F445352

General Info

Members Datasets Scaffolds Average Seq Length
444 278 888 360

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0000043|Ga0496121_0000043_67649_68869
Length 406
Sequence VLRVANVYNKFNLQNFFYSPFYYLNIGNYRYLCIHKTNSKMSANNLFQPFQLKSLNLKNRIVMAPMTRSFSPNGVPGQDVADYYKRRAEGQVGLILSEGTVIDRPSSSYDPNIPHFYGTQALSGWQKVINEVHTAGGAMGPQIWHQGIMSNHHSGWLPSAPFEGPSGILAPDSHNGKALSEEDIADVIAAFAKAAVDAKRLGFETVELHGAHGYLIDQFFYHVTNQRTDKYNGKTIGERTRFAVEVIKEVRKQVGEDYPLIIRLSQFKPTDYNHKLATTPLEMEAWLTPMADAGIDIFHCSQRRFWEPEFEGDDLNFAGWAKKLTGKATITVGSIGLSGEFMAAFRGESSEPSSLDELLRRYDRGDFDLVAVGRPLLADPDWALKIKDERTSELKGFSKEALATLL

Samples

Sample ID Description Type Environment
1 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
27 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
28 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
29 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
30 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
31 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
32 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
50 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
51 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
52 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
55 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
57 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
59 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
75 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
77 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
78 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
79 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
80 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
81 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
82 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
83 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
87 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
88 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
89 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
90 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
91 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
92 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
93 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
94 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
95 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
96 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
97 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
114 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
115 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
116 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
117 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
118 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
121 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
124 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
125 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
126 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
127 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
130 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
131 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
132 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
133 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
134 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
135 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
136 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
137 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
140 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
141 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
142 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
143 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
144 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
148 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
149 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
150 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
151 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
152 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
153 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
154 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
155 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
156 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
158 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
159 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
160 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
161 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
162 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
163 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
165 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
166 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
167 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
168 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
169 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
170 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
171 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
172 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
173 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
174 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
175 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
176 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
177 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
178 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
179 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
180 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
181 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
182 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
183 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
184 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
185 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
186 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
187 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
188 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
189 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
190 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
191 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
192 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
193 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
194 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
195 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
196 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
197 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
198 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
199 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
200 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
201 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
202 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
203 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
204 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
205 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
206 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
207 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
208 2738541283 Pedobacter sp. OK701 Isolate Unclassified
209 2738541284 Pedobacter sp. YR016 Isolate Unclassified
210 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
211 2738541302 Pedobacter sp. CF074 Isolate Unclassified
212 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
213 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
214 2738543023 Pedobacter sp. OK628 Isolate Unclassified
215 2739367651 Pedobacter sp. OK291 Isolate Unclassified
216 2739367656 Pedobacter sp. CF523 Isolate Unclassified
217 2739367663 Pedobacter sp. YR510 Isolate Unclassified
218 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
219 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
220 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
221 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
222 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
223 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
224 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
225 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
226 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
227 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
228 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
229 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
230 2818991437 Pedobacter terrae 518 Isolate Unclassified
231 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
232 2818991444 Filimonas endophytica 3197 Isolate Unclassified
233 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
234 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
235 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
236 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
237 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
238 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
239 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
240 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
241 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
242 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
243 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
244 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
245 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
246 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
247 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
248 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
249 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
250 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
251 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
252 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
253 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
254 2914759650 Rhizosphaericola mali Isolate Rhizosphere
255 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
256 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
257 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
258 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
259 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
260 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
261 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
262 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
263 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
264 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
265 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
266 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
267 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
268 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
269 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
270 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
271 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
272 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
273 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
274 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
275 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
276 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
277 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
278 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.7
Metatranscriptomes 0.23
Isolates 22.07

Biome Distribution

Category Percentage (%)
Aerial Root 0.45
Bulb 0
Endosphere 9.68
Nodule 1.13
Rhizoplane 0.68
Rhizosphere 68.69
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496121_0000043 3300048924 Bacteria 341882
2 SwRhRL2b_contig_261465 2162886007 Bacteria 1202
3 SwRhRL2b_contig_475676 2162886007 Bacteria 8397
4 JGI24741J21665_1003685 3300001915 Bacteria 3580
5 JGI25152J39213_1000054 3300002773 Bacteria 76796
6 JGI25150J39212_1000003 3300002774 Bacteria 508651
7 JGI25151J46595_10000002 3300003187 Bacteria 731381
8 JGI25153J46596_10000015 3300003215 Bacteria 289820
9 rootH2_10224681 3300003320 Bacteria 3447
10 rootL2_10012446 3300003322 Bacteria 12409
11 rootL2_10016756 3300003322 Bacteria 4107
12 rootL2_10019069 3300003322 Bacteria 5568
13 rootL2_10032417 3300003322 Bacteria 8795
14 rootL2_10103704 3300003322 Bacteria 4209
15 rootL2_10243909 3300003322 Bacteria 3419
16 rootH1_10086585 3300003323 Bacteria 15734
17 rootH1_10143231 3300003323 Bacteria 3820
18 rootH1_10257874 3300003323 Bacteria 3270
19 Ga0055535_1001254 3300003761 Bacteria 14023
20 Ga0055536_1000006 3300003781 Bacteria 347733
21 Ga0055534_1002866 3300003784 Bacteria 5728
22 Ga0055530_10003777 3300003791 Bacteria 8353
23 Ga0055531_10000006 3300003794 Bacteria 226600
24 Ga0065165_1012900 3300005262 Bacteria 3362
25 Ga0065714_10002298 3300005288 Bacteria 48008
26 Ga0065714_10002621 3300005288 Bacteria 31326
27 Ga0065714_10064492 3300005288 Bacteria 49867
28 Ga0065714_10064685 3300005288 Bacteria 23720
29 Ga0065714_10072480 3300005288 Bacteria 3360
30 Ga0065704_10000205 3300005289 Bacteria 128899
31 Ga0065704_10001103 3300005289 Bacteria 14777
32 Ga0065704_10076384 3300005289 Bacteria 5142
33 Ga0065715_10237125 3300005293 Bacteria 1172
34 Ga0070682_100000122 3300005337 Bacteria 69084
35 Ga0070660_100075281 3300005339 Bacteria 2643
36 Ga0070660_100136013 3300005339 Bacteria 1969
37 Ga0070659_100000731 3300005366 Bacteria 23826
38 Ga0070667_100248989 3300005367 Bacteria 1588
39 Ga0070684_100003839 3300005535 Bacteria 11361
40 Ga0075366_10000306 3300006195 Bacteria 22150
41 Ga0075366_10023758 3300006195 Bacteria 3572
42 Ga0099824_1000974 3300006942 Bacteria 38343
43 Ga0079104_1000179 3300006946 Bacteria 90381
44 Ga0099794_10060832 3300007265 Bacteria 1835
45 Ga0099795_10020169 3300007788 Bacteria 2168
46 Ga0105251_10059655 3300009011 Bacteria 1798
47 Ga0105244_10000004 3300009036 Bacteria 492478
48 Ga0105244_10000010 3300009036 Bacteria 265799
49 Ga0105244_10110845 3300009036 Bacteria 1335
50 Ga0105250_10007168 3300009092 Bacteria 4810
51 Ga0105240_10000006 3300009093 Bacteria 669662
52 Ga0105243_10000201 3300009148 Bacteria 69844
53 Ga0105243_10032815 3300009148 Bacteria 4013
54 Ga0105237_10183086 3300009545 Bacteria 2095
55 Ga0105238_10008705 3300009551 Bacteria 10153
56 Ga0105238_10454317 3300009551 Unclassified 1278
57 Ga0099796_10030563 3300010159 Bacteria 1749
58 Ga0105239_10001618 3300010375 Bacteria 29751
59 Ga0105239_10006819 3300010375 Bacteria 13173
60 Ga0105246_10228061 3300011119 Bacteria 1465
61 Ga0157373_10000002 3300013100 Bacteria 750094
62 Ga0157373_10000019 3300013100 Bacteria 166579
63 Ga0157373_10010113 3300013100 Bacteria 6949
64 Ga0157373_10010731 3300013100 Bacteria 6740
65 Ga0157373_10034038 3300013100 Bacteria 3660
66 Ga0157373_10044563 3300013100 Bacteria 3167
67 Ga0157371_10003762 3300013102 Bacteria 13577
68 Ga0157371_10010487 3300013102 Bacteria 7211
69 Ga0157371_10010623 3300013102 Bacteria 7152
70 Ga0157371_10045464 3300013102 Bacteria 3124
71 Ga0157370_10000136 3300013104 Bacteria 88390
72 Ga0157370_10000464 3300013104 Bacteria 50658
73 Ga0157370_10000724 3300013104 Bacteria 41344
74 Ga0157370_10015837 3300013104 Bacteria 7650
75 Ga0157370_10035737 3300013104 Bacteria 4827
76 Ga0157370_10070480 3300013104 Bacteria 3300
77 Ga0157370_10138974 3300013104 Bacteria 2263
78 Ga0157369_10000047 3300013105 Bacteria 172682
79 Ga0157369_10012719 3300013105 Bacteria 9544
80 Ga0157374_10238576 3300013296 Bacteria 1787
81 Ga0163162_10015433 3300013306 Bacteria 7465
82 Ga0157372_10130216 3300013307 Bacteria 2894
83 Ga0157372_10157628 3300013307 Bacteria 2622
84 Ga0157375_10000150 3300013308 Bacteria 68209
85 Ga0157375_10148106 3300013308 Bacteria 2480
86 Ga0182008_10000015 3300014497 Bacteria 243121
87 Ga0182008_10000069 3300014497 Bacteria 82281
88 Ga0182008_10000132 3300014497 Bacteria 56231
89 Ga0182008_10022977 3300014497 Bacteria 3190
90 Ga0182008_10057212 3300014497 Bacteria 1926
91 Ga0182006_1000016 3300015261 Bacteria 303558
92 Ga0182006_1000179 3300015261 Bacteria 66779
93 Ga0182006_1000182 3300015261 Bacteria 65171
94 Ga0182006_1000239 3300015261 Bacteria 51541
95 Ga0182007_10000005 3300015262 Bacteria 442702
96 Ga0182007_10009142 3300015262 Bacteria 4027
97 Ga0182007_10025650 3300015262 Bacteria 2051
98 Ga0182005_1000120 3300015265 Bacteria 57067
99 Ga0183373_1002 3300015682 Bacteria 990153
100 Ga0163161_10000007 3300017792 Bacteria 301614
101 Ga0163161_10000238 3300017792 Bacteria 50049
102 Ga0163161_10000838 3300017792 Bacteria 23986
103 Ga0163161_10002225 3300017792 Bacteria 13969
104 Ga0163161_10007400 3300017792 Bacteria 7584
105 Ga0163161_10015137 3300017792 Bacteria 5376
106 Ga0163161_10017174 3300017792 Bacteria 5060
107 Ga0163161_10059233 3300017792 Bacteria 2784
108 Ga0209436_100635 3300025208 Bacteria 14956
109 Ga0209258_101495 3300025242 Bacteria 7999
110 Ga0207425_1000003 3300025245 Bacteria 1145342
111 Ga0209148_1000453 3300025254 Bacteria 44659
112 Ga0209129_1000014 3300025258 Bacteria 509018
113 Ga0209675_1000094 3300025291 Bacteria 138083
114 Ga0209676_1000039 3300025292 Bacteria 443158
115 Ga0209025_1000007 3300025294 Bacteria 1145109
116 Ga0209758_1000012 3300025297 Bacteria 949866
117 Ga0209050_1000033 3300025298 Bacteria 442615
118 Ga0209257_1000071 3300025304 Bacteria 335832
119 Ga0209257_1000402 3300025304 Bacteria 84536
120 Ga0207655_1000008 3300025728 Bacteria 734289
121 Ga0207655_1000671 3300025728 Bacteria 40220
122 Ga0207655_1068977 3300025728 Bacteria 1323
123 Ga0207713_1055282 3300025735 Bacteria 1550
124 Ga0207695_10000017 3300025913 Bacteria 769384
125 Ga0207657_10137524 3300025919 Bacteria 1998
126 Ga0207694_10071360 3300025924 Bacteria 2714
127 Ga0207690_10000596 3300025932 Bacteria 23410
128 Ga0207709_10000736 3300025935 Bacteria 26029
129 Ga0207712_10089047 3300025961 Bacteria 2268
130 Ga0207658_10223614 3300025986 Bacteria 1585
131 Ga0209281_1000116 3300027111 Bacteria 209707
132 Ga0209588_1044153 3300027671 Bacteria 1441
133 Ga0265337_1031809 3300028556 Bacteria 1564
134 Ga0265326_10005547 3300028558 Bacteria 3977
135 Ga0265326_10006136 3300028558 Bacteria 3750
136 Ga0265326_10014020 3300028558 Bacteria 2335
137 Ga0265319_1000937 3300028563 Bacteria 18272
138 Ga0265319_1002341 3300028563 Bacteria 10431
139 Ga0265319_1015632 3300028563 Bacteria 2936
140 Ga0265319_1023759 3300028563 Bacteria 2216
141 Ga0265334_10004243 3300028573 Bacteria 6392
142 Ga0265334_10010052 3300028573 Bacteria 3998
143 Ga0265334_10039736 3300028573 Bacteria 1845
144 Ga0265318_10000101 3300028577 Bacteria 79709
145 Ga0265318_10005945 3300028577 Bacteria 5670
146 Ga0265318_10010002 3300028577 Bacteria 4151
147 Ga0265323_10001325 3300028653 Bacteria 12272
148 Ga0265323_10003752 3300028653 Bacteria 6642
149 Ga0265323_10006003 3300028653 Bacteria 5136
150 Ga0265323_10008580 3300028653 Bacteria 4209
151 Ga0265323_10010702 3300028653 Bacteria 3712
152 Ga0265323_10014351 3300028653 Bacteria 3142
153 Ga0265323_10027893 3300028653 Bacteria 2119
154 Ga0265323_10041418 3300028653 Bacteria 1671
155 Ga0265322_10002052 3300028654 Bacteria 6342
156 Ga0265322_10002513 3300028654 Bacteria 5650
157 Ga0265322_10044129 3300028654 Bacteria 1269
158 Ga0307517_10000280 3300028786 Bacteria 87903
159 Ga0307515_10000181 3300028794 Bacteria 154316
160 Ga0307515_10001233 3300028794 Bacteria 58397
161 Ga0307515_10036715 3300028794 Bacteria 7915
162 Ga0265338_10005329 3300028800 Bacteria 16832
163 Ga0265338_10030543 3300028800 Bacteria 5305
164 Ga0265338_10056801 3300028800 Bacteria 3467
165 Ga0265338_10141122 3300028800 Bacteria 1887
166 Ga0265338_10223882 3300028800 Bacteria 1403
167 Ga0265324_10002011 3300029957 Bacteria 10839
168 Ga0265324_10010225 3300029957 Bacteria 3627
169 Ga0316177_1193479 3300030731 Bacteria 3966
170 Ga0316183_1061567 3300030742 Bacteria 42572
171 Ga0265330_10001716 3300031235 Bacteria 12355
172 Ga0265330_10004545 3300031235 Bacteria 7025
173 Ga0265330_10008509 3300031235 Bacteria 4934
174 Ga0265328_10088241 3300031239 Bacteria 1145
175 Ga0265320_10038707 3300031240 Bacteria 2390
176 Ga0265325_10032382 3300031241 Bacteria 2791
177 Ga0265325_10066735 3300031241 Bacteria 1813
178 Ga0265325_10120429 3300031241 Bacteria 1266
179 Ga0265329_10000118 3300031242 Bacteria 37207
180 Ga0265329_10001338 3300031242 Bacteria 11985
181 Ga0265329_10005456 3300031242 Bacteria 5137
182 Ga0265329_10006275 3300031242 Bacteria 4725
183 Ga0265340_10002229 3300031247 Bacteria 11093
184 Ga0265339_10002821 3300031249 Bacteria 12329
185 Ga0265339_10003402 3300031249 Bacteria 11133
186 Ga0265339_10019745 3300031249 Bacteria 3949
187 Ga0265331_10013826 3300031250 Bacteria 4325
188 Ga0265327_10000091 3300031251 Bacteria 196369
189 Ga0265327_10017752 3300031251 Bacteria 4443
190 Ga0265327_10051481 3300031251 Bacteria 2150
191 Ga0265327_10053189 3300031251 Bacteria 2103
192 Ga0265316_10000208 3300031344 Bacteria 68236
193 Ga0265316_10001162 3300031344 Bacteria 28457
194 Ga0265316_10003493 3300031344 Bacteria 15863
195 Ga0265316_10009941 3300031344 Bacteria 8713
196 Ga0265316_10010004 3300031344 Bacteria 8675
197 Ga0265316_10012549 3300031344 Bacteria 7589
198 Ga0265316_10023079 3300031344 Bacteria 5231
199 Ga0265316_10033466 3300031344 Bacteria 4185
200 Ga0265316_10055952 3300031344 Bacteria 3083
201 Ga0265316_10124955 3300031344 Bacteria 1940
202 Ga0307513_10002772 3300031456 Bacteria 24100
203 Ga0307408_100000031 3300031548 Bacteria 214210
204 Ga0307408_100003051 3300031548 Bacteria 11566
205 Ga0265313_10002175 3300031595 Bacteria 17382
206 Ga0265313_10010582 3300031595 Bacteria 5813
207 Ga0265313_10066827 3300031595 Bacteria 1665
208 Ga0265314_10001033 3300031711 Bacteria 32400
209 Ga0265314_10001130 3300031711 Bacteria 30899
210 Ga0265314_10003597 3300031711 Bacteria 14919
211 Ga0265314_10015858 3300031711 Bacteria 5968
212 Ga0265314_10047689 3300031711 Bacteria 3012
213 Ga0265314_10144455 3300031711 Bacteria 1467
214 Ga0265342_10001046 3300031712 Bacteria 27124
215 Ga0265342_10005516 3300031712 Bacteria 9613
216 Ga0265342_10005778 3300031712 Bacteria 9351
217 Ga0265342_10014482 3300031712 Bacteria 5232
218 Ga0265342_10046034 3300031712 Bacteria 2623
219 Ga0307405_10000009 3300031731 Bacteria 259388
220 Ga0307413_10000015 3300031824 Bacteria 48618
221 Ga0307413_10118268 3300031824 Bacteria 1789
222 Ga0307410_10000126 3300031852 Bacteria 27166
223 Ga0307406_10001672 3300031901 Bacteria 12189
224 Ga0307407_10000001 3300031903 Bacteria 570048
225 Ga0307407_10000111 3300031903 Bacteria 26379
226 Ga0307407_10000724 3300031903 Bacteria 10775
227 Ga0307412_10000004 3300031911 Bacteria 544053
228 Ga0307412_10000022 3300031911 Bacteria 241533
229 Ga0307412_10000441 3300031911 Bacteria 25135
230 Ga0307412_10054922 3300031911 Bacteria 2646
231 Ga0307412_10068611 3300031911 Bacteria 2411
232 Ga0307416_100000003 3300032002 Bacteria 509060
233 Ga0307416_100000008 3300032002 Bacteria 401343
234 Ga0307416_100018159 3300032002 Bacteria 4947
235 Ga0307416_100033201 3300032002 Bacteria 3909
236 Ga0307414_10000001 3300032004 Bacteria 1352954
237 Ga0307414_10000004 3300032004 Bacteria 472218
238 Ga0307414_10000477 3300032004 Bacteria 20980
239 Ga0307414_10010961 3300032004 Bacteria 5295
240 Ga0307414_10016123 3300032004 Bacteria 4533
241 Ga0307414_10040915 3300032004 Bacteria 3134
242 Ga0307414_10083718 3300032004 Bacteria 2343
243 Ga0307411_10000013 3300032005 Bacteria 145335
244 Ga0307510_10085911 3300033180 Bacteria 3020
245 Ga0436361_0658394 3300039447 Bacteria 19974
246 Ga0439466_0026252 3300041411 Bacteria 2027
247 Ga0439466_0064515 3300041411 Bacteria 1174
248 Ga0439465_0000033 3300041413 Bacteria 28385
249 Ga0439432_068586 3300042006 Bacteria 1084
250 Ga0439456_025011 3300042013 Bacteria 1268
251 Ga0466972_0020502 3300044658 Bacteria 3303
252 Ga0466960_0093602 3300044901 Bacteria 1536
253 Ga0495627_000002 3300046453 Bacteria 903861
254 Ga0495627_026361 3300046453 Bacteria 1874
255 Ga0495638_0150343 3300046460 Bacteria 1351
256 Ga0495585_0001680 3300046492 Bacteria 16912
257 Ga0495596_0001663 3300046500 Bacteria 12620
258 Ga0495606_0033143 3300046507 Bacteria 3567
259 Ga0495606_0038865 3300046507 Bacteria 3214
260 Ga0495606_0046060 3300046507 Bacteria 2885
261 Ga0495610_0000009 3300046512 Bacteria 554843
262 Ga0495610_0000696 3300046512 Bacteria 32341
263 Ga0495610_0107253 3300046512 Bacteria 1242
264 Ga0495616_0000021 3300046513 Bacteria 160303
265 Ga0495628_0153351 3300046516 Bacteria 1754
266 Ga0495632_0001871 3300046519 Bacteria 16890
267 Ga0495644_0021119 3300046523 Bacteria 2484
268 Ga0495648_0057019 3300046524 Bacteria 2346
269 Ga0495663_0000010 3300046525 Bacteria 161009
270 Ga0495654_0000056 3300046530 Bacteria 140658
271 Ga0495654_0060357 3300046530 Bacteria 1823
272 Ga0495609_0000134 3300046538 Bacteria 79757
273 Ga0495609_0006416 3300046538 Bacteria 6002
274 Ga0495622_0065609 3300046557 Bacteria 1678
275 Ga0495633_0000130 3300046558 Bacteria 100724
276 Ga0495633_0000199 3300046558 Bacteria 76789
277 Ga0495633_0000853 3300046558 Bacteria 26660
278 Ga0495633_0001745 3300046558 Bacteria 16176
279 Ga0495668_0000075 3300046616 Bacteria 163092
280 Ga0495668_0003376 3300046616 Bacteria 12017
281 Ga0495625_0000543 3300046660 Bacteria 55204
282 Ga0495625_0000647 3300046660 Bacteria 50043
283 Ga0495625_0002872 3300046660 Bacteria 18039
284 Ga0495625_0010104 3300046660 Bacteria 7840
285 Ga0495661_0033617 3300046665 Bacteria 3233
286 Ga0495671_0128031 3300046692 Bacteria 1238
287 Ga0495660_0000987 3300046810 Bacteria 20773
288 Ga0495687_000007 3300047443 Bacteria 552679
289 Ga0495686_0000151 3300047472 Bacteria 135048
290 Ga0495686_0001287 3300047472 Bacteria 28292
291 Ga0495686_0132720 3300047472 Bacteria 1475
292 Ga0496103_0063581 3300048906 Bacteria 2299
293 Ga0496113_0046893 3300048916 Bacteria 3210
294 Ga0496115_0006636 3300048918 Bacteria 8490
295 Ga0496116_0000006 3300048919 Bacteria 811937
296 Ga0496116_0000047 3300048919 Bacteria 315121
297 Ga0496117_0000023 3300048920 Bacteria 438585
298 Ga0496118_0000388 3300048921 Bacteria 74358
299 Ga0496118_0059309 3300048921 Bacteria 2851
300 Ga0496119_0000010 3300048922 Bacteria 438534
301 Ga0496122_0000066 3300048925 Bacteria 231473
302 Ga0496122_0000091 3300048925 Bacteria 204567
303 Ga0496122_0002335 3300048925 Bacteria 27368
304 Ga0496122_0002426 3300048925 Bacteria 26509
305 Ga0496122_0002827 3300048925 Bacteria 23787
306 Ga0496122_0015442 3300048925 Bacteria 7300
307 Ga0496123_0000294 3300048926 Bacteria 97574
308 Ga0496123_0010777 3300048926 Bacteria 8022
309 Ga0496123_0018679 3300048926 Bacteria 5498
310 Ga0496124_0004895 3300048927 Bacteria 15407
311 Ga0496124_0022658 3300048927 Bacteria 5751
312 Ga0496125_0000050 3300048928 Bacteria 286703
313 Ga0496125_0000181 3300048928 Bacteria 138133
314 Ga0496125_0009481 3300048928 Bacteria 9993
315 Ga0496126_0001958 3300048929 Bacteria 29180
316 Ga0496126_0008002 3300048929 Bacteria 11478
317 Ga0496126_0010334 3300048929 Bacteria 9796
318 Ga0496126_0390438 3300048929 Bacteria 1131
319 Ga0501334_00472 3300049550 Bacteria 1843
320 Ga0501238_001395 3300049671 Bacteria 2799
321 Ga0501249_000027 3300049679 Bacteria 87387
322 Ga0501241_000006 3300049758 Bacteria 149999
323 Ga0501241_000800 3300049758 Bacteria 6685
324 Ga0501266_000005 3300049763 Bacteria 346750
325 Ga0501269_000276 3300049766 Bacteria 14341
326 Ga0501280_000336 3300049776 Bacteria 11746
327 nmdc:mga0k408_3918_c1 3300050493 Bacteria 7892
328 nmdc:mga0k408_63411_c1 3300050493 Bacteria 2150
329 Ga0495619_0031548 3300053085 Unclassified 3434
330 Ga0500643_037932 3300053087 Bacteria 1431
331 Ga0500644_0001295 3300053088 Bacteria 6797
332 Ga0500651_0000207 3300053093 Bacteria 36951
333 Ga0500641_0000027 3300053096 Bacteria 106908
334 Ga0500608_017745 3300053122 Bacteria 3238
335 Ga0500618_000005 3300053125 Bacteria 253092
336 Ga0500658_0000021 3300053134 Bacteria 133042
337 Ga0500559_0015763 3300053136 Bacteria 3192
338 Ga0500577_0008560 3300053142 Bacteria 2925
339 Ga0500604_0001333 3300053151 Bacteria 6867
340 Ga0500616_0001928 3300053153 Bacteria 18508
341 Ga0500622_0000022 3300053156 Bacteria 267246
342 Ga0500622_0000384 3300053156 Bacteria 42700
343 Ga0500624_000265 3300053157 Bacteria 18286
344 Ga0500627_0012072 3300053158 Bacteria 3221
345 Ga0500634_0089958 3300053161 Bacteria 1561
346 Ga0500636_0054516 3300053177 Bacteria 2344
347 2511234574 2511231000 Bacteria 4488346
348 2513235735 2513020052 Bacteria 5120511
349 2520878865 2519899754 Bacteria 5336938
350 2585144646 2582581278 Bacteria 5296881
351 2585156842 2582581281 Bacteria 4487904
352 2585161075 2582581282 Bacteria 4495830
353 2585424539 2582581873 Bacteria 3032664
354 2586208813 2585427687 Bacteria 5544917
355 2587677888 2585428045 Bacteria 5203023
356 2587747019 2585428060 Bacteria 5304711
357 2587753674 2585428061 Bacteria 3939663
358 2587944295 2585428115 Bacteria 4420269
359 2588209777 2585428182 Bacteria 5007281
360 2588215075 2585428183 Bacteria 5166119
361 2588218267 2585428184 Bacteria 4978681
362 2588222420 2585428185 Bacteria 4969476
363 2588233978 2585428187 Bacteria 4629388
364 2588444750 2588253712 Bacteria 5403181
365 2590604147 2588254255 Bacteria 5014294
366 2590612841 2588254257 Bacteria 5436094
367 2644011418 2643221600 Bacteria 5530138
368 2644369824 2643221667 Bacteria 5627472
369 2644642335 2643221716 Bacteria 4986332
370 2644685213 2643221725 Bacteria 5087956
371 2729199502 2728369107 Bacteria 5082720
372 2738700470 2738541273 Bacteria 4048577
373 2738731990 2738541279 Bacteria 6149495
374 2738757596 2738541283 Bacteria 7222293
375 2738762951 2738541284 Bacteria 5199923
376 2738764555 2738541285 Bacteria 6150075
377 2738854839 2738541302 Bacteria 5944758
378 2739213570 2738543007 Bacteria 6149845
379 2739254219 2738543014 Bacteria 4048139
380 2739304663 2738543023 Bacteria 6767879
381 2739587045 2739367651 Bacteria 6359826
382 2739618231 2739367656 Bacteria 5152243
383 2739646338 2739367663 Bacteria 5040914
384 2740000842 2739367857 Bacteria 5433684
385 2740005658 2739367858 Bacteria 5432813
386 2740057239 2739367874 Bacteria 4872888
387 2753670985 2751185877 Bacteria 4921427
388 2765573530 2765235839 Bacteria 5314748
389 2772604044 2772190705 Bacteria 4666226
390 2775672343 2775506739 Bacteria 3855222
391 2776260134 2775506901 Bacteria 9631051
392 2776614559 2775506987 Bacteria 5373360
393 2802654126 2802428842 Bacteria 4926114
394 2816873894 2816332188 Bacteria 5133218
395 2817415845 2816332280 Bacteria 5109718
396 2819547496 2818991437 Bacteria 5805520
397 2819577877 2818991442 Bacteria 8318214
398 2819589239 2818991444 Bacteria 6968812
399 2821139023 2821136567 Bacteria 8080116
400 2835313819 2835312727 Bacteria 7413381
401 2842084854 2842083920 Bacteria 4857652
402 2842726521 2842722452 Bacteria 6263924
403 2842904225 2842903701 Bacteria 6986368
404 2842911285 2842909656 Bacteria 6185908
405 2848860639 2848858292 Bacteria 7391279
406 2849286492 2849281842 Bacteria 6065644
407 2852627689 2852627209 Bacteria 5896285
408 2857614581 2857613821 Bacteria 4917088
409 2857619030 2857618242 Bacteria 5635925
410 2871721640 2871720351 Bacteria 4862476
411 2881249064 2881247448 Bacteria 3717788
412 2881360489 2881359912 Bacteria 4935907
413 2889295879 2889290771 Bacteria 5530962
414 2903896202 2903895155 Bacteria 5258610
415 2904419871 2904419702 Bacteria 5166287
416 2904448927 2904445276 Bacteria 5310396
417 2904472457 2904467357 Bacteria 8057758
418 2904556661 2904555929 Bacteria 5218588
419 2906000218 2905999023 Bacteria 4591259
420 2914759682 2914759650 Bacteria 4701441
421 2919099027 2919097161 Bacteria 3860339
422 2919194011 2919191525 Bacteria 5765973
423 2919400011 2919399522 Bacteria 5164947
424 2919421706 2919420072 Bacteria 5390363
425 2919434736 2919432681 Bacteria 5390474
426 2919686079 2919683626 Bacteria 5534354
427 2929153084 2929150217 Bacteria 5462483
428 2929243770 2929239360 Bacteria 7745570
429 2945928189 2945924605 Bacteria 4296724
430 2946022118 2946019816 Bacteria 4621265
431 2954020035 2954016120 Bacteria 6446024
432 2958460855 2958458903 Bacteria 5301041
433 2958512534 2958512119 Bacteria 4528530
434 2977245544 2977243572 Bacteria 4374394
435 2977269759 2977268062 Bacteria 5243061
436 2984576594 2984572630 Bacteria 4186940
437 2984610050 2984606641 Bacteria 4186971
438 2993372890 2993372514 Bacteria 4214139
439 2993483570 2993480792 Bacteria 4022225
440 2995394315 2995392953 Bacteria 4539380
441 3000018511 3000017691 Bacteria 3772574
442 8054309891 8054307821 Bacteria 5212224
443 8055421526 8055419101 Bacteria 5289643
444 8055594001 8055592153 Bacteria 5961247
445 Ga0496121_0000043
446 SwRhRL2b_contig_261465
447 SwRhRL2b_contig_475676
448 JGI24741J21665_1003685
449 JGI25152J39213_1000054
450 JGI25150J39212_1000003
451 JGI25151J46595_10000002
452 JGI25153J46596_10000015
453 rootH2_10224681
454 rootL2_10012446
455 rootL2_10016756
456 rootL2_10019069
457 rootL2_10032417
458 rootL2_10103704
459 rootL2_10243909
460 rootH1_10086585
461 rootH1_10143231
462 rootH1_10257874
463 Ga0055535_1001254
464 Ga0055536_1000006
465 Ga0055534_1002866
466 Ga0055530_10003777
467 Ga0055531_10000006
468 Ga0065165_1012900
469 Ga0065714_10002298
470 Ga0065714_10002621
471 Ga0065714_10064492
472 Ga0065714_10064685
473 Ga0065714_10072480
474 Ga0065704_10000205
475 Ga0065704_10001103
476 Ga0065704_10076384
477 Ga0065715_10237125
478 Ga0070682_100000122
479 Ga0070660_100075281
480 Ga0070660_100136013
481 Ga0070659_100000731
482 Ga0070667_100248989
483 Ga0070684_100003839
484 Ga0075366_10000306
485 Ga0075366_10023758
486 Ga0099824_1000974
487 Ga0079104_1000179
488 Ga0099794_10060832
489 Ga0099795_10020169
490 Ga0105251_10059655
491 Ga0105244_10000004
492 Ga0105244_10000010
493 Ga0105244_10110845
494 Ga0105250_10007168
495 Ga0105240_10000006
496 Ga0105243_10000201
497 Ga0105243_10032815
498 Ga0105237_10183086
499 Ga0105238_10008705
500 Ga0105238_10454317
501 Ga0099796_10030563
502 Ga0105239_10001618
503 Ga0105239_10006819
504 Ga0105246_10228061
505 Ga0157373_10000002
506 Ga0157373_10000019
507 Ga0157373_10010113
508 Ga0157373_10010731
509 Ga0157373_10034038
510 Ga0157373_10044563
511 Ga0157371_10003762
512 Ga0157371_10010487
513 Ga0157371_10010623
514 Ga0157371_10045464
515 Ga0157370_10000136
516 Ga0157370_10000464
517 Ga0157370_10000724
518 Ga0157370_10015837
519 Ga0157370_10035737
520 Ga0157370_10070480
521 Ga0157370_10138974
522 Ga0157369_10000047
523 Ga0157369_10012719
524 Ga0157374_10238576
525 Ga0163162_10015433
526 Ga0157372_10130216
527 Ga0157372_10157628
528 Ga0157375_10000150
529 Ga0157375_10148106
530 Ga0182008_10000015
531 Ga0182008_10000069
532 Ga0182008_10000132
533 Ga0182008_10022977
534 Ga0182008_10057212
535 Ga0182006_1000016
536 Ga0182006_1000179
537 Ga0182006_1000182
538 Ga0182006_1000239
539 Ga0182007_10000005
540 Ga0182007_10009142
541 Ga0182007_10025650
542 Ga0182005_1000120
543 Ga0183373_1002
544 Ga0163161_10000007
545 Ga0163161_10000238
546 Ga0163161_10000838
547 Ga0163161_10002225
548 Ga0163161_10007400
549 Ga0163161_10015137
550 Ga0163161_10017174
551 Ga0163161_10059233
552 Ga0209436_100635
553 Ga0209258_101495
554 Ga0207425_1000003
555 Ga0209148_1000453
556 Ga0209129_1000014
557 Ga0209675_1000094
558 Ga0209676_1000039
559 Ga0209025_1000007
560 Ga0209758_1000012
561 Ga0209050_1000033
562 Ga0209257_1000071
563 Ga0209257_1000402
564 Ga0207655_1000008
565 Ga0207655_1000671
566 Ga0207655_1068977
567 Ga0207713_1055282
568 Ga0207695_10000017
569 Ga0207657_10137524
570 Ga0207694_10071360
571 Ga0207690_10000596
572 Ga0207709_10000736
573 Ga0207712_10089047
574 Ga0207658_10223614
575 Ga0209281_1000116
576 Ga0209588_1044153
577 Ga0265337_1031809
578 Ga0265326_10005547
579 Ga0265326_10006136
580 Ga0265326_10014020
581 Ga0265319_1000937
582 Ga0265319_1002341
583 Ga0265319_1015632
584 Ga0265319_1023759
585 Ga0265334_10004243
586 Ga0265334_10010052
587 Ga0265334_10039736
588 Ga0265318_10000101
589 Ga0265318_10005945
590 Ga0265318_10010002
591 Ga0265323_10001325
592 Ga0265323_10003752
593 Ga0265323_10006003
594 Ga0265323_10008580
595 Ga0265323_10010702
596 Ga0265323_10014351
597 Ga0265323_10027893
598 Ga0265323_10041418
599 Ga0265322_10002052
600 Ga0265322_10002513
601 Ga0265322_10044129
602 Ga0307517_10000280
603 Ga0307515_10000181
604 Ga0307515_10001233
605 Ga0307515_10036715
606 Ga0265338_10005329
607 Ga0265338_10030543
608 Ga0265338_10056801
609 Ga0265338_10141122
610 Ga0265338_10223882
611 Ga0265324_10002011
612 Ga0265324_10010225
613 Ga0316177_1193479
614 Ga0316183_1061567
615 Ga0265330_10001716
616 Ga0265330_10004545
617 Ga0265330_10008509
618 Ga0265328_10088241
619 Ga0265320_10038707
620 Ga0265325_10032382
621 Ga0265325_10066735
622 Ga0265325_10120429
623 Ga0265329_10000118
624 Ga0265329_10001338
625 Ga0265329_10005456
626 Ga0265329_10006275
627 Ga0265340_10002229
628 Ga0265339_10002821
629 Ga0265339_10003402
630 Ga0265339_10019745
631 Ga0265331_10013826
632 Ga0265327_10000091
633 Ga0265327_10017752
634 Ga0265327_10051481
635 Ga0265327_10053189
636 Ga0265316_10000208
637 Ga0265316_10001162
638 Ga0265316_10003493
639 Ga0265316_10009941
640 Ga0265316_10010004
641 Ga0265316_10012549
642 Ga0265316_10023079
643 Ga0265316_10033466
644 Ga0265316_10055952
645 Ga0265316_10124955
646 Ga0307513_10002772
647 Ga0307408_100000031
648 Ga0307408_100003051
649 Ga0265313_10002175
650 Ga0265313_10010582
651 Ga0265313_10066827
652 Ga0265314_10001033
653 Ga0265314_10001130
654 Ga0265314_10003597
655 Ga0265314_10015858
656 Ga0265314_10047689
657 Ga0265314_10144455
658 Ga0265342_10001046
659 Ga0265342_10005516
660 Ga0265342_10005778
661 Ga0265342_10014482
662 Ga0265342_10046034
663 Ga0307405_10000009
664 Ga0307413_10000015
665 Ga0307413_10118268
666 Ga0307410_10000126
667 Ga0307406_10001672
668 Ga0307407_10000001
669 Ga0307407_10000111
670 Ga0307407_10000724
671 Ga0307412_10000004
672 Ga0307412_10000022
673 Ga0307412_10000441
674 Ga0307412_10054922
675 Ga0307412_10068611
676 Ga0307416_100000003
677 Ga0307416_100000008
678 Ga0307416_100018159
679 Ga0307416_100033201
680 Ga0307414_10000001
681 Ga0307414_10000004
682 Ga0307414_10000477
683 Ga0307414_10010961
684 Ga0307414_10016123
685 Ga0307414_10040915
686 Ga0307414_10083718
687 Ga0307411_10000013
688 Ga0307510_10085911
689 Ga0436361_0658394
690 Ga0439466_0026252
691 Ga0439466_0064515
692 Ga0439465_0000033
693 Ga0439432_068586
694 Ga0439456_025011
695 Ga0466972_0020502
696 Ga0466960_0093602
697 Ga0495627_000002
698 Ga0495627_026361
699 Ga0495638_0150343
700 Ga0495585_0001680
701 Ga0495596_0001663
702 Ga0495606_0033143
703 Ga0495606_0038865
704 Ga0495606_0046060
705 Ga0495610_0000009
706 Ga0495610_0000696
707 Ga0495610_0107253
708 Ga0495616_0000021
709 Ga0495628_0153351
710 Ga0495632_0001871
711 Ga0495644_0021119
712 Ga0495648_0057019
713 Ga0495663_0000010
714 Ga0495654_0000056
715 Ga0495654_0060357
716 Ga0495609_0000134
717 Ga0495609_0006416
718 Ga0495622_0065609
719 Ga0495633_0000130
720 Ga0495633_0000199
721 Ga0495633_0000853
722 Ga0495633_0001745
723 Ga0495668_0000075
724 Ga0495668_0003376
725 Ga0495625_0000543
726 Ga0495625_0000647
727 Ga0495625_0002872
728 Ga0495625_0010104
729 Ga0495661_0033617
730 Ga0495671_0128031
731 Ga0495660_0000987
732 Ga0495687_000007
733 Ga0495686_0000151
734 Ga0495686_0001287
735 Ga0495686_0132720
736 Ga0496103_0063581
737 Ga0496113_0046893
738 Ga0496115_0006636
739 Ga0496116_0000006
740 Ga0496116_0000047
741 Ga0496117_0000023
742 Ga0496118_0000388
743 Ga0496118_0059309
744 Ga0496119_0000010
745 Ga0496122_0000066
746 Ga0496122_0000091
747 Ga0496122_0002335
748 Ga0496122_0002426
749 Ga0496122_0002827
750 Ga0496122_0015442
751 Ga0496123_0000294
752 Ga0496123_0010777
753 Ga0496123_0018679
754 Ga0496124_0004895
755 Ga0496124_0022658
756 Ga0496125_0000050
757 Ga0496125_0000181
758 Ga0496125_0009481
759 Ga0496126_0001958
760 Ga0496126_0008002
761 Ga0496126_0010334
762 Ga0496126_0390438
763 Ga0501334_00472
764 Ga0501238_001395
765 Ga0501249_000027
766 Ga0501241_000006
767 Ga0501241_000800
768 Ga0501266_000005
769 Ga0501269_000276
770 Ga0501280_000336
771 nmdc:mga0k408_3918_c1
772 nmdc:mga0k408_63411_c1
773 Ga0495619_0031548
774 Ga0500643_037932
775 Ga0500644_0001295
776 Ga0500651_0000207
777 Ga0500641_0000027
778 Ga0500608_017745
779 Ga0500618_000005
780 Ga0500658_0000021
781 Ga0500559_0015763
782 Ga0500577_0008560
783 Ga0500604_0001333
784 Ga0500616_0001928
785 Ga0500622_0000022
786 Ga0500622_0000384
787 Ga0500624_000265
788 Ga0500627_0012072
789 Ga0500634_0089958
790 Ga0500636_0054516
791 2511234574
792 2513235735
793 2520878865
794 2585144646
795 2585156842
796 2585161075
797 2585424539
798 2586208813
799 2587677888
800 2587747019
801 2587753674
802 2587944295
803 2588209777
804 2588215075
805 2588218267
806 2588222420
807 2588233978
808 2588444750
809 2590604147
810 2590612841
811 2644011418
812 2644369824
813 2644642335
814 2644685213
815 2729199502
816 2738700470
817 2738731990
818 2738757596
819 2738762951
820 2738764555
821 2738854839
822 2739213570
823 2739254219
824 2739304663
825 2739587045
826 2739618231
827 2739646338
828 2740000842
829 2740005658
830 2740057239
831 2753670985
832 2765573530
833 2772604044
834 2775672343
835 2776260134
836 2776614559
837 2802654126
838 2816873894
839 2817415845
840 2819547496
841 2819577877
842 2819589239
843 2821139023
844 2835313819
845 2842084854
846 2842726521
847 2842904225
848 2842911285
849 2848860639
850 2849286492
851 2852627689
852 2857614581
853 2857619030
854 2871721640
855 2881249064
856 2881360489
857 2889295879
858 2903896202
859 2904419871
860 2904448927
861 2904472457
862 2904556661
863 2906000218
864 2914759682
865 2919099027
866 2919194011
867 2919400011
868 2919421706
869 2919434736
870 2919686079
871 2929153084
872 2929243770
873 2945928189
874 2946022118
875 2954020035
876 2958460855
877 2958512534
878 2977245544
879 2977269759
880 2984576594
881 2984610050
882 2993372890
883 2993483570
884 2995394315
885 3000018511
886 8054309891
887 8055421526
888 8055594001

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00724

Oxidored_FMN

NADH:flavin oxidoreductase / NADH oxidase family

45

393

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
8e5h-assembly1.cif.gz_A old yellow enzyme 5 (pcoye5) from pseudomonas chloritidismutans 0.8425 1 319
8e5h-assembly1.cif.gz_A old yellow enzyme 5 (pcoye5) from pseudomonas chloritidismutans 0.8375 1 319
1vyp-assembly1.cif.gz_X structure of pentaerythritol tetranitrate reductase w102f mutant and complexed with picric acid 0.8105 1 316
3p67-assembly1.cif.gz_A t26s mutant of pentaerythritol tetranitrate reductase containing a bound acetate molecule 0.8098 1 316
1vys-assembly1.cif.gz_X structure of pentaerythritol tetranitrate reductase w102y mutant and complexed with picric acid 0.8087 9 316
ID Description Score Start End Superfamily
af_Q4CNI1_1_256_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8372 1 178 3.20.20.70
5k1wA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8053 1 320 3.20.20.70
4ot7A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8044 13 316 3.20.20.70
5k1wA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.803 1 320 3.20.20.70
4a3uA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8008 1 316 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2N9AJS4-F1-model_v4 NADH:flavin oxidoreductase/NADH oxidase N-terminal domain-containing protein 0.9943 93 172 GO:0005829
GO:0010181
GO:0016491
AF-A0A0X3ANV1-F1-model_v4 NADH:flavin oxidoreductase / NADH oxidase family protein 0.9858 131 245 GO:0009056
GO:0010181
GO:0016491
AF-A0A519Y922-F1-model_v4 12-oxophytodienoate reductase 0.9851 92 320 GO:0009056
GO:0010181
GO:0016491
AF-A0A4R5EDS6-F1-model_v4 12-oxophytodienoate reductase 0.9847 51 213 GO:0009056
GO:0010181
GO:0016491
AF-A0A4Q3SM20-F1-model_v4 deleted 0.9792 51 320

Map