157372_10000866 Ga0157372_100008669 250
369 3300013307 Ga0157372_10031566 Ga0157372_100315663 250
370 3300013307 Ga0157372_10116886 Ga0157372_101168863 250
371 3300013308 Ga0157375_10040225 Ga0157375_100402252 250
372 3300014325 Ga0163163_10001028 Ga0163163_1000102810 250
373 3300014968 Ga0157379_10000305 Ga0157379_1000030516 250
374 3300014968 Ga0157379_10853213 Ga0157379_108532131 250
375 3300014969 Ga0157376_10001618 Ga0157376_1000161810 250
376 3300025900 Ga0207710_10002050 Ga0207710_100020503 250
377 3300025909 Ga0207705_10057148 Ga0207705_100571482 250
378 3300025909 Ga0207705_10106303 Ga0207705_101063033 250
379 3300025911 Ga0207654_10000052 Ga0207654_1000005266 250
380 3300025911 Ga0207654_10001505 Ga0207654_100015055 250
381 3300025911 Ga0207654_10015290 Ga0207654_100152902 250
382 3300025912 Ga0207707_10050422 Ga0207707_100504222 250
383 3300025913 Ga0207695_10000538 Ga0207695_1000053826 250
384 3300025913 Ga0207695_10000995 Ga0207695_1000099541 250
385 3300025913 Ga0207695_10002072 Ga0207695_1000207217 250
386 3300025913 Ga0207695_10420994 Ga0207695_104209942 250
387 3300025914 Ga0207671_10001289 Ga0207671_100012897 250
388 3300025914 Ga0207671_10001318 Ga0207671_100013188 250
389 3300025919 Ga0207657_10001469 Ga0207657_1000146914 250
390 3300025920 Ga0207649_10002426 Ga0207649_100024269 250
391 3300025920 Ga0207649_10061054 Ga0207649_100610541 250
392 3300025921 Ga0207652_10001691 Ga0207652_100016912 250
393 3300025924 Ga0207694_10000028 Ga0207694_1000002817 250
394 3300025924 Ga0207694_10004122 Ga0207694_100041226 250
395 3300025924 Ga0207694_10007274 Ga0207694_100072745 250
396 3300025925 Ga0207650_10020580 Ga0207650_100205804 250
397 3300025927 Ga0207687_10024009 Ga0207687_100240092 250
398 3300025927 Ga0207687_10613249 Ga0207687_106132491 250
399 3300025931 Ga0207644_10136807 Ga0207644_101368074 250
400 3300025941 Ga0207711_10020128 Ga0207711_100201283 250
401 3300025942 Ga0207689_10036443 Ga0207689_100364433 250
402 3300025949 Ga0207667_10000079 Ga0207667_1000007947 250
403 3300025949 Ga0207667_10005791 Ga0207667_100057918 250
404 3300025981 Ga0207640_10014244 Ga0207640_100142443 250
405 3300025986 Ga0207658_10000163 Ga0207658_1000016361 250
406 3300026023 Ga0207677_10000076 Ga0207677_1000007661 250
407 3300026023 Ga0207677_10245112 Ga0207677_102451122 250
408 3300026041 Ga0207639_10000043 Ga0207639_10000043111 250
409 3300026041 Ga0207639_10011559 Ga0207639_100115593 250
410 3300026041 Ga0207639_10206600 Ga0207639_102066002 250
411 3300026078 Ga0207702_10000834 Ga0207702_1000083416 250
412 3300026078 Ga0207702_10006030 Ga0207702_100060306 250
413 3300026078 Ga0207702_10120334 Ga0207702_101203342 250
414 3300026088 Ga0207641_10018780 Ga0207641_100187804 250
415 3300026095 Ga0207676_10005173 Ga0207676_100051732 250
416 3300026116 Ga0207674_10005564 Ga0207674_100055643 250
417 3300026116 Ga0207674_10080294 Ga0207674_100802943 250
418 3300026142 Ga0207698_10000046 Ga0207698_1000004673 250
419 3300026142 Ga0207698_10610251 Ga0207698_106102511 250
420 3300026142 Ga0207698_10614283 Ga0207698_106142832 250
421 3300028381 Ga0268264_10001422 Ga0268264_1000142219 250
422 3300028577 Ga0265318_10105679 Ga0265318_101056791 250
423 3300028800 Ga0265338_10053983 Ga0265338_100539832 250
424 3300028800 Ga0265338_10117838 Ga0265338_101178382 250
425 3300028800 Ga0265338_10201580 Ga0265338_102015803 250
426 3300031235 Ga0265330_10000702 Ga0265330_1000070215 250
427 3300031235 Ga0265330_10029575 Ga0265330_100295752 250
428 3300031239 Ga0265328_10004478 Ga0265328_100044785 250
429 3300031240 Ga0265320_10022715 Ga0265320_100227152 250
430 3300031241 Ga0265325_10123847 Ga0265325_101238471 250
431 3300031247 Ga0265340_10016287 Ga0265340_100162872 250
432 3300031249 Ga0265339_10000041 Ga0265339_10000041104 250
433 3300031249 Ga0265339_10067882 Ga0265339_100678822 250
434 3300031344 Ga0265316_10019533 Ga0265316_100195333 250
435 3300031711 Ga0265314_10329397 Ga0265314_103293971 250
436 3300031712 Ga0265342_10005577 Ga0265342_100055775 250
437 3300031712 Ga0265342_10011746 Ga0265342_100117463 250
438 3300031712 Ga0265342_10116479 Ga0265342_101164792 250
439 3300036401 Ga0373937_0606900 Ga0373937_0606900_77_829 250
440 3300044694 Ga0466963_0093649 Ga0466963_0093649_1013_1768 250
441 3300045976 Ga0466967_0040718 Ga0466967_0040718_2823_3578 250
442 3300048918 Ga0496115_0262157 Ga0496115_0262157_407_1159 250
443 3300050508 nmdc:mga09592_143495_c1 nmdc:mga09592_143495_c1_33_851 250
444 3300050510 nmdc:mga06r32_20464_c1 nmdc:mga06r32_20464_c1_3633_4451 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02754

CCG

Cysteine-rich domain

60

141

0.98

PF02754

CCG

Cysteine-rich domain

191

276

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5odq-assembly1.cif.gz_B heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. 0.7923 1 239
7bkb-assembly1.cif.gz_B formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) 0.7646 2 238
5odq-assembly1.cif.gz_B heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. 0.7581 1 239
7bkb-assembly1.cif.gz_B formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) 0.7264 2 238
1oe6-assembly1.cif.gz_A xenopus smug1, an anti-mutator uracil-dna glycosylase 0.6666 186 233
ID Description Score Start End Superfamily
af_P0A996_163_249_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9151 4 79 3.40.30.10
af_P77252_132_217_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9082 135 218 3.40.30.10
af_P52074_302_386_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8952 135 218 3.40.30.10
af_P77252_3_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8926 4 79 3.40.30.10
af_P52074_170_256_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8833 4 81 3.40.30.10
ID Description Score Start End GO Terms
AF-Q1J3P8-F1-model_v4 Cysteine-rich region DUF224, predicted oxidase subunit 0.9722 1 242 GO:0005829
GO:0016491
AF-A0A3S3QUR2-F1-model_v4 deleted 0.9709 1 174
AF-C1D3M1-F1-model_v4 Putative Fe-S oxidoreductase 0.9707 1 244 GO:0005829
GO:0016491
AF-A0A1H5T2K5-F1-model_v4 L-lactate dehydrogenase complex protein LldE 0.9695 1 245 GO:0005829
GO:0016491
AF-A0A5C4MFC5-F1-model_v4 (Fe-S)-binding protein 0.9692 72 242 GO:0005829
GO:0016491

Feature Viewer

pLDDT pTM Quality
90.81 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map