F445353

General Info

Members Datasets Scaffolds Average Seq Length
444 270 888 516

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0066304|Ga0496121_0066304_635_2377
Length 580
Sequence MMAGYDHKKENEETDMQAAVPHRGADALIRTLTDAGVDTLFTLSGNHIMPIFDACVQSGIRLIHTRHEAATVHMADAYARITGKIGIALVTGGPGHANAIAALYTAGQAESPVVLLSGHAPLTQLGMGAFQEMRQADLAAPLTKASWTAQSAETLSQDIARAIVVARSGRPGPVHVSLPTDVLEAHVSALKPHAAAAFAPHPLPLDAAVAQAVVTRLRAASRPLILTGPASMTRTARGHAAALEHALGVPVVGMESPRGIGDPSLGAFGDMLAQSDCVLLLGKRLDFTLKFGQTPAFHRDAIVMQIDADRHELDRTQTAFGDRLTHAASADAASAIXXLLAAAEDRAPQATMSSTPSLNLASHGPGAKSSSWRHDVRAAIAFRPAAWDNATSSQAGRLHPVAACRPLQALLDSHPDSVLVVDGGEIGQWAQACLSAPHRVINGIAGSIGASLPFAAAARVAVPDAPVVAVLGDGTFGFHSAEFDTAVRYDLPFVAVVGNDARWNAEYQIQVRDYGQDRTIGCELLPTRYDQVAVAFGGFGVFVEAPHDMTQAVLDAQASGKPACINVMIEGLAAPNIKRA

Samples

Sample ID Description Type Environment
1 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
104 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
155 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
156 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
157 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
160 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
161 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
164 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
175 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
176 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
177 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
178 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
179 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
180 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
181 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
186 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
189 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
190 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
191 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
192 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
193 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
194 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
198 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
199 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
200 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
201 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
202 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
203 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
204 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
205 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
208 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
209 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
229 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
230 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
231 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
234 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
238 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
239 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
240 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
248 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
251 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
252 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
255 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
256 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
257 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
258 2738541277 Variovorax sp. GV051 Isolate Unclassified
259 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
260 2738541307 Variovorax sp. GV008 Isolate Unclassified
261 2738543019 Variovorax sp. GV040 Isolate Unclassified
262 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
263 2855730933 Achromobacter sp. HZ28 Isolate Nodule
264 2855767633 Achromobacter sp. HZ34 Isolate Nodule
265 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
266 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
267 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
268 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
269 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
270 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.4
Metatranscriptomes 0.23
Isolates 3.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.28
Nodule 0.45
Rhizoplane 0.23
Rhizosphere 90.09
Stem 0
Stem Tuber 0
Unclassified 1.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496121_0066304 3300048924 Bacteria 2932
2 JGI25151J46595_10000277 3300003187 Bacteria 59086
3 JGI25151J46595_10002083 3300003187 Bacteria 12465
4 Ga0065707_10002319 3300005295 Bacteria 5465
5 Ga0070658_10028753 3300005327 Bacteria 4464
6 Ga0070658_10060135 3300005327 Bacteria 3094
7 Ga0070658_10088281 3300005327 Bacteria 2553
8 Ga0070676_10019803 3300005328 Bacteria 3749
9 Ga0070690_100002436 3300005330 Bacteria 10012
10 Ga0070690_100053404 3300005330 Bacteria 2585
11 Ga0070690_100137406 3300005330 Bacteria 1656
12 Ga0070670_100002192 3300005331 Bacteria 16051
13 Ga0070670_100004521 3300005331 Bacteria 11658
14 Ga0070670_100045764 3300005331 Bacteria 3762
15 Ga0070670_100046054 3300005331 Bacteria 3750
16 Ga0068869_100002396 3300005334 Bacteria 11296
17 Ga0068869_100010509 3300005334 Bacteria 6039
18 Ga0070680_100001010 3300005336 Bacteria 20069
19 Ga0070680_100072251 3300005336 Bacteria 2835
20 Ga0070682_100002448 3300005337 Bacteria 10251
21 Ga0068868_100000230 3300005338 Bacteria 38066
22 Ga0070660_100006454 3300005339 Bacteria 8132
23 Ga0070689_100006601 3300005340 Bacteria 8053
24 Ga0070689_100037330 3300005340 Bacteria 3714
25 Ga0070691_10000565 3300005341 Bacteria 14119
26 Ga0070687_100000189 3300005343 Bacteria 21407
27 Ga0070661_100134517 3300005344 Bacteria 1859
28 Ga0070692_10001504 3300005345 Bacteria 8527
29 Ga0070668_100012167 3300005347 Bacteria 6408
30 Ga0070669_100002895 3300005353 Bacteria 12373
31 Ga0070669_100058707 3300005353 Bacteria 2824
32 Ga0070675_100027997 3300005354 Bacteria 4531
33 Ga0070674_100028855 3300005356 Bacteria 3647
34 Ga0070673_100046157 3300005364 Bacteria 3382
35 Ga0070673_100088549 3300005364 Bacteria 2525
36 Ga0070659_100013815 3300005366 Bacteria 6022
37 Ga0070659_100100769 3300005366 Bacteria 2324
38 Ga0070703_10011234 3300005406 Bacteria 2527
39 Ga0070709_10043952 3300005434 Bacteria 2765
40 Ga0070714_100065245 3300005435 Bacteria 3135
41 Ga0070713_100000089 3300005436 Bacteria 57995
42 Ga0070713_100029603 3300005436 Bacteria 4339
43 Ga0070701_10014041 3300005438 Bacteria 3663
44 Ga0070711_100040438 3300005439 Bacteria 3145
45 Ga0070705_100001677 3300005440 Bacteria 11591
46 Ga0070705_100019319 3300005440 Bacteria 3586
47 Ga0070705_100023848 3300005440 Unclassified 3293
48 Ga0070705_100052741 3300005440 Bacteria 2377
49 Ga0070700_100000145 3300005441 Bacteria 42177
50 Ga0070700_100000624 3300005441 Bacteria 17574
51 Ga0070694_100000630 3300005444 Bacteria 19388
52 Ga0070694_100000760 3300005444 Bacteria 18024
53 Ga0070694_100008697 3300005444 Bacteria 6217
54 Ga0070708_100017768 3300005445 Bacteria 5939
55 Ga0070663_100004210 3300005455 Bacteria 8415
56 Ga0070678_100065328 3300005456 Bacteria 2701
57 Ga0070662_100025434 3300005457 Bacteria 4088
58 Ga0070662_100069629 3300005457 Bacteria 2590
59 Ga0070681_10000797 3300005458 Bacteria 26270
60 Ga0070681_10176757 3300005458 Bacteria 2057
61 Ga0068867_100001184 3300005459 Bacteria 17886
62 Ga0068867_100004570 3300005459 Bacteria 9734
63 Ga0070707_100084302 3300005468 Bacteria 3071
64 Ga0070707_100098573 3300005468 Bacteria 2831
65 Ga0070698_100114129 3300005471 Bacteria 2666
66 Ga0070679_100070605 3300005530 Bacteria 3484
67 Ga0070684_100002259 3300005535 Bacteria 14174
68 Ga0070684_100055684 3300005535 Bacteria 3449
69 Ga0070697_100141319 3300005536 Bacteria 2025
70 Ga0068853_100004055 3300005539 Bacteria 11277
71 Ga0068853_100109093 3300005539 Bacteria 2456
72 Ga0070672_100011065 3300005543 Bacteria 6281
73 Ga0070686_100004982 3300005544 Bacteria 7327
74 Ga0070695_100000178 3300005545 Bacteria 30212
75 Ga0070696_100000248 3300005546 Bacteria 32432
76 Ga0070693_100000907 3300005547 Bacteria 13185
77 Ga0070665_100136731 3300005548 Bacteria 2454
78 Ga0070704_100002183 3300005549 Bacteria 10900
79 Ga0068855_100004185 3300005563 Bacteria 17608
80 Ga0068855_100007211 3300005563 Bacteria 13487
81 Ga0068855_100055002 3300005563 Bacteria 4676
82 Ga0068855_100078226 3300005563 Bacteria 3837
83 Ga0068855_100114440 3300005563 Bacteria 3093
84 Ga0068856_100002661 3300005614 Bacteria 18317
85 Ga0068856_100004214 3300005614 Bacteria 14351
86 Ga0068856_100193469 3300005614 Bacteria 2048
87 Ga0070702_100000014 3300005615 Bacteria 51486
88 Ga0068852_100000605 3300005616 Bacteria 23555
89 Ga0068852_100008344 3300005616 Bacteria 7629
90 Ga0068852_100017306 3300005616 Bacteria 5651
91 Ga0068859_100006357 3300005617 Bacteria 11988
92 Ga0068859_100009703 3300005617 Bacteria 9719
93 Ga0068859_100030367 3300005617 Bacteria 5423
94 Ga0068859_100038385 3300005617 Bacteria 4805
95 Ga0068864_100010186 3300005618 Bacteria 7760
96 Ga0068864_100081831 3300005618 Bacteria 2832
97 Ga0068866_10000795 3300005718 Bacteria 14155
98 Ga0068861_100000581 3300005719 Bacteria 21649
99 Ga0068861_100006739 3300005719 Bacteria 7850
100 Ga0068861_100058851 3300005719 Bacteria 2940
101 Ga0068863_100002279 3300005841 Bacteria 19076
102 Ga0068863_100035261 3300005841 Bacteria 4766
103 Ga0068858_100008180 3300005842 Bacteria 10056
104 Ga0068858_100031516 3300005842 Bacteria 4925
105 Ga0068860_100002447 3300005843 Bacteria 19513
106 Ga0068862_100005876 3300005844 Bacteria 10219
107 Ga0068862_100017243 3300005844 Bacteria 6011
108 Ga0068862_100046115 3300005844 Bacteria 3720
109 Ga0068862_100137932 3300005844 Bacteria 2163
110 Ga0081538_10016457 3300005981 Bacteria 5667
111 Ga0075365_10036348 3300006038 Bacteria 3191
112 Ga0075368_10000576 3300006042 Bacteria 11047
113 Ga0075363_100009919 3300006048 Bacteria 4497
114 Ga0075364_10012475 3300006051 Bacteria 5200
115 Ga0075362_10002668 3300006177 Bacteria 6059
116 Ga0075367_10032528 3300006178 Bacteria 3002
117 Ga0075369_10000297 3300006186 Bacteria 14806
118 Ga0075366_10017257 3300006195 Bacteria 4153
119 Ga0097621_100000525 3300006237 Bacteria 26865
120 Ga0068871_100003821 3300006358 Bacteria 10381
121 Ga0068871_100040320 3300006358 Bacteria 3740
122 Ga0068871_100094916 3300006358 Bacteria 2490
123 Ga0075428_100000946 3300006844 Bacteria 30757
124 Ga0075428_100014219 3300006844 Bacteria 8853
125 Ga0075430_100050090 3300006846 Bacteria 3524
126 Ga0075430_100079326 3300006846 Bacteria 2751
127 Ga0075431_100076897 3300006847 Bacteria 3444
128 Ga0075431_100197242 3300006847 Bacteria 2061
129 Ga0075431_100206864 3300006847 Bacteria 2006
130 Ga0075433_10020907 3300006852 Bacteria 5480
131 Ga0075433_10045916 3300006852 Bacteria 3799
132 Ga0075433_10082986 3300006852 Bacteria 2828
133 Ga0075434_100003192 3300006871 Bacteria 14618
134 Ga0075434_100015251 3300006871 Bacteria 7364
135 Ga0075434_100071151 3300006871 Bacteria 3469
136 Ga0075434_100114963 3300006871 Bacteria 2704
137 Ga0075429_100000078 3300006880 Bacteria 49626
138 Ga0075429_100000916 3300006880 Bacteria 23356
139 Ga0068865_100000645 3300006881 Bacteria 19721
140 Ga0068865_100062093 3300006881 Bacteria 2622
141 Ga0097620_100006357 3300006931 Bacteria 11988
142 Ga0097620_100009703 3300006931 Bacteria 9719
143 Ga0097620_100030366 3300006931 Bacteria 5423
144 Ga0097620_100038384 3300006931 Bacteria 4805
145 Ga0105240_10006838 3300009093 Bacteria 16678
146 Ga0105240_10081084 3300009093 Bacteria 3988
147 Ga0105240_10105288 3300009093 Unclassified 3425
148 Ga0105240_10132571 3300009093 Bacteria 2987
149 Ga0111539_10001323 3300009094 Bacteria 33033
150 Ga0111539_10008054 3300009094 Bacteria 13435
151 Ga0111539_10029712 3300009094 Bacteria 6653
152 Ga0111539_10109690 3300009094 Bacteria 3239
153 Ga0111539_10152387 3300009094 Bacteria 2706
154 Ga0111539_10187141 3300009094 Bacteria 2418
155 Ga0105245_10001140 3300009098 Bacteria 24024
156 Ga0114129_10000817 3300009147 Bacteria 40107
157 Ga0105243_10001625 3300009148 Bacteria 19552
158 Ga0105243_10216029 3300009148 Bacteria 1692
159 Ga0105241_10002470 3300009174 Bacteria 13900
160 Ga0105241_10002892 3300009174 Bacteria 12842
161 Ga0105241_10021675 3300009174 Bacteria 4753
162 Ga0105242_10000289 3300009176 Bacteria 40069
163 Ga0105242_10000610 3300009176 Bacteria 27965
164 Ga0105242_10065923 3300009176 Bacteria 2989
165 Ga0105238_10021696 3300009551 Bacteria 6542
166 Ga0105249_10004525 3300009553 Bacteria 12013
167 Ga0105239_10060411 3300010375 Bacteria 4160
168 Ga0157370_10001450 3300013104 Bacteria 29357
169 Ga0157370_10079417 3300013104 Bacteria 3090
170 Ga0157369_10002637 3300013105 Bacteria 21445
171 Ga0157369_10002981 3300013105 Bacteria 20257
172 Ga0157369_10043791 3300013105 Bacteria 4877
173 Ga0157378_10001659 3300013297 Bacteria 20115
174 Ga0163162_10068762 3300013306 Bacteria 3593
175 Ga0157372_10002247 3300013307 Bacteria 20968
176 Ga0157372_10065567 3300013307 Bacteria 4078
177 Ga0157372_10199621 3300013307 Bacteria 2317
178 Ga0163163_10016237 3300014325 Bacteria 6913
179 Ga0157380_10023456 3300014326 Bacteria 4654
180 Ga0157380_10062178 3300014326 Bacteria 2990
181 Ga0157379_10075029 3300014968 Bacteria 3027
182 Ga0157376_10006725 3300014969 Bacteria 8141
183 Ga0157376_10010532 3300014969 Bacteria 6770
184 Ga0206354_10252641 3300020081 Bacteria 2349
185 Ga0213875_10001830 3300021388 Bacteria 13220
186 Ga0209025_1000003 3300025294 Bacteria 1366495
187 Ga0209025_1000139 3300025294 Bacteria 188553
188 Ga0207653_10017024 3300025885 Bacteria 2286
189 Ga0207643_10019721 3300025908 Bacteria 3696
190 Ga0207643_10052377 3300025908 Bacteria 2318
191 Ga0207705_10016546 3300025909 Bacteria 5284
192 Ga0207705_10037932 3300025909 Bacteria 3448
193 Ga0207654_10094263 3300025911 Bacteria 1832
194 Ga0207707_10009453 3300025912 Bacteria 8453
195 Ga0207707_10136551 3300025912 Bacteria 2144
196 Ga0207695_10023085 3300025913 Bacteria 7040
197 Ga0207695_10063032 3300025913 Bacteria 3823
198 Ga0207662_10000021 3300025918 Bacteria 72688
199 Ga0207652_10002600 3300025921 Bacteria 15146
200 Ga0207652_10008198 3300025921 Bacteria 8391
201 Ga0207652_10049074 3300025921 Bacteria 3611
202 Ga0207646_10084332 3300025922 Bacteria 2843
203 Ga0207681_10001295 3300025923 Bacteria 16146
204 Ga0207694_10014388 3300025924 Bacteria 5963
205 Ga0207650_10002060 3300025925 Bacteria 14059
206 Ga0207659_10010734 3300025926 Bacteria 5761
207 Ga0207687_10000833 3300025927 Bacteria 20808
208 Ga0207700_10000235 3300025928 Bacteria 33272
209 Ga0207700_10114448 3300025928 Bacteria 2176
210 Ga0207690_10069885 3300025932 Bacteria 2417
211 Ga0207706_10017256 3300025933 Bacteria 6507
212 Ga0207706_10117010 3300025933 Bacteria 2344
213 Ga0207686_10004250 3300025934 Bacteria 7676
214 Ga0207686_10069511 3300025934 Unclassified 2259
215 Ga0207709_10001152 3300025935 Bacteria 19245
216 Ga0207704_10000327 3300025938 Bacteria 22154
217 Ga0207704_10042379 3300025938 Bacteria 2679
218 Ga0207691_10003477 3300025940 Bacteria 15335
219 Ga0207689_10003628 3300025942 Bacteria 14109
220 Ga0207689_10017733 3300025942 Bacteria 6015
221 Ga0207679_10050037 3300025945 Bacteria 3051
222 Ga0207679_10072876 3300025945 Bacteria 2596
223 Ga0207667_10004978 3300025949 Bacteria 16232
224 Ga0207667_10030141 3300025949 Bacteria 5870
225 Ga0207667_10036902 3300025949 Bacteria 5231
226 Ga0207667_10044362 3300025949 Bacteria 4712
227 Ga0207667_10057578 3300025949 Bacteria 4080
228 Ga0207651_10081319 3300025960 Bacteria 2335
229 Ga0207712_10002735 3300025961 Bacteria 11269
230 Ga0207668_10003085 3300025972 Bacteria 9768
231 Ga0207668_10037300 3300025972 Bacteria 3252
232 Ga0207640_10015467 3300025981 Bacteria 4417
233 Ga0207677_10023229 3300026023 Bacteria 3825
234 Ga0207703_10001923 3300026035 Bacteria 18399
235 Ga0207708_10000231 3300026075 Bacteria 44046
236 Ga0207708_10004016 3300026075 Bacteria 10824
237 Ga0207708_10062093 3300026075 Bacteria 2854
238 Ga0207708_10077896 3300026075 Bacteria 2545
239 Ga0207702_10003871 3300026078 Bacteria 13487
240 Ga0207702_10022253 3300026078 Bacteria 5253
241 Ga0207641_10027034 3300026088 Bacteria 4737
242 Ga0207641_10121947 3300026088 Bacteria 2328
243 Ga0207641_10185691 3300026088 Bacteria 1907
244 Ga0207648_10000930 3300026089 Bacteria 32957
245 Ga0207648_10002716 3300026089 Bacteria 18804
246 Ga0207648_10011509 3300026089 Bacteria 8329
247 Ga0207648_10059786 3300026089 Bacteria 3324
248 Ga0207676_10002040 3300026095 Bacteria 14675
249 Ga0207676_10067968 3300026095 Bacteria 2848
250 Ga0207674_10002850 3300026116 Bacteria 21479
251 Ga0207674_10101748 3300026116 Bacteria 2854
252 Ga0207675_100000086 3300026118 Bacteria 72707
253 Ga0207675_100012824 3300026118 Bacteria 7829
254 Ga0207675_100080170 3300026118 Bacteria 3060
255 Ga0207683_10011255 3300026121 Bacteria 7627
256 Ga0207698_10006264 3300026142 Bacteria 7405
257 Ga0207698_10006325 3300026142 Bacteria 7375
258 Ga0207698_10043248 3300026142 Bacteria 3373
259 Ga0207698_10157571 3300026142 Bacteria 1981
260 Ga0209981_1001197 3300027378 Bacteria 3291
261 Ga0210000_1004072 3300027462 Bacteria 2111
262 Ga0207428_10000582 3300027907 Bacteria 43121
263 Ga0207428_10001039 3300027907 Bacteria 30611
264 Ga0207428_10065239 3300027907 Bacteria 2873
265 Ga0268266_10114521 3300028379 Bacteria 2393
266 Ga0268265_10000621 3300028380 Bacteria 35352
267 Ga0268265_10010527 3300028380 Bacteria 6244
268 Ga0268264_10001620 3300028381 Bacteria 20799
269 Ga0265338_10000045 3300028800 Bacteria 223264
270 Ga0265338_10011359 3300028800 Bacteria 10294
271 Ga0307511_10000005 3300030521 Bacteria 175482
272 Ga0265327_10022057 3300031251 Bacteria 3823
273 Ga0265327_10041468 3300031251 Bacteria 2481
274 Ga0307408_100109180 3300031548 Bacteria 2122
275 Ga0307507_10058819 3300033179 Bacteria 3604
276 Ga0373926_0038149 3300035083 Bacteria 1710
277 Ga0373940_0001156 3300035088 Bacteria 4622
278 Ga0373944_0002957 3300035089 Bacteria 4368
279 Ga0373936_0003409 3300035113 Bacteria 5960
280 Ga0373936_0007958 3300035113 Bacteria 3982
281 Ga0373939_0020924 3300035114 Unclassified 1784
282 Ga0373941_0003512 3300035115 Bacteria 3555
283 Ga0373945_0014769 3300035116 Bacteria 2621
284 Ga0373943_0004578 3300035170 Bacteria 6247
285 Ga0373943_0029719 3300035170 Bacteria 2582
286 Ga0373961_0005174 3300035241 Unclassified 3137
287 Ga0373962_0010083 3300035242 Unclassified 2350
288 Ga0373931_0002278 3300035691 Bacteria 8481
289 Ga0373931_0004074 3300035691 Bacteria 6626
290 Ga0373935_0001928 3300035692 Bacteria 11662
291 Ga0373935_0034793 3300035692 Bacteria 3142
292 Ga0373927_0005838 3300035695 Bacteria 8442
293 Ga0373947_0032872 3300035725 Bacteria 3059
294 Ga0373937_0010649 3300036401 Bacteria 8039
295 Ga0373925_0011822 3300037068 Bacteria 6317
296 Ga0373925_0020997 3300037068 Bacteria 4758
297 Ga0373925_0156702 3300037068 Bacteria 1791
298 Ga0395900_0100034 3300037418 Bacteria 2978
299 Ga0436364_0207258 3300037853 Bacteria 22246
300 Ga0436365_0448718 3300039437 Bacteria 5773
301 Ga0436365_0774047 3300039437 Bacteria 3429
302 Ga0439461_0000816 3300041410 Bacteria 4599
303 Ga0439446_0003471 3300042156 Bacteria 3920
304 Ga0439434_0003040 3300042435 Bacteria 4918
305 Ga0439435_0000222 3300042436 Bacteria 8087
306 Ga0439460_0011922 3300042461 Bacteria 2247
307 Ga0451577_0000727 3300042876 Bacteria 51041
308 Ga0451577_0050615 3300042876 Bacteria 3708
309 Ga0453683_0051176 3300044673 Bacteria 2588
310 Ga0466964_0017896 3300044706 Bacteria 2715
311 Ga0466959_0068155 3300045049 Bacteria 2579
312 Ga0451576_0001861 3300045051 Bacteria 34059
313 Ga0451576_0012423 3300045051 Bacteria 9565
314 Ga0451576_0016906 3300045051 Bacteria 8034
315 Ga0451576_0238329 3300045051 Bacteria 1900
316 Ga0466967_0116924 3300045976 Bacteria 2457
317 Ga0466967_0227632 3300045976 Bacteria 1774
318 Ga0495627_010575 3300046453 Bacteria 3348
319 Ga0495603_0004531 3300046455 Bacteria 8293
320 Ga0495580_0001071 3300046472 Bacteria 24057
321 Ga0495580_0002399 3300046472 Bacteria 16371
322 Ga0495582_0030714 3300046473 Bacteria 2951
323 Ga0495605_0012248 3300046474 Bacteria 4762
324 Ga0495639_0003391 3300046475 Bacteria 6905
325 Ga0495585_0058234 3300046492 Bacteria 2131
326 Ga0495606_0000901 3300046507 Bacteria 44189
327 Ga0495616_0011983 3300046513 Bacteria 4936
328 Ga0495643_0038512 3300046522 Bacteria 2618
329 Ga0495586_0009323 3300046535 Bacteria 5221
330 Ga0495667_0001460 3300046559 Bacteria 15551
331 Ga0495611_0045360 3300046648 Bacteria 1968
332 Ga0495625_0040531 3300046660 Bacteria 3395
333 Ga0495588_0031502 3300046674 Bacteria 2669
334 Ga0495647_0007074 3300046681 Bacteria 3744
335 Ga0495669_0090244 3300046684 Unclassified 1414
336 Ga0495660_0067576 3300046810 Bacteria 1903
337 Ga0495687_000108 3300047443 Bacteria 126739
338 Ga0495679_010662 3300047446 Bacteria 3596
339 Ga0495681_0047554 3300047470 Bacteria 2040
340 Ga0496112_0000056 3300048915 Bacteria 77708
341 Ga0496121_0014477 3300048924 Bacteria 8365
342 Ga0496122_0013132 3300048925 Bacteria 8143
343 Ga0496123_0011247 3300048926 Bacteria 7783
344 Ga0496124_0000007 3300048927 Bacteria 883534
345 Ga0501032_0038096 3300049569 Bacteria 3276
346 Ga0501033_0094402 3300049570 Bacteria 2187
347 Ga0501034_0018472 3300049571 Bacteria 7150
348 Ga0501036_0012523 3300049572 Bacteria 7033
349 Ga0501038_0006366 3300049574 Bacteria 10928
350 Ga0501039_0008896 3300049575 Bacteria 7650
351 Ga0501040_0000589 3300049576 Bacteria 22156
352 Ga0501040_0033701 3300049576 Bacteria 3471
353 Ga0501041_0000542 3300049577 Bacteria 19525
354 Ga0501041_0002333 3300049577 Bacteria 10736
355 Ga0501042_0003164 3300049578 Bacteria 10264
356 Ga0501042_0030051 3300049578 Bacteria 3836
357 Ga0501046_0004322 3300049580 Bacteria 12931
358 Ga0501046_0038961 3300049580 Bacteria 3810
359 Ga0501047_0004029 3300049581 Bacteria 13816
360 Ga0501048_0003209 3300049582 Bacteria 12458
361 Ga0501069_0000715 3300049585 Bacteria 15504
362 Ga0501069_0026066 3300049585 Bacteria 3201
363 Ga0501070_0006647 3300049586 Bacteria 9845
364 Ga0501071_0003745 3300049587 Bacteria 9549
365 Ga0501072_0009227 3300049588 Bacteria 7497
366 Ga0501072_0009584 3300049588 Bacteria 7365
367 Ga0501073_0000686 3300049589 Bacteria 23798
368 Ga0501074_0002270 3300049590 Bacteria 13365
369 Ga0501074_0026893 3300049590 Bacteria 4170
370 Ga0501074_0107679 3300049590 Bacteria 1995
371 Ga0501075_0003047 3300049591 Bacteria 11195
372 Ga0501075_0003488 3300049591 Bacteria 10514
373 Ga0501076_0001452 3300049592 Bacteria 15936
374 Ga0501076_0004688 3300049592 Bacteria 9746
375 Ga0501077_0001702 3300049593 Bacteria 13261
376 Ga0501077_0025280 3300049593 Bacteria 3772
377 Ga0501079_0003201 3300049741 Bacteria 11994
378 Ga0501079_0004482 3300049741 Bacteria 10360
379 Ga0501079_0033025 3300049741 Bacteria 3980
380 Ga0501080_0007015 3300049742 Bacteria 10174
381 Ga0501080_0050672 3300049742 Bacteria 3864
382 Ga0501081_0000846 3300049743 Bacteria 18080
383 Ga0501081_0048058 3300049743 Bacteria 2936
384 Ga0501083_0012855 3300049744 Bacteria 5854
385 Ga0501083_0041039 3300049744 Bacteria 3140
386 Ga0501035_0000881 3300049822 Bacteria 31845
387 Ga0501044_0005104 3300049823 Bacteria 14649
388 Ga0501045_0000845 3300049824 Bacteria 19872
389 Ga0501045_0001470 3300049824 Bacteria 15660
390 Ga0501045_0070904 3300049824 Bacteria 2564
391 nmdc:mga00v17_9562_c1 3300050491 Bacteria 5253
392 nmdc:mga0yw44_25175_c1 3300050492 Bacteria 3379
393 nmdc:mga0yw44_37866_c1 3300050492 Bacteria 2851
394 nmdc:mga0k408_11517_c1 3300050493 Bacteria 4820
395 nmdc:mga05p37_28821_c1 3300050507 Bacteria 6773
396 nmdc:mga05p37_706_c1 3300050507 Bacteria 37016
397 nmdc:mga09592_1295_c1 3300050508 Bacteria 20096
398 nmdc:mga09592_161488_c1 3300050508 Bacteria 1936
399 nmdc:mga09592_48195_c1 3300050508 Bacteria 3592
400 nmdc:mga09592_722_c1 3300050508 Bacteria 25393
401 nmdc:mga0qj67_22609_c1 3300050509 Bacteria 4830
402 nmdc:mga0qj67_6379_c1 3300050509 Bacteria 8665
403 nmdc:mga0qj67_80151_c1 3300050509 Bacteria 2616
404 nmdc:mga06r32_19227_c1 3300050510 Bacteria 6269
405 nmdc:mga06r32_63287_c1 3300050510 Bacteria 3565
406 nmdc:mga08y16_10502_c1 3300050511 Bacteria 9714
407 nmdc:mga08y16_202249_c1 3300050511 Bacteria 2058
408 nmdc:mga08y16_205592_c1 3300050511 Bacteria 2040
409 nmdc:mga08y16_39188_c1 3300050511 Bacteria 4972
410 nmdc:mga08y16_80471_c1 3300050511 Bacteria 3397
411 nmdc:mga0n895_20879_c1 3300050512 Bacteria 6118
412 nmdc:mga0n895_228102_c1 3300050512 Unclassified 1891
413 nmdc:mga0n895_38541_c1 3300050512 Bacteria 4632
414 nmdc:mga0n895_93273_c1 3300050512 Bacteria 3014
415 nmdc:mga0rr50_15053_c1 3300050513 Bacteria 5096
416 nmdc:mga0rr50_637_c1 3300050513 Bacteria 18855
417 nmdc:mga08x19_2357_c1 3300050514 Bacteria 11455
418 nmdc:mga0a205_3036_c1 3300050515 Bacteria 14877
419 nmdc:mga0a205_3946_c1 3300050515 Bacteria 13277
420 nmdc:mga0a205_60019_c1 3300050515 Bacteria 3673
421 nmdc:mga0a205_80681_c1 3300050515 Bacteria 3143
422 Ga0500646_0002782 3300053090 Bacteria 4499
423 Ga0500594_0001189 3300053118 Bacteria 5613
424 Ga0500604_0001412 3300053151 Bacteria 6696
425 Ga0501084_0003771 3300054114 Bacteria 12318
426 Ga0501082_0004597 3300060353 Bacteria 12054
427 Ga0501082_0044050 3300060353 Bacteria 3849
428 Ga0501082_0203448 3300060353 Bacteria 1723
429 Ga0530510_0007741 3300061734 Bacteria 7483
430 2516018702 2515154189 Bacteria 9629850
431 2644304301 2643221654 Bacteria 5273570
432 2738722520 2738541277 Bacteria 7458140
433 2738745980 2738541281 Bacteria 5112672
434 2738885673 2738541307 Bacteria 8606193
435 2739283091 2738543019 Bacteria 7459457
436 2739355210 2738543032 Bacteria 5115625
437 2855731082 2855730933 Bacteria 7047938
438 2855770317 2855767633 Bacteria 7049357
439 2857544126 2857542790 Bacteria 5326616
440 2881414540 2881412998 Bacteria 6492157
441 2883090197 2883087390 Bacteria 9532701
442 2889307423 2889306138 Bacteria 6358934
443 2904549588 2904541872 Bacteria 8915136
444 2929166672 2929160207 Bacteria 9075316
445 Ga0496121_0066304
446 JGI25151J46595_10000277
447 JGI25151J46595_10002083
448 Ga0065707_10002319
449 Ga0070658_10028753
450 Ga0070658_10060135
451 Ga0070658_10088281
452 Ga0070676_10019803
453 Ga0070690_100002436
454 Ga0070690_100053404
455 Ga0070690_100137406
456 Ga0070670_100002192
457 Ga0070670_100004521
458 Ga0070670_100045764
459 Ga0070670_100046054
460 Ga0068869_100002396
461 Ga0068869_100010509
462 Ga0070680_100001010
463 Ga0070680_100072251
464 Ga0070682_100002448
465 Ga0068868_100000230
466 Ga0070660_100006454
467 Ga0070689_100006601
468 Ga0070689_100037330
469 Ga0070691_10000565
470 Ga0070687_100000189
471 Ga0070661_100134517
472 Ga0070692_10001504
473 Ga0070668_100012167
474 Ga0070669_100002895
475 Ga0070669_100058707
476 Ga0070675_100027997
477 Ga0070674_100028855
478 Ga0070673_100046157
479 Ga0070673_100088549
480 Ga0070659_100013815
481 Ga0070659_100100769
482 Ga0070703_10011234
483 Ga0070709_10043952
484 Ga0070714_100065245
485 Ga0070713_100000089
486 Ga0070713_100029603
487 Ga0070701_10014041
488 Ga0070711_100040438
489 Ga0070705_100001677
490 Ga0070705_100019319
491 Ga0070705_100023848
492 Ga0070705_100052741
493 Ga0070700_100000145
494 Ga0070700_100000624
495 Ga0070694_100000630
496 Ga0070694_100000760
497 Ga0070694_100008697
498 Ga0070708_100017768
499 Ga0070663_100004210
500 Ga0070678_100065328
501 Ga0070662_100025434
502 Ga0070662_100069629
503 Ga0070681_10000797
504 Ga0070681_10176757
505 Ga0068867_100001184
506 Ga0068867_100004570
507 Ga0070707_100084302
508 Ga0070707_100098573
509 Ga0070698_100114129
510 Ga0070679_100070605
511 Ga0070684_100002259
512 Ga0070684_100055684
513 Ga0070697_100141319
514 Ga0068853_100004055
515 Ga0068853_100109093
516 Ga0070672_100011065
517 Ga0070686_100004982
518 Ga0070695_100000178
519 Ga0070696_100000248
520 Ga0070693_100000907
521 Ga0070665_100136731
522 Ga0070704_100002183
523 Ga0068855_100004185
524 Ga0068855_100007211
525 Ga0068855_100055002
526 Ga0068855_100078226
527 Ga0068855_100114440
528 Ga0068856_100002661
529 Ga0068856_100004214
530 Ga0068856_100193469
531 Ga0070702_100000014
532 Ga0068852_100000605
533 Ga0068852_100008344
534 Ga0068852_100017306
535 Ga0068859_100006357
536 Ga0068859_100009703
537 Ga0068859_100030367
538 Ga0068859_100038385
539 Ga0068864_100010186
540 Ga0068864_100081831
541 Ga0068866_10000795
542 Ga0068861_100000581
543 Ga0068861_100006739
544 Ga0068861_100058851
545 Ga0068863_100002279
546 Ga0068863_100035261
547 Ga0068858_100008180
548 Ga0068858_100031516
549 Ga0068860_100002447
550 Ga0068862_100005876
551 Ga0068862_100017243
552 Ga0068862_100046115
553 Ga0068862_100137932
554 Ga0081538_10016457
555 Ga0075365_10036348
556 Ga0075368_10000576
557 Ga0075363_100009919
558 Ga0075364_10012475
559 Ga0075362_10002668
560 Ga0075367_10032528
561 Ga0075369_10000297
562 Ga0075366_10017257
563 Ga0097621_100000525
564 Ga0068871_100003821
565 Ga0068871_100040320
566 Ga0068871_100094916
567 Ga0075428_100000946
568 Ga0075428_100014219
569 Ga0075430_100050090
570 Ga0075430_100079326
571 Ga0075431_100076897
572 Ga0075431_100197242
573 Ga0075431_100206864
574 Ga0075433_10020907
575 Ga0075433_10045916
576 Ga0075433_10082986
577 Ga0075434_100003192
578 Ga0075434_100015251
579 Ga0075434_100071151
580 Ga0075434_100114963
581 Ga0075429_100000078
582 Ga0075429_100000916
583 Ga0068865_100000645
584 Ga0068865_100062093
585 Ga0097620_100006357
586 Ga0097620_100009703
587 Ga0097620_100030366
588 Ga0097620_100038384
589 Ga0105240_10006838
590 Ga0105240_10081084
591 Ga0105240_10105288
592 Ga0105240_10132571
593 Ga0111539_10001323
594 Ga0111539_10008054
595 Ga0111539_10029712
596 Ga0111539_10109690
597 Ga0111539_10152387
598 Ga0111539_10187141
599 Ga0105245_10001140
600 Ga0114129_10000817
601 Ga0105243_10001625
602 Ga0105243_10216029
603 Ga0105241_10002470
604 Ga0105241_10002892
605 Ga0105241_10021675
606 Ga0105242_10000289
607 Ga0105242_10000610
608 Ga0105242_10065923
609 Ga0105238_10021696
610 Ga0105249_10004525
611 Ga0105239_10060411
612 Ga0157370_10001450
613 Ga0157370_10079417
614 Ga0157369_10002637
615 Ga0157369_10002981
616 Ga0157369_10043791
617 Ga0157378_10001659
618 Ga0163162_10068762
619 Ga0157372_10002247
620 Ga0157372_10065567
621 Ga0157372_10199621
622 Ga0163163_10016237
623 Ga0157380_10023456
624 Ga0157380_10062178
625 Ga0157379_10075029
626 Ga0157376_10006725
627 Ga0157376_10010532
628 Ga0206354_10252641
629 Ga0213875_10001830
630 Ga0209025_1000003
631 Ga0209025_1000139
632 Ga0207653_10017024
633 Ga0207643_10019721
634 Ga0207643_10052377
635 Ga0207705_10016546
636 Ga0207705_10037932
637 Ga0207654_10094263
638 Ga0207707_10009453
639 Ga0207707_10136551
640 Ga0207695_10023085
641 Ga0207695_10063032
642 Ga0207662_10000021
643 Ga0207652_10002600
644 Ga0207652_10008198
645 Ga0207652_10049074
646 Ga0207646_10084332
647 Ga0207681_10001295
648 Ga0207694_10014388
649 Ga0207650_10002060
650 Ga0207659_10010734
651 Ga0207687_10000833
652 Ga0207700_10000235
653 Ga0207700_10114448
654 Ga0207690_10069885
655 Ga0207706_10017256
656 Ga0207706_10117010
657 Ga0207686_10004250
658 Ga0207686_10069511
659 Ga0207709_10001152
660 Ga0207704_10000327
661 Ga0207704_10042379
662 Ga0207691_10003477
663 Ga0207689_10003628
664 Ga0207689_10017733
665 Ga0207679_10050037
666 Ga0207679_10072876
667 Ga0207667_10004978
668 Ga0207667_10030141
669 Ga0207667_10036902
670 Ga0207667_10044362
671 Ga0207667_10057578
672 Ga0207651_10081319
673 Ga0207712_10002735
674 Ga0207668_10003085
675 Ga0207668_10037300
676 Ga0207640_10015467
677 Ga0207677_10023229
678 Ga0207703_10001923
679 Ga0207708_10000231
680 Ga0207708_10004016
681 Ga0207708_10062093
682 Ga0207708_10077896
683 Ga0207702_10003871
684 Ga0207702_10022253
685 Ga0207641_10027034
686 Ga0207641_10121947
687 Ga0207641_10185691
688 Ga0207648_10000930
689 Ga0207648_10002716
690 Ga0207648_10011509
691 Ga0207648_10059786
692 Ga0207676_10002040
693 Ga0207676_10067968
694 Ga0207674_10002850
695 Ga0207674_10101748
696 Ga0207675_100000086
697 Ga0207675_100012824
698 Ga0207675_100080170
699 Ga0207683_10011255
700 Ga0207698_10006264
701 Ga0207698_10006325
702 Ga0207698_10043248
703 Ga0207698_10157571
704 Ga0209981_1001197
705 Ga0210000_1004072
706 Ga0207428_10000582
707 Ga0207428_10001039
708 Ga0207428_10065239
709 Ga0268266_10114521
710 Ga0268265_10000621
711 Ga0268265_10010527
712 Ga0268264_10001620
713 Ga0265338_10000045
714 Ga0265338_10011359
715 Ga0307511_10000005
716 Ga0265327_10022057
717 Ga0265327_10041468
718 Ga0307408_100109180
719 Ga0307507_10058819
720 Ga0373926_0038149
721 Ga0373940_0001156
722 Ga0373944_0002957
723 Ga0373936_0003409
724 Ga0373936_0007958
725 Ga0373939_0020924
726 Ga0373941_0003512
727 Ga0373945_0014769
728 Ga0373943_0004578
729 Ga0373943_0029719
730 Ga0373961_0005174
731 Ga0373962_0010083
732 Ga0373931_0002278
733 Ga0373931_0004074
734 Ga0373935_0001928
735 Ga0373935_0034793
736 Ga0373927_0005838
737 Ga0373947_0032872
738 Ga0373937_0010649
739 Ga0373925_0011822
740 Ga0373925_0020997
741 Ga0373925_0156702
742 Ga0395900_0100034
743 Ga0436364_0207258
744 Ga0436365_0448718
745 Ga0436365_0774047
746 Ga0439461_0000816
747 Ga0439446_0003471
748 Ga0439434_0003040
749 Ga0439435_0000222
750 Ga0439460_0011922
751 Ga0451577_0000727
752 Ga0451577_0050615
753 Ga0453683_0051176
754 Ga0466964_0017896
755 Ga0466959_0068155
756 Ga0451576_0001861
757 Ga0451576_0012423
758 Ga0451576_0016906
759 Ga0451576_0238329
760 Ga0466967_0116924
761 Ga0466967_0227632
762 Ga0495627_010575
763 Ga0495603_0004531
764 Ga0495580_0001071
765 Ga0495580_0002399
766 Ga0495582_0030714
767 Ga0495605_0012248
768 Ga0495639_0003391
769 Ga0495585_0058234
770 Ga0495606_0000901
771 Ga0495616_0011983
772 Ga0495643_0038512
773 Ga0495586_0009323
774 Ga0495667_0001460
775 Ga0495611_0045360
776 Ga0495625_0040531
777 Ga0495588_0031502
778 Ga0495647_0007074
779 Ga0495669_0090244
780 Ga0495660_0067576
781 Ga0495687_000108
782 Ga0495679_010662
783 Ga0495681_0047554
784 Ga0496112_0000056
785 Ga0496121_0014477
786 Ga0496122_0013132
787 Ga0496123_0011247
788 Ga0496124_0000007
789 Ga0501032_0038096
790 Ga0501033_0094402
791 Ga0501034_0018472
792 Ga0501036_0012523
793 Ga0501038_0006366
794 Ga0501039_0008896
795 Ga0501040_0000589
796 Ga0501040_0033701
797 Ga0501041_0000542
798 Ga0501041_0002333
799 Ga0501042_0003164
800 Ga0501042_0030051
801 Ga0501046_0004322
802 Ga0501046_0038961
803 Ga0501047_0004029
804 Ga0501048_0003209
805 Ga0501069_0000715
806 Ga0501069_0026066
807 Ga0501070_0006647
808 Ga0501071_0003745
809 Ga0501072_0009227
810 Ga0501072_0009584
811 Ga0501073_0000686
812 Ga0501074_0002270
813 Ga0501074_0026893
814 Ga0501074_0107679
815 Ga0501075_0003047
816 Ga0501075_0003488
817 Ga0501076_0001452
818 Ga0501076_0004688
819 Ga0501077_0001702
820 Ga0501077_0025280
821 Ga0501079_0003201
822 Ga0501079_0004482
823 Ga0501079_0033025
824 Ga0501080_0007015
825 Ga0501080_0050672
826 Ga0501081_0000846
827 Ga0501081_0048058
828 Ga0501083_0012855
829 Ga0501083_0041039
830 Ga0501035_0000881
831 Ga0501044_0005104
832 Ga0501045_0000845
833 Ga0501045_0001470
834 Ga0501045_0070904
835 nmdc:mga00v17_9562_c1
836 nmdc:mga0yw44_25175_c1
837 nmdc:mga0yw44_37866_c1
838 nmdc:mga0k408_11517_c1
839 nmdc:mga05p37_28821_c1
840 nmdc:mga05p37_706_c1
841 nmdc:mga09592_1295_c1
842 nmdc:mga09592_161488_c1
843 nmdc:mga09592_48195_c1
844 nmdc:mga09592_722_c1
845 nmdc:mga0qj67_22609_c1
846 nmdc:mga0qj67_6379_c1
847 nmdc:mga0qj67_80151_c1
848 nmdc:mga06r32_19227_c1
849 nmdc:mga06r32_63287_c1
850 nmdc:mga08y16_10502_c1
851 nmdc:mga08y16_202249_c1
852 nmdc:mga08y16_205592_c1
853 nmdc:mga08y16_39188_c1
854 nmdc:mga08y16_80471_c1
855 nmdc:mga0n895_20879_c1
856 nmdc:mga0n895_228102_c1
857 nmdc:mga0n895_38541_c1
858 nmdc:mga0n895_93273_c1
859 nmdc:mga0rr50_15053_c1
860 nmdc:mga0rr50_637_c1
861 nmdc:mga08x19_2357_c1
862 nmdc:mga0a205_3036_c1
863 nmdc:mga0a205_3946_c1
864 nmdc:mga0a205_60019_c1
865 nmdc:mga0a205_80681_c1
866 Ga0500646_0002782
867 Ga0500594_0001189
868 Ga0500604_0001412
869 Ga0501084_0003771
870 Ga0501082_0004597
871 Ga0501082_0044050
872 Ga0501082_0203448
873 Ga0530510_0007741
874 2516018702
875 2644304301
876 2738722520
877 2738745980
878 2738885673
879 2739283091
880 2739355210
881 2855731082
882 2855770317
883 2857544126
884 2881414540
885 2883090197
886 2889307423
887 2904549588
888 2929166672

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02776

TPP_enzyme_N

Thiamine pyrophosphate enzyme, N-terminal TPP binding domain

22

138

0.97

PF00205

TPP_enzyme_M

Thiamine pyrophosphate enzyme, central domain

210

322

0.92

PF02775

TPP_enzyme_C

Thiamine pyrophosphate enzyme, C-terminal TPP binding domain

422

567

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
8i08-assembly1.cif.gz_A crystal structure of escherichia coli glyoxylate carboligase quadruple mutant 0.881 6 521
1upc-assembly1.cif.gz_C carboxyethylarginine synthase from streptomyces clavuligerus 0.8792 5 519
1upb-assembly1.cif.gz_A carboxyethylarginine synthase from streptomyces clavuligerus 0.8783 5 519
8i05-assembly1.cif.gz_A crystal structure of escherichia coli glyoxylate carboligase double mutant 0.8775 6 521
4qq8-assembly1.cif.gz_B crystal structure of the formolase fls in space group p 43 21 2 0.8772 6 524
ID Description Score Start End Superfamily
af_Q9UJ83_3_186_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.97 5 168 3.40.50.970
5dx6A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9653 6 177 3.40.50.970
af_Q9Y7M1_1_173_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9587 5 175 3.40.50.970
af_P9WG39_1_179_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9575 1 168 3.40.50.970
2c31A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9538 5 168 3.40.50.970
ID Description Score Start End GO Terms
AF-S9SC34-F1-model_v4 Thiamine pyrophosphate enzyme, N-terminal TPP binding domain protein 0.9778 22 156 GO:0003984
GO:0005948
GO:0009097
GO:0009099
GO:0030976
GO:0050660
AF-A0A0N8PRT6-F1-model_v4 Acetolactate synthase 0.9774 5 127 GO:0003984
GO:0005948
GO:0009097
GO:0009099
GO:0030976
GO:0050660
AF-A0A7L3CF79-F1-model_v4 ILVBL protein 0.9769 66 168 GO:0003984
GO:0005948
GO:0009097
GO:0009099
GO:0030976
GO:0050660
AF-A0A3B9IL66-F1-model_v4 Thiamine pyrophosphate protein central region 0.9745 2 150 GO:0003984
GO:0005948
GO:0009097
GO:0009099
GO:0030976
GO:0050660
AF-A0A434SL68-F1-model_v4 Thiamine pyrophosphate-binding protein 0.9741 5 172 GO:0003984
GO:0005948
GO:0009097
GO:0009099
GO:0030976
GO:0050660

Map