F445364

General Info

Members Datasets Scaffolds Average Seq Length
444 240 888 80

Family's Representative Sequence

Representative Sequence 3300049588|Ga0501072_0150590|Ga0501072_0150590_1406_1690
Length 94
Sequence LGRLRFNARAQTHGAVMADPKQLLHLVFGGELESADEVTFKDLGKLDFVGMYPNFAEAKKAWAAKAQATVDNAQMRYFVVHIHRLIEPEADREH

Samples

Sample ID Description Type Environment
1 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
124 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
125 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
126 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
127 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
128 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
129 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
136 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
137 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
138 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
140 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
141 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
151 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
152 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
153 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
154 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
155 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
156 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
157 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
202 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
209 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
216 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
217 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
218 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
219 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
220 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
227 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
228 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
229 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
230 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
231 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
232 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
233 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
234 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
235 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
236 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
239 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
240 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.11
Nodule 0.23
Rhizoplane 6.31
Rhizosphere 82.88
Stem 0
Stem Tuber 0
Unclassified 13.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501072_0150590 3300049588 Bacteria 1855
2 JGI24740J21852_10047147 3300001979 Bacteria 1260
3 JGI24740J21852_10057839 3300001979 Bacteria 1081
4 JGI25153J46596_10001205 3300003215 Bacteria 15650
5 rootH2_10061914 3300003320 Bacteria 1768
6 Ga0070658_10639595 3300005327 Bacteria 923
7 Ga0070658_10656471 3300005327 Bacteria 910
8 Ga0070676_11293561 3300005328 Bacteria 557
9 Ga0068869_100546569 3300005334 Bacteria 972
10 Ga0068869_100722388 3300005334 Bacteria 851
11 Ga0070680_101837543 3300005336 Bacteria 525
12 Ga0070680_101988721 3300005336 Unclassified 504
13 Ga0070660_100102026 3300005339 Bacteria 2274
14 Ga0070660_100794413 3300005339 Unclassified 796
15 Ga0070691_10318947 3300005341 Unclassified 854
16 Ga0070661_100211452 3300005344 Bacteria 1485
17 Ga0070668_100365960 3300005347 Unclassified 1224
18 Ga0070668_101051283 3300005347 Bacteria 733
19 Ga0070671_101807047 3300005355 Bacteria 543
20 Ga0070674_100240911 3300005356 Bacteria 1416
21 Ga0070659_100004063 3300005366 Bacteria 10436
22 Ga0070659_101897609 3300005366 Bacteria 534
23 Ga0070714_100017309 3300005435 Bacteria 5837
24 Ga0070714_100827875 3300005435 Unclassified 897
25 Ga0070713_100000004 3300005436 Bacteria 220768
26 Ga0070713_101052020 3300005436 Bacteria 786
27 Ga0070710_10223193 3300005437 Bacteria 1200
28 Ga0070710_10318076 3300005437 Unclassified 1021
29 Ga0070711_100020746 3300005439 Bacteria 4240
30 Ga0070711_100037853 3300005439 Bacteria 3239
31 Ga0070711_100143292 3300005439 Bacteria 1794
32 Ga0070705_101844807 3300005440 Unclassified 513
33 Ga0070700_101674234 3300005441 Bacteria 545
34 Ga0070678_100151084 3300005456 Bacteria 1871
35 Ga0070662_100762702 3300005457 Bacteria 821
36 Ga0070681_11360957 3300005458 Bacteria 633
37 Ga0068867_100452341 3300005459 Bacteria 1094
38 Ga0070679_101249174 3300005530 Unclassified 688
39 Ga0070684_100127100 3300005535 Bacteria 2297
40 Ga0068853_100427305 3300005539 Bacteria 1243
41 Ga0068853_100499512 3300005539 Bacteria 1148
42 Ga0068853_101026890 3300005539 Bacteria 794
43 Ga0068853_101627552 3300005539 Bacteria 626
44 Ga0070672_101620306 3300005543 Bacteria 581
45 Ga0070695_100407964 3300005545 Bacteria 1032
46 Ga0070696_100122022 3300005546 Bacteria 1887
47 Ga0070696_100205986 3300005546 Unclassified 1470
48 Ga0070693_100032622 3300005547 Bacteria 2866
49 Ga0068855_100098101 3300005563 Bacteria 3376
50 Ga0070664_102079056 3300005564 Unclassified 539
51 Ga0068857_100127398 3300005577 Bacteria 2294
52 Ga0068857_100187531 3300005577 Bacteria 1883
53 Ga0068857_100278608 3300005577 Bacteria 1538
54 Ga0068857_100458087 3300005577 Bacteria 1193
55 Ga0068856_100000474 3300005614 Bacteria 44385
56 Ga0068856_101146976 3300005614 Bacteria 794
57 Ga0068856_102273629 3300005614 Unclassified 551
58 Ga0070702_100528236 3300005615 Bacteria 872
59 Ga0068852_101249613 3300005616 Unclassified 764
60 Ga0068864_100101336 3300005618 Bacteria 2554
61 Ga0068864_100351210 3300005618 Unclassified 1391
62 Ga0068858_100068155 3300005842 Bacteria 3297
63 Ga0068858_102021961 3300005842 Bacteria 570
64 Ga0068862_100222302 3300005844 Unclassified 1710
65 Ga0081455_10000894 3300005937 Bacteria 38467
66 Ga0075363_100014511 3300006048 Bacteria 3852
67 Ga0075364_10113108 3300006051 Bacteria 1813
68 Ga0075432_10055236 3300006058 Bacteria 1407
69 Ga0075432_10588603 3300006058 Bacteria 507
70 Ga0070712_100000396 3300006175 Bacteria 24801
71 Ga0070712_100002805 3300006175 Bacteria 10774
72 Ga0070712_100183789 3300006175 Bacteria 1631
73 Ga0070712_100501648 3300006175 Bacteria 1017
74 Ga0070712_101128814 3300006175 Unclassified 681
75 Ga0075362_10035266 3300006177 Bacteria 2183
76 Ga0075362_10192949 3300006177 Bacteria 990
77 Ga0075367_10499047 3300006178 Bacteria 772
78 Ga0075369_10003492 3300006186 Bacteria 5725
79 Ga0075369_10303906 3300006186 Bacteria 745
80 Ga0075366_10000662 3300006195 Bacteria 16222
81 Ga0097621_100016270 3300006237 Bacteria 5617
82 Ga0097621_100270811 3300006237 Unclassified 1492
83 Ga0075370_11029773 3300006353 Bacteria 505
84 Ga0075428_100770768 3300006844 Bacteria 1023
85 Ga0075433_10004023 3300006852 Bacteria 11369
86 Ga0075434_100196460 3300006871 Unclassified 2037
87 Ga0075434_100274825 3300006871 Bacteria 1704
88 Ga0068865_100179506 3300006881 Bacteria 1629
89 Ga0075436_100000187 3300006914 Bacteria 38576
90 Ga0075436_101012469 3300006914 Unclassified 624
91 Ga0075435_100004990 3300007076 Bacteria 9212
92 Ga0075435_100986422 3300007076 Unclassified 735
93 Ga0105240_10583318 3300009093 Bacteria 1233
94 Ga0105240_11342014 3300009093 Bacteria 753
95 Ga0111539_10052846 3300009094 Bacteria 4836
96 Ga0111539_10065100 3300009094 Bacteria 4310
97 Ga0105245_11108921 3300009098 Bacteria 838
98 Ga0105247_11427314 3300009101 Bacteria 561
99 Ga0114129_10136747 3300009147 Bacteria 3362
100 Ga0105241_10523832 3300009174 Unclassified 1060
101 Ga0105241_10940425 3300009174 Bacteria 805
102 Ga0105242_10015932 3300009176 Bacteria 5841
103 Ga0105242_12494787 3300009176 Bacteria 565
104 Ga0105237_10363969 3300009545 Bacteria 1450
105 Ga0105237_12113592 3300009545 Bacteria 572
106 Ga0105238_10319394 3300009551 Bacteria 1539
107 Ga0105238_10777513 3300009551 Bacteria 972
108 Ga0105238_11225461 3300009551 Unclassified 775
109 Ga0105238_11521734 3300009551 Bacteria 698
110 Ga0105238_11757286 3300009551 Bacteria 652
111 Ga0105238_12473537 3300009551 Bacteria 555
112 Ga0105249_10512607 3300009553 Bacteria 1246
113 Ga0105239_10008191 3300010375 Bacteria 11924
114 Ga0105239_10675538 3300010375 Bacteria 1180
115 Ga0105239_11694145 3300010375 Unclassified 732
116 Ga0157370_10123840 3300013104 Bacteria 2414
117 Ga0157374_10484065 3300013296 Bacteria 1241
118 Ga0157374_12197873 3300013296 Bacteria 579
119 Ga0157378_10325535 3300013297 Unclassified 1494
120 Ga0157378_10493084 3300013297 Bacteria 1222
121 Ga0163162_10160816 3300013306 Bacteria 2367
122 Ga0163162_10185765 3300013306 Bacteria 2206
123 Ga0157372_11143460 3300013307 Bacteria 900
124 Ga0157375_10044238 3300013308 Bacteria 4324
125 Ga0163163_10002034 3300014325 Bacteria 17099
126 Ga0163163_10936025 3300014325 Bacteria 930
127 Ga0163163_12835803 3300014325 Bacteria 541
128 Ga0182008_10121636 3300014497 Bacteria 1298
129 Ga0157379_10001633 3300014968 Bacteria 18510
130 Ga0157379_10139787 3300014968 Bacteria 2183
131 Ga0157376_10457216 3300014969 Unclassified 1247
132 Ga0213873_10029598 3300021358 Bacteria 1351
133 Ga0213876_10051604 3300021384 Bacteria 2174
134 Ga0209563_111525 3300025230 Unclassified 1245
135 Ga0209455_1023947 3300025272 Bacteria 1135
136 Ga0209758_1000013 3300025297 Bacteria 873003
137 Ga0209758_1160721 3300025297 Bacteria 559
138 Ga0207692_10067664 3300025898 Unclassified 1871
139 Ga0207647_10149245 3300025904 Unclassified 1367
140 Ga0207699_10000307 3300025906 Bacteria 26162
141 Ga0207645_10505879 3300025907 Bacteria 818
142 Ga0207705_11403370 3300025909 Bacteria 531
143 Ga0207654_10391422 3300025911 Bacteria 965
144 Ga0207707_11092387 3300025912 Bacteria 650
145 Ga0207695_10109081 3300025913 Bacteria 2751
146 Ga0207695_10271190 3300025913 Bacteria 1592
147 Ga0207695_11560689 3300025913 Bacteria 541
148 Ga0207671_10034474 3300025914 Bacteria 3760
149 Ga0207671_10273222 3300025914 Bacteria 1332
150 Ga0207671_11170163 3300025914 Unclassified 602
151 Ga0207693_10001040 3300025915 Bacteria 24829
152 Ga0207693_10001139 3300025915 Bacteria 23823
153 Ga0207663_10015612 3300025916 Bacteria 4194
154 Ga0207663_10046901 3300025916 Bacteria 2665
155 Ga0207663_10208637 3300025916 Bacteria 1414
156 Ga0207660_11466738 3300025917 Bacteria 552
157 Ga0207657_10205788 3300025919 Bacteria 1581
158 Ga0207652_10418580 3300025921 Bacteria 1208
159 Ga0207652_11791104 3300025921 Unclassified 519
160 Ga0207694_10274826 3300025924 Bacteria 1382
161 Ga0207694_10597556 3300025924 Unclassified 928
162 Ga0207694_10982101 3300025924 Bacteria 714
163 Ga0207687_10147104 3300025927 Bacteria 1793
164 Ga0207700_10000011 3300025928 Bacteria 266323
165 Ga0207700_10067079 3300025928 Bacteria 2745
166 Ga0207700_10896107 3300025928 Bacteria 794
167 Ga0207664_10453297 3300025929 Unclassified 1145
168 Ga0207664_10654136 3300025929 Unclassified 945
169 Ga0207690_10021630 3300025932 Bacteria 3991
170 Ga0207690_11418894 3300025932 Bacteria 581
171 Ga0207706_10329898 3300025933 Bacteria 1327
172 Ga0207686_10037336 3300025934 Bacteria 2930
173 Ga0207669_10759472 3300025937 Bacteria 801
174 Ga0207704_10018343 3300025938 Bacteria 3650
175 Ga0207691_10295538 3300025940 Bacteria 1392
176 Ga0207689_10544177 3300025942 Bacteria 975
177 Ga0207689_10662965 3300025942 Bacteria 879
178 Ga0207667_10177316 3300025949 Bacteria 2189
179 Ga0207667_10257002 3300025949 Bacteria 1787
180 Ga0207667_10588114 3300025949 Bacteria 1123
181 Ga0207668_10639140 3300025972 Bacteria 930
182 Ga0207668_11249225 3300025972 Bacteria 668
183 Ga0207677_10554888 3300026023 Bacteria 1002
184 Ga0207703_10012743 3300026035 Bacteria 6557
185 Ga0207703_10509008 3300026035 Bacteria 1131
186 Ga0207639_10719367 3300026041 Bacteria 927
187 Ga0207639_10760722 3300026041 Bacteria 901
188 Ga0207639_10859354 3300026041 Unclassified 847
189 Ga0207708_11407312 3300026075 Bacteria 612
190 Ga0207702_10000164 3300026078 Bacteria 79231
191 Ga0207648_10033844 3300026089 Bacteria 4506
192 Ga0207676_10406777 3300026095 Bacteria 1273
193 Ga0207676_10456842 3300026095 Unclassified 1205
194 Ga0207674_10032889 3300026116 Bacteria 5436
195 Ga0207674_10268307 3300026116 Bacteria 1654
196 Ga0207674_10586937 3300026116 Bacteria 1076
197 Ga0207674_11094597 3300026116 Bacteria 766
198 Ga0207683_10082893 3300026121 Bacteria 2849
199 Ga0207428_10757509 3300027907 Unclassified 692
200 Ga0265338_10030421 3300028800 Bacteria 5319
201 Ga0265338_10117477 3300028800 Bacteria 2128
202 Ga0265338_10176621 3300028800 Bacteria 1632
203 Ga0265338_10802023 3300028800 Bacteria 645
204 Ga0265328_10008779 3300031239 Bacteria 4147
205 Ga0265320_10462232 3300031240 Bacteria 560
206 Ga0265325_10000226 3300031241 Bacteria 40024
207 Ga0265325_10001389 3300031241 Bacteria 17088
208 Ga0265325_10012432 3300031241 Bacteria 4867
209 Ga0265325_10094772 3300031241 Bacteria 1468
210 Ga0265329_10037307 3300031242 Bacteria 1566
211 Ga0265329_10043579 3300031242 Bacteria 1435
212 Ga0265340_10106638 3300031247 Bacteria 1298
213 Ga0265340_10116156 3300031247 Bacteria 1233
214 Ga0265340_10158648 3300031247 Bacteria 1029
215 Ga0265340_10436649 3300031247 Bacteria 577
216 Ga0265339_10008903 3300031249 Bacteria 6353
217 Ga0265339_10009252 3300031249 Bacteria 6209
218 Ga0265339_10034416 3300031249 Bacteria 2846
219 Ga0265339_10066400 3300031249 Bacteria 1931
220 Ga0265331_10001773 3300031250 Bacteria 15456
221 Ga0265331_10041343 3300031250 Bacteria 2240
222 Ga0265331_10165339 3300031250 Bacteria 1002
223 Ga0265331_10325440 3300031250 Bacteria 688
224 Ga0265327_10000786 3300031251 Bacteria 48928
225 Ga0265316_10024821 3300031344 Bacteria 5011
226 Ga0265316_10109035 3300031344 Bacteria 2098
227 Ga0265316_10193797 3300031344 Bacteria 1508
228 Ga0265316_10388875 3300031344 Unclassified 1006
229 Ga0265316_10538233 3300031344 Bacteria 832
230 Ga0265313_10001780 3300031595 Bacteria 19683
231 Ga0265313_10004746 3300031595 Bacteria 10246
232 Ga0265313_10011451 3300031595 Bacteria 5512
233 Ga0265313_10045520 3300031595 Bacteria 2136
234 Ga0265313_10268791 3300031595 Bacteria 691
235 Ga0265314_10001422 3300031711 Bacteria 26799
236 Ga0265314_10051599 3300031711 Bacteria 2864
237 Ga0265314_10244084 3300031711 Bacteria 1034
238 Ga0265342_10014297 3300031712 Bacteria 5272
239 Ga0265342_10183913 3300031712 Bacteria 1143
240 Ga0265342_10201123 3300031712 Bacteria 1082
241 Ga0265342_10237812 3300031712 Bacteria 976
242 Ga0307516_10389376 3300031730 Bacteria 1054
243 Ga0373938_0064443 3300034957 Bacteria 863
244 Ga0373949_0003686 3300035090 Bacteria 3595
245 Ga0373936_0082509 3300035113 Bacteria 1340
246 Ga0373945_0167938 3300035116 Bacteria 898
247 Ga0373954_0686515 3300035118 Bacteria 508
248 Ga0373946_0196796 3300035171 Unclassified 964
249 Ga0373955_0749008 3300035172 Unclassified 600
250 Ga0373935_0073645 3300035692 Bacteria 2207
251 Ga0373927_0013349 3300035695 Bacteria 5462
252 Ga0373927_0817882 3300035695 Unclassified 615
253 Ga0373927_1187565 3300035695 Unclassified 503
254 Ga0373933_0221742 3300035724 Bacteria 1213
255 Ga0373937_0002421 3300036401 Bacteria 15515
256 Ga0373937_0894000 3300036401 Bacteria 837
257 Ga0373937_1218018 3300036401 Bacteria 701
258 Ga0373925_0004099 3300037068 Bacteria 11057
259 Ga0373925_0360605 3300037068 Bacteria 1181
260 Ga0373925_0669700 3300037068 Bacteria 855
261 Ga0436364_1090100 3300037853 Unclassified 1760
262 Ga0436365_1044769 3300039437 Bacteria 997
263 Ga0436365_1412951 3300039437 Bacteria 3416
264 Ga0436365_1523797 3300039437 Bacteria 885
265 Ga0436360_1208071 3300039438 Bacteria 2349
266 Ga0436363_0903664 3300039450 Bacteria 9295
267 Ga0436363_1053521 3300039450 Bacteria 833
268 Ga0436363_1092418 3300039450 Bacteria 929
269 Ga0436362_0058847 3300039453 Bacteria 2438
270 Ga0436362_1077531 3300039453 Bacteria 874
271 Ga0451795_1143706 3300041456 Bacteria 507
272 Ga0439445_0068769 3300042004 Bacteria 977
273 Ga0439432_135879 3300042006 Bacteria 724
274 Ga0439462_0152991 3300042015 Bacteria 649
275 Ga0466968_0342618 3300044735 Bacteria 725
276 Ga0466957_0194324 3300044842 Bacteria 1331
277 Ga0466958_0582041 3300045836 Bacteria 728
278 Ga0495651_0548292 3300046462 Bacteria 735
279 Ga0495653_0374193 3300046463 Bacteria 911
280 Ga0495582_0300871 3300046473 Bacteria 922
281 Ga0495608_0410399 3300046511 Bacteria 827
282 Ga0495654_0070905 3300046530 Bacteria 1652
283 Ga0495587_0103774 3300046536 Bacteria 1637
284 Ga0495625_0033974 3300046660 Bacteria 3766
285 Ga0495599_0462340 3300046678 Bacteria 750
286 Ga0495613_0889128 3300046689 Bacteria 577
287 Ga0495581_0435685 3300047315 Unclassified 764
288 Ga0495674_0688806 3300047319 Bacteria 803
289 Ga0495676_0484343 3300047321 Bacteria 813
290 Ga0495676_0602384 3300047321 Bacteria 715
291 Ga0496100_0210277 3300048903 Bacteria 1423
292 Ga0496100_0229697 3300048903 Bacteria 1365
293 Ga0496100_0800997 3300048903 Bacteria 738
294 Ga0496101_0497685 3300048904 Bacteria 963
295 Ga0496101_0730691 3300048904 Bacteria 781
296 Ga0496101_0862410 3300048904 Bacteria 713
297 Ga0496102_0249270 3300048905 Bacteria 1674
298 Ga0496104_0000637 3300048907 Bacteria 30053
299 Ga0496104_0284902 3300048907 Bacteria 1565
300 Ga0496105_0004043 3300048908 Bacteria 10978
301 Ga0496105_0512750 3300048908 Bacteria 940
302 Ga0496106_0846491 3300048909 Unclassified 724
303 Ga0496106_1021312 3300048909 Unclassified 650
304 Ga0496107_0265906 3300048910 Bacteria 1276
305 Ga0496108_0171425 3300048911 Bacteria 1877
306 Ga0496109_0000908 3300048912 Bacteria 24650
307 Ga0496110_0050875 3300048913 Bacteria 3639
308 Ga0496110_0220046 3300048913 Bacteria 1726
309 Ga0496111_0002002 3300048914 Bacteria 12119
310 Ga0496111_0581996 3300048914 Unclassified 820
311 Ga0496111_0623275 3300048914 Bacteria 788
312 Ga0496112_0001429 3300048915 Bacteria 18305
313 Ga0496112_1192654 3300048915 Bacteria 678
314 Ga0496113_0002544 3300048916 Bacteria 10638
315 Ga0496113_0714378 3300048916 Bacteria 799
316 Ga0496114_1778271 3300048917 Bacteria 504
317 Ga0496115_0001958 3300048918 Bacteria 14699
318 Ga0496126_0203907 3300048929 Bacteria 1668
319 Ga0501031_0004390 3300049568 Bacteria 9141
320 Ga0501031_0944145 3300049568 Bacteria 552
321 Ga0501032_0003552 3300049569 Bacteria 11895
322 Ga0501032_0106633 3300049569 Unclassified 1856
323 Ga0501032_0282243 3300049569 Bacteria 1075
324 Ga0501032_0406433 3300049569 Unclassified 874
325 Ga0501032_0544295 3300049569 Bacteria 740
326 Ga0501032_0796598 3300049569 Bacteria 597
327 Ga0501033_0020735 3300049570 Bacteria 4965
328 Ga0501033_0035315 3300049570 Bacteria 3748
329 Ga0501033_0087516 3300049570 Bacteria 2280
330 Ga0501033_0199279 3300049570 Bacteria 1430
331 Ga0501033_0425442 3300049570 Unclassified 924
332 Ga0501034_0028181 3300049571 Bacteria 5714
333 Ga0501034_0348214 3300049571 Bacteria 1410
334 Ga0501034_0652347 3300049571 Bacteria 954
335 Ga0501034_0767982 3300049571 Bacteria 858
336 Ga0501034_1144397 3300049571 Unclassified 658
337 Ga0501036_0004514 3300049572 Bacteria 11237
338 Ga0501036_0063170 3300049572 Bacteria 3136
339 Ga0501036_0436089 3300049572 Unclassified 1092
340 Ga0501036_0663299 3300049572 Bacteria 863
341 Ga0501037_0015642 3300049573 Bacteria 5585
342 Ga0501037_0108952 3300049573 Bacteria 1996
343 Ga0501037_0236034 3300049573 Bacteria 1283
344 Ga0501037_0397131 3300049573 Unclassified 946
345 Ga0501038_0017647 3300049574 Bacteria 6450
346 Ga0501038_0079878 3300049574 Bacteria 2758
347 Ga0501038_0159536 3300049574 Bacteria 1834
348 Ga0501038_0283238 3300049574 Bacteria 1304
349 Ga0501039_0034497 3300049575 Bacteria 3904
350 Ga0501042_0022418 3300049578 Bacteria 4410
351 Ga0501043_0050071 3300049579 Bacteria 3284
352 Ga0501043_0136462 3300049579 Bacteria 1921
353 Ga0501043_0510367 3300049579 Bacteria 897
354 Ga0501043_1002848 3300049579 Bacteria 594
355 Ga0501046_0005260 3300049580 Bacteria 11574
356 Ga0501047_0006154 3300049581 Bacteria 11284
357 Ga0501047_0049262 3300049581 Bacteria 4068
358 Ga0501047_0060218 3300049581 Bacteria 3664
359 Ga0501047_0134096 3300049581 Bacteria 2356
360 Ga0501047_0176148 3300049581 Bacteria 2006
361 Ga0501047_0205578 3300049581 Bacteria 1828
362 Ga0501047_0284305 3300049581 Bacteria 1498
363 Ga0501047_0385111 3300049581 Bacteria 1236
364 Ga0501048_0028328 3300049582 Bacteria 4065
365 Ga0501067_0000868 3300049583 Bacteria 16256
366 Ga0501067_0002226 3300049583 Bacteria 10728
367 Ga0501069_0023961 3300049585 Bacteria 3328
368 Ga0501070_0021750 3300049586 Bacteria 5375
369 Ga0501070_0147472 3300049586 Bacteria 1942
370 Ga0501071_0496778 3300049587 Bacteria 936
371 Ga0501072_0031707 3300049588 Bacteria 4139
372 Ga0501073_0002413 3300049589 Bacteria 13988
373 Ga0501073_0003832 3300049589 Bacteria 11282
374 Ga0501073_0831491 3300049589 Bacteria 636
375 Ga0501073_0831714 3300049589 Bacteria 636
376 Ga0501074_0002268 3300049590 Bacteria 13376
377 Ga0501074_1201185 3300049590 Unclassified 532
378 Ga0501075_0828067 3300049591 Bacteria 704
379 Ga0501252_006551 3300049682 Bacteria 1298
380 Ga0501079_0011714 3300049741 Bacteria 6697
381 Ga0501079_0048653 3300049741 Bacteria 3272
382 Ga0501080_0002279 3300049742 Bacteria 16702
383 Ga0501080_0071045 3300049742 Bacteria 3237
384 Ga0501080_0105291 3300049742 Bacteria 2615
385 Ga0501080_0107972 3300049742 Bacteria 2579
386 Ga0501080_0248497 3300049742 Bacteria 1622
387 Ga0501083_0009752 3300049744 Bacteria 6781
388 Ga0501083_0032436 3300049744 Bacteria 3580
389 Ga0501083_0068906 3300049744 Bacteria 2354
390 Ga0501083_0646578 3300049744 Bacteria 688
391 Ga0501035_0010177 3300049822 Bacteria 8729
392 Ga0501035_0042026 3300049822 Bacteria 4124
393 Ga0501035_0064773 3300049822 Bacteria 3247
394 Ga0501035_0455032 3300049822 Bacteria 1058
395 Ga0501035_0783364 3300049822 Bacteria 763
396 Ga0501035_0798053 3300049822 Bacteria 754
397 Ga0501044_0006189 3300049823 Bacteria 13226
398 Ga0501044_0039531 3300049823 Bacteria 4921
399 Ga0501044_0055333 3300049823 Bacteria 4075
400 Ga0501044_0090498 3300049823 Bacteria 3087
401 Ga0501044_0162414 3300049823 Bacteria 2209
402 Ga0501044_0263771 3300049823 Bacteria 1660
403 Ga0501044_0391234 3300049823 Bacteria 1304
404 Ga0501044_0628696 3300049823 Unclassified 964
405 Ga0501045_1366563 3300049824 Unclassified 515
406 nmdc:mga03683_632871_c1 3300050489 Bacteria 526
407 nmdc:mga03n38_198185_c1 3300050490 Bacteria 1038
408 nmdc:mga00v17_273944_c1 3300050491 Bacteria 1095
409 nmdc:mga0k408_701396_c1 3300050493 Bacteria 593
410 nmdc:mga0k408_805_c1 3300050493 Bacteria 7039
411 nmdc:mga0k408_866010_c1 3300050493 Bacteria 525
412 nmdc:mga06z11_347581_c1 3300050494 Bacteria 887
413 nmdc:mga06z11_989018_c1 3300050494 Bacteria 513
414 nmdc:mga07m45_465284_c1 3300050496 Bacteria 733
415 nmdc:mga08y16_186915_c1 3300050511 Bacteria 2150
416 nmdc:mga0n895_176978_c1 3300050512 Bacteria 2164
417 nmdc:mga0n895_189316_c1 3300050512 Unclassified 2089
418 nmdc:mga0n895_40096_c1 3300050512 Bacteria 4548
419 nmdc:mga0rr50_32397_c1 3300050513 Bacteria 1144
420 nmdc:mga0rr50_3430_c1 3300050513 Bacteria 9119
421 nmdc:mga08x19_155_c1 3300050514 Bacteria 56249
422 nmdc:mga08x19_271306_c1 3300050514 Unclassified 1174
423 nmdc:mga0a205_36333_c1 3300050515 Bacteria 4733
424 nmdc:mga0sz30_10581_c1 3300050516 Bacteria 2009
425 Ga0500643_000003 3300053087 Bacteria 876659
426 Ga0500646_0312113 3300053090 Bacteria 566
427 Ga0500554_132659 3300053102 Bacteria 842
428 Ga0500555_095781 3300053103 Bacteria 758
429 Ga0500555_104674 3300053103 Bacteria 716
430 Ga0500593_000075 3300053117 Bacteria 37303
431 Ga0500594_0174892 3300053118 Bacteria 699
432 Ga0500595_152361 3300053119 Unclassified 646
433 Ga0500568_0000002 3300053139 Bacteria 880601
434 Ga0500568_0035568 3300053139 Bacteria 2032
435 Ga0500588_0298049 3300053146 Unclassified 610
436 Ga0500587_036174 3300053739 Bacteria 694
437 Ga0501084_0009855 3300054114 Bacteria 7895
438 Ga0501084_0950463 3300054114 Bacteria 722
439 Ga0501082_0008955 3300060353 Bacteria 8638
440 Ga0501082_0065737 3300060353 Bacteria 3123
441 Ga0501082_0607119 3300060353 Bacteria 957
442 Ga0501082_1558962 3300060353 Bacteria 577
443 2513887850 2513237141 Bacteria 8496279
444 2919451632 2919450847 Bacteria 5631160
445 Ga0501072_0150590
446 JGI24740J21852_10047147
447 JGI24740J21852_10057839
448 JGI25153J46596_10001205
449 rootH2_10061914
450 Ga0070658_10639595
451 Ga0070658_10656471
452 Ga0070676_11293561
453 Ga0068869_100546569
454 Ga0068869_100722388
455 Ga0070680_101837543
456 Ga0070680_101988721
457 Ga0070660_100102026
458 Ga0070660_100794413
459 Ga0070691_10318947
460 Ga0070661_100211452
461 Ga0070668_100365960
462 Ga0070668_101051283
463 Ga0070671_101807047
464 Ga0070674_100240911
465 Ga0070659_100004063
466 Ga0070659_101897609
467 Ga0070714_100017309
468 Ga0070714_100827875
469 Ga0070713_100000004
470 Ga0070713_101052020
471 Ga0070710_10223193
472 Ga0070710_10318076
473 Ga0070711_100020746
474 Ga0070711_100037853
475 Ga0070711_100143292
476 Ga0070705_101844807
477 Ga0070700_101674234
478 Ga0070678_100151084
479 Ga0070662_100762702
480 Ga0070681_11360957
481 Ga0068867_100452341
482 Ga0070679_101249174
483 Ga0070684_100127100
484 Ga0068853_100427305
485 Ga0068853_100499512
486 Ga0068853_101026890
487 Ga0068853_101627552
488 Ga0070672_101620306
489 Ga0070695_100407964
490 Ga0070696_100122022
491 Ga0070696_100205986
492 Ga0070693_100032622
493 Ga0068855_100098101
494 Ga0070664_102079056
495 Ga0068857_100127398
496 Ga0068857_100187531
497 Ga0068857_100278608
498 Ga0068857_100458087
499 Ga0068856_100000474
500 Ga0068856_101146976
501 Ga0068856_102273629
502 Ga0070702_100528236
503 Ga0068852_101249613
504 Ga0068864_100101336
505 Ga0068864_100351210
506 Ga0068858_100068155
507 Ga0068858_102021961
508 Ga0068862_100222302
509 Ga0081455_10000894
510 Ga0075363_100014511
511 Ga0075364_10113108
512 Ga0075432_10055236
513 Ga0075432_10588603
514 Ga0070712_100000396
515 Ga0070712_100002805
516 Ga0070712_100183789
517 Ga0070712_100501648
518 Ga0070712_101128814
519 Ga0075362_10035266
520 Ga0075362_10192949
521 Ga0075367_10499047
522 Ga0075369_10003492
523 Ga0075369_10303906
524 Ga0075366_10000662
525 Ga0097621_100016270
526 Ga0097621_100270811
527 Ga0075370_11029773
528 Ga0075428_100770768
529 Ga0075433_10004023
530 Ga0075434_100196460
531 Ga0075434_100274825
532 Ga0068865_100179506
533 Ga0075436_100000187
534 Ga0075436_101012469
535 Ga0075435_100004990
536 Ga0075435_100986422
537 Ga0105240_10583318
538 Ga0105240_11342014
539 Ga0111539_10052846
540 Ga0111539_10065100
541 Ga0105245_11108921
542 Ga0105247_11427314
543 Ga0114129_10136747
544 Ga0105241_10523832
545 Ga0105241_10940425
546 Ga0105242_10015932
547 Ga0105242_12494787
548 Ga0105237_10363969
549 Ga0105237_12113592
550 Ga0105238_10319394
551 Ga0105238_10777513
552 Ga0105238_11225461
553 Ga0105238_11521734
554 Ga0105238_11757286
555 Ga0105238_12473537
556 Ga0105249_10512607
557 Ga0105239_10008191
558 Ga0105239_10675538
559 Ga0105239_11694145
560 Ga0157370_10123840
561 Ga0157374_10484065
562 Ga0157374_12197873
563 Ga0157378_10325535
564 Ga0157378_10493084
565 Ga0163162_10160816
566 Ga0163162_10185765
567 Ga0157372_11143460
568 Ga0157375_10044238
569 Ga0163163_10002034
570 Ga0163163_10936025
571 Ga0163163_12835803
572 Ga0182008_10121636
573 Ga0157379_10001633
574 Ga0157379_10139787
575 Ga0157376_10457216
576 Ga0213873_10029598
577 Ga0213876_10051604
578 Ga0209563_111525
579 Ga0209455_1023947
580 Ga0209758_1000013
581 Ga0209758_1160721
582 Ga0207692_10067664
583 Ga0207647_10149245
584 Ga0207699_10000307
585 Ga0207645_10505879
586 Ga0207705_11403370
587 Ga0207654_10391422
588 Ga0207707_11092387
589 Ga0207695_10109081
590 Ga0207695_10271190
591 Ga0207695_11560689
592 Ga0207671_10034474
593 Ga0207671_10273222
594 Ga0207671_11170163
595 Ga0207693_10001040
596 Ga0207693_10001139
597 Ga0207663_10015612
598 Ga0207663_10046901
599 Ga0207663_10208637
600 Ga0207660_11466738
601 Ga0207657_10205788
602 Ga0207652_10418580
603 Ga0207652_11791104
604 Ga0207694_10274826
605 Ga0207694_10597556
606 Ga0207694_10982101
607 Ga0207687_10147104
608 Ga0207700_10000011
609 Ga0207700_10067079
610 Ga0207700_10896107
611 Ga0207664_10453297
612 Ga0207664_10654136
613 Ga0207690_10021630
614 Ga0207690_11418894
615 Ga0207706_10329898
616 Ga0207686_10037336
617 Ga0207669_10759472
618 Ga0207704_10018343
619 Ga0207691_10295538
620 Ga0207689_10544177
621 Ga0207689_10662965
622 Ga0207667_10177316
623 Ga0207667_10257002
624 Ga0207667_10588114
625 Ga0207668_10639140
626 Ga0207668_11249225
627 Ga0207677_10554888
628 Ga0207703_10012743
629 Ga0207703_10509008
630 Ga0207639_10719367
631 Ga0207639_10760722
632 Ga0207639_10859354
633 Ga0207708_11407312
634 Ga0207702_10000164
635 Ga0207648_10033844
636 Ga0207676_10406777
637 Ga0207676_10456842
638 Ga0207674_10032889
639 Ga0207674_10268307
640 Ga0207674_10586937
641 Ga0207674_11094597
642 Ga0207683_10082893
643 Ga0207428_10757509
644 Ga0265338_10030421
645 Ga0265338_10117477
646 Ga0265338_10176621
647 Ga0265338_10802023
648 Ga0265328_10008779
649 Ga0265320_10462232
650 Ga0265325_10000226
651 Ga0265325_10001389
652 Ga0265325_10012432
653 Ga0265325_10094772
654 Ga0265329_10037307
655 Ga0265329_10043579
656 Ga0265340_10106638
657 Ga0265340_10116156
658 Ga0265340_10158648
659 Ga0265340_10436649
660 Ga0265339_10008903
661 Ga0265339_10009252
662 Ga0265339_10034416
663 Ga0265339_10066400
664 Ga0265331_10001773
665 Ga0265331_10041343
666 Ga0265331_10165339
667 Ga0265331_10325440
668 Ga0265327_10000786
669 Ga0265316_10024821
670 Ga0265316_10109035
671 Ga0265316_10193797
672 Ga0265316_10388875
673 Ga0265316_10538233
674 Ga0265313_10001780
675 Ga0265313_10004746
676 Ga0265313_10011451
677 Ga0265313_10045520
678 Ga0265313_10268791
679 Ga0265314_10001422
680 Ga0265314_10051599
681 Ga0265314_10244084
682 Ga0265342_10014297
683 Ga0265342_10183913
684 Ga0265342_10201123
685 Ga0265342_10237812
686 Ga0307516_10389376
687 Ga0373938_0064443
688 Ga0373949_0003686
689 Ga0373936_0082509
690 Ga0373945_0167938
691 Ga0373954_0686515
692 Ga0373946_0196796
693 Ga0373955_0749008
694 Ga0373935_0073645
695 Ga0373927_0013349
696 Ga0373927_0817882
697 Ga0373927_1187565
698 Ga0373933_0221742
699 Ga0373937_0002421
700 Ga0373937_0894000
701 Ga0373937_1218018
702 Ga0373925_0004099
703 Ga0373925_0360605
704 Ga0373925_0669700
705 Ga0436364_1090100
706 Ga0436365_1044769
707 Ga0436365_1412951
708 Ga0436365_1523797
709 Ga0436360_1208071
710 Ga0436363_0903664
711 Ga0436363_1053521
712 Ga0436363_1092418
713 Ga0436362_0058847
714 Ga0436362_1077531
715 Ga0451795_1143706
716 Ga0439445_0068769
717 Ga0439432_135879
718 Ga0439462_0152991
719 Ga0466968_0342618
720 Ga0466957_0194324
721 Ga0466958_0582041
722 Ga0495651_0548292
723 Ga0495653_0374193
724 Ga0495582_0300871
725 Ga0495608_0410399
726 Ga0495654_0070905
727 Ga0495587_0103774
728 Ga0495625_0033974
729 Ga0495599_0462340
730 Ga0495613_0889128
731 Ga0495581_0435685
732 Ga0495674_0688806
733 Ga0495676_0484343
734 Ga0495676_0602384
735 Ga0496100_0210277
736 Ga0496100_0229697
737 Ga0496100_0800997
738 Ga0496101_0497685
739 Ga0496101_0730691
740 Ga0496101_0862410
741 Ga0496102_0249270
742 Ga0496104_0000637
743 Ga0496104_0284902
744 Ga0496105_0004043
745 Ga0496105_0512750
746 Ga0496106_0846491
747 Ga0496106_1021312
748 Ga0496107_0265906
749 Ga0496108_0171425
750 Ga0496109_0000908
751 Ga0496110_0050875
752 Ga0496110_0220046
753 Ga0496111_0002002
754 Ga0496111_0581996
755 Ga0496111_0623275
756 Ga0496112_0001429
757 Ga0496112_1192654
758 Ga0496113_0002544
759 Ga0496113_0714378
760 Ga0496114_1778271
761 Ga0496115_0001958
762 Ga0496126_0203907
763 Ga0501031_0004390
764 Ga0501031_0944145
765 Ga0501032_0003552
766 Ga0501032_0106633
767 Ga0501032_0282243
768 Ga0501032_0406433
769 Ga0501032_0544295
770 Ga0501032_0796598
771 Ga0501033_0020735
772 Ga0501033_0035315
773 Ga0501033_0087516
774 Ga0501033_0199279
775 Ga0501033_0425442
776 Ga0501034_0028181
777 Ga0501034_0348214
778 Ga0501034_0652347
779 Ga0501034_0767982
780 Ga0501034_1144397
781 Ga0501036_0004514
782 Ga0501036_0063170
783 Ga0501036_0436089
784 Ga0501036_0663299
785 Ga0501037_0015642
786 Ga0501037_0108952
787 Ga0501037_0236034
788 Ga0501037_0397131
789 Ga0501038_0017647
790 Ga0501038_0079878
791 Ga0501038_0159536
792 Ga0501038_0283238
793 Ga0501039_0034497
794 Ga0501042_0022418
795 Ga0501043_0050071
796 Ga0501043_0136462
797 Ga0501043_0510367
798 Ga0501043_1002848
799 Ga0501046_0005260
800 Ga0501047_0006154
801 Ga0501047_0049262
802 Ga0501047_0060218
803 Ga0501047_0134096
804 Ga0501047_0176148
805 Ga0501047_0205578
806 Ga0501047_0284305
807 Ga0501047_0385111
808 Ga0501048_0028328
809 Ga0501067_0000868
810 Ga0501067_0002226
811 Ga0501069_0023961
812 Ga0501070_0021750
813 Ga0501070_0147472
814 Ga0501071_0496778
815 Ga0501072_0031707
816 Ga0501073_0002413
817 Ga0501073_0003832
818 Ga0501073_0831491
819 Ga0501073_0831714
820 Ga0501074_0002268
821 Ga0501074_1201185
822 Ga0501075_0828067
823 Ga0501252_006551
824 Ga0501079_0011714
825 Ga0501079_0048653
826 Ga0501080_0002279
827 Ga0501080_0071045
828 Ga0501080_0105291
829 Ga0501080_0107972
830 Ga0501080_0248497
831 Ga0501083_0009752
832 Ga0501083_0032436
833 Ga0501083_0068906
834 Ga0501083_0646578
835 Ga0501035_0010177
836 Ga0501035_0042026
837 Ga0501035_0064773
838 Ga0501035_0455032
839 Ga0501035_0783364
840 Ga0501035_0798053
841 Ga0501044_0006189
842 Ga0501044_0039531
843 Ga0501044_0055333
844 Ga0501044_0090498
845 Ga0501044_0162414
846 Ga0501044_0263771
847 Ga0501044_0391234
848 Ga0501044_0628696
849 Ga0501045_1366563
850 nmdc:mga03683_632871_c1
851 nmdc:mga03n38_198185_c1
852 nmdc:mga00v17_273944_c1
853 nmdc:mga0k408_701396_c1
854 nmdc:mga0k408_805_c1
855 nmdc:mga0k408_866010_c1
856 nmdc:mga06z11_347581_c1
857 nmdc:mga06z11_989018_c1
858 nmdc:mga07m45_465284_c1
859 nmdc:mga08y16_186915_c1
860 nmdc:mga0n895_176978_c1
861 nmdc:mga0n895_189316_c1
862 nmdc:mga0n895_40096_c1
863 nmdc:mga0rr50_32397_c1
864 nmdc:mga0rr50_3430_c1
865 nmdc:mga08x19_155_c1
866 nmdc:mga08x19_271306_c1
867 nmdc:mga0a205_36333_c1
868 nmdc:mga0sz30_10581_c1
869 Ga0500643_000003
870 Ga0500646_0312113
871 Ga0500554_132659
872 Ga0500555_095781
873 Ga0500555_104674
874 Ga0500593_000075
875 Ga0500594_0174892
876 Ga0500595_152361
877 Ga0500568_0000002
878 Ga0500568_0035568
879 Ga0500588_0298049
880 Ga0500587_036174
881 Ga0501084_0009855
882 Ga0501084_0950463
883 Ga0501082_0008955
884 Ga0501082_0065737
885 Ga0501082_0607119
886 Ga0501082_1558962
887 2513887850
888 2919451632

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13773

DUF4170

Domain of unknown function (DUF4170)

23

82

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2mhe-assembly1.cif.gz_B nmr structure of the protein np_419126.1 from caulobacter crescentus 0.7784 3 74
2mhe-assembly1.cif.gz_B nmr structure of the protein np_419126.1 from caulobacter crescentus 0.7526 3 74
3o2h-assembly1.cif.gz_A e. coli clps in complex with a leu n-end rule peptide 0.6401 4 67
3gq1-assembly2.cif.gz_B the structure of the caulobacter crescentus clps protease adaptor protein in complex with a wlfvqrdske decapeptide 0.6315 5 67
2wa8-assembly2.cif.gz_C structural basis of n-end rule substrate recognition in escherichia coli by the clpap adaptor protein clps - the phe peptide structure 0.6312 5 67
ID Description Score Start End Superfamily
af_K7UQ19_118_172_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.8341 28 56 3.30.730.10
2mheB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Uncharacterised protein PF13773, DUF4170 0.7784 3 74 3.30.70.2400
af_B4FET9_33_90_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.7774 31 59 3.30.730.10
2mheB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Uncharacterised protein PF13773, DUF4170 0.7526 3 74 3.30.70.2400
af_K7KMY2_15_72_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.7462 22 53 3.30.730.10
ID Description Score Start End GO Terms
AF-A0A2E1RWQ1-F1-model_v4 Inositol monophosphatase 1 6 67
AF-A0A7Y4TAE6-F1-model_v4 DUF4170 domain-containing protein 0.9957 5 68
AF-A0A3D4F2C3-F1-model_v4 deleted 0.9906 9 65
AF-A0A2A8HQB2-F1-model_v4 Inositol monophosphatase 0.9718 7 69
AF-A0A3B1A9C7-F1-model_v4 Uncharacterized protein, Bsl7517 homolog 0.9691 11 69

Map