F445372

General Info

Members Datasets Scaffolds Average Seq Length
444 264 888 167

Family's Representative Sequence

Representative Sequence 3300053090|Ga0500646_0028382|Ga0500646_0028382_802_1323
Length 173
Sequence MRTGVYPGTFDPITLGHMDIIRRAAHLVDRLVIGVTTNPSKSPMFTVEERLAMVERETASVTDGAALSVVAFDSLLMDFAEAQGASMIVRGLRAVADFEYEYQMAGMNQQLNADIETVFLMADVSLQPIASKLVKEIAIYGGDISRFVPPAVVGEVSRRVAEIGRKGTPPPRA

Samples

Sample ID Description Type Environment
1 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
62 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
86 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
132 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
146 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
147 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
148 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
149 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
150 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
151 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
152 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
153 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
154 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
155 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
156 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
157 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
158 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
162 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
174 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
175 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
176 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
179 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
180 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
181 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
182 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
183 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
184 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
185 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
186 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
187 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
188 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
204 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
205 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
206 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
207 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
208 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
209 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
210 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
211 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
212 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
213 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
214 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
215 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
216 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
217 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
218 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
219 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
220 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
221 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
222 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
223 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
228 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
229 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
230 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
231 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
232 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
233 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
234 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
235 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
236 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
237 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
238 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
239 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
240 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
241 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
242 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
243 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
244 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
245 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
246 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
247 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
248 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
249 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
250 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
251 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
252 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
253 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
254 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
255 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
256 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
257 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
258 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
259 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
260 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
261 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
262 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
263 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
264 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.07
Metatranscriptomes 0
Isolates 2.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.49
Nodule 0
Rhizoplane 4.28
Rhizosphere 76.8
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500646_0028382 3300053090 Bacteria 1527
2 SwRhRL2b_contig_1505805 2162886007 Bacteria 987
3 SwRhRL2b_contig_3439718 2162886007 Bacteria 1009
4 JGI24741J21665_1013465 3300001915 Bacteria 1387
5 JGI24752J21851_1003188 3300001976 Bacteria 2164
6 JGI24740J21852_10002064 3300001979 Bacteria 9182
7 JGI24740J21852_10034057 3300001979 Bacteria 1609
8 JGI24739J22299_10001692 3300001989 Bacteria 8378
9 JGI24737J22298_10024726 3300001990 Bacteria 1901
10 JGI24735J21928_10005665 3300002067 Bacteria 4130
11 JGI24748J21848_1000029 3300002074 Bacteria 90134
12 JGI24738J21930_10000138 3300002075 Bacteria 17795
13 JGI24738J21930_10003295 3300002075 Bacteria 4103
14 JGI24749J21850_1000094 3300002076 Bacteria 15838
15 JGI24749J21850_1001913 3300002076 Bacteria 2941
16 JGI24034J26672_10000006 3300002239 Bacteria 294495
17 JGI24742J22300_10002513 3300002244 Bacteria 2931
18 JGI24751J29686_10000093 3300002459 Bacteria 50074
19 JGI24751J29686_10008583 3300002459 Bacteria 2092
20 JGI24751J29686_10021088 3300002459 Bacteria 1351
21 Ga0055536_1010070 3300003781 Bacteria 3809
22 Ga0055534_1019334 3300003784 Bacteria 1171
23 Ga0055530_10000083 3300003791 Bacteria 81772
24 Ga0055530_10068130 3300003791 Bacteria 774
25 Ga0055531_10000316 3300003794 Bacteria 47444
26 Ga0055531_10001717 3300003794 Bacteria 15697
27 Ga0065704_10078399 3300005289 Bacteria 4441
28 Ga0065704_10202209 3300005289 Bacteria 1141
29 Ga0065715_10916673 3300005293 Bacteria 570
30 Ga0065707_10082105 3300005295 Bacteria 21836
31 Ga0065707_10082467 3300005295 Bacteria 14795
32 Ga0065707_10141585 3300005295 Bacteria 1765
33 Ga0065707_10484423 3300005295 Bacteria 771
34 Ga0070658_10137441 3300005327 Bacteria 2040
35 Ga0070658_10160617 3300005327 Bacteria 1885
36 Ga0070690_100000002 3300005330 Bacteria 176748
37 Ga0070670_100000005 3300005331 Bacteria 351569
38 Ga0070670_100000169 3300005331 Bacteria 59093
39 Ga0070670_100000528 3300005331 Bacteria 30641
40 Ga0070670_100073948 3300005331 Bacteria 2927
41 Ga0070666_10000002 3300005335 Bacteria 478684
42 Ga0070666_10035929 3300005335 Bacteria 3286
43 Ga0070689_100007860 3300005340 Bacteria 7477
44 Ga0070668_100000007 3300005347 Bacteria 150621
45 Ga0070668_100324389 3300005347 Bacteria 1297
46 Ga0070668_100609554 3300005347 Bacteria 956
47 Ga0070669_100000195 3300005353 Bacteria 53791
48 Ga0070669_100000440 3300005353 Bacteria 31718
49 Ga0070669_100034494 3300005353 Bacteria 3663
50 Ga0070671_100000388 3300005355 Bacteria 30256
51 Ga0070671_100027243 3300005355 Bacteria 4702
52 Ga0070674_100707454 3300005356 Bacteria 862
53 Ga0070673_101380978 3300005364 Bacteria 663
54 Ga0070688_100011582 3300005365 Bacteria 4905
55 Ga0070659_100042467 3300005366 Bacteria 3554
56 Ga0070659_100369057 3300005366 Bacteria 1207
57 Ga0070667_100000003 3300005367 Bacteria 447715
58 Ga0070667_100000327 3300005367 Bacteria 52972
59 Ga0070667_100001850 3300005367 Bacteria 18783
60 Ga0070667_100008584 3300005367 Bacteria 8468
61 Ga0070663_100185239 3300005455 Bacteria 1617
62 Ga0070662_100006250 3300005457 Bacteria 7670
63 Ga0070662_100060346 3300005457 Bacteria 2765
64 Ga0070662_100608194 3300005457 Bacteria 920
65 Ga0070662_101024679 3300005457 Bacteria 707
66 Ga0070681_10237857 3300005458 Bacteria 1735
67 Ga0070685_10000056 3300005466 Bacteria 68183
68 Ga0070679_100354019 3300005530 Bacteria 1416
69 Ga0070684_100693090 3300005535 Bacteria 949
70 Ga0068853_100096736 3300005539 Bacteria 2605
71 Ga0070672_100229285 3300005543 Bacteria 1560
72 Ga0070686_100000002 3300005544 Bacteria 336303
73 Ga0070693_100829250 3300005547 Bacteria 688
74 Ga0070665_100000025 3300005548 Bacteria 367488
75 Ga0070665_100004060 3300005548 Bacteria 15401
76 Ga0070665_100657668 3300005548 Bacteria 1061
77 Ga0068855_100004366 3300005563 Bacteria 17285
78 Ga0068857_100015964 3300005577 Bacteria 6577
79 Ga0068857_100134454 3300005577 Bacteria 2232
80 Ga0068857_100166790 3300005577 Bacteria 2000
81 Ga0068854_100029193 3300005578 Bacteria 3817
82 Ga0068854_100036277 3300005578 Bacteria 3456
83 Ga0068854_100322165 3300005578 Bacteria 1257
84 Ga0068856_100058625 3300005614 Bacteria 3803
85 Ga0068852_100215479 3300005616 Bacteria 1824
86 Ga0068859_100008939 3300005617 Bacteria 10118
87 Ga0068859_100012055 3300005617 Bacteria 8685
88 Ga0068859_100012820 3300005617 Bacteria 8419
89 Ga0068859_100025890 3300005617 Bacteria 5886
90 Ga0068864_100000004 3300005618 Bacteria 489341
91 Ga0068864_100000011 3300005618 Bacteria 350056
92 Ga0068864_100004976 3300005618 Bacteria 10896
93 Ga0068861_100220277 3300005719 Bacteria 1603
94 Ga0068851_10027890 3300005834 Bacteria 2786
95 Ga0068863_100000002 3300005841 Bacteria 489510
96 Ga0068863_100000070 3300005841 Bacteria 115715
97 Ga0068863_100003398 3300005841 Bacteria 15704
98 Ga0068863_100017965 3300005841 Bacteria 6769
99 Ga0068858_100001881 3300005842 Bacteria 21432
100 Ga0068858_100002924 3300005842 Bacteria 17185
101 Ga0068860_100000001 3300005843 Bacteria 703043
102 Ga0068860_100000045 3300005843 Bacteria 223252
103 Ga0068860_100040511 3300005843 Bacteria 4451
104 Ga0068862_100000002 3300005844 Bacteria 489341
105 Ga0068862_100000011 3300005844 Bacteria 270105
106 Ga0068862_100000020 3300005844 Bacteria 219516
107 Ga0068862_100000989 3300005844 Bacteria 27179
108 Ga0081540_1056312 3300005983 Bacteria 1909
109 Ga0097620_100008939 3300006931 Bacteria 10118
110 Ga0097620_100012054 3300006931 Bacteria 8685
111 Ga0097620_100012820 3300006931 Bacteria 8419
112 Ga0097620_100025890 3300006931 Bacteria 5886
113 Ga0105251_10000342 3300009011 Bacteria 46221
114 Ga0105250_10260431 3300009092 Bacteria 743
115 Ga0105240_10009282 3300009093 Bacteria 13947
116 Ga0111539_10382741 3300009094 Bacteria 1638
117 Ga0105247_10017026 3300009101 Bacteria 4361
118 Ga0105247_10041415 3300009101 Bacteria 2819
119 Ga0105241_10230273 3300009174 Bacteria 1562
120 Ga0105248_10000016 3300009177 Bacteria 308151
121 Ga0105248_10000069 3300009177 Bacteria 120989
122 Ga0105248_10065895 3300009177 Bacteria 4067
123 Ga0105248_10509668 3300009177 Bacteria 1357
124 Ga0105237_10224635 3300009545 Bacteria 1878
125 Ga0105237_10586709 3300009545 Bacteria 1121
126 Ga0105237_10599018 3300009545 Bacteria 1109
127 Ga0105238_10051291 3300009551 Bacteria 4150
128 Ga0105238_10072055 3300009551 Bacteria 3452
129 Ga0105238_11100422 3300009551 Bacteria 817
130 Ga0105249_10000005 3300009553 Bacteria 362467
131 Ga0105249_10000106 3300009553 Bacteria 115526
132 Ga0105249_10369014 3300009553 Bacteria 1458
133 Ga0105249_10810158 3300009553 Bacteria 1001
134 Ga0105239_10446539 3300010375 Bacteria 1467
135 Ga0105239_10509252 3300010375 Bacteria 1369
136 Ga0105239_10852509 3300010375 Bacteria 1045
137 Ga0157326_1000303 3300012513 Bacteria 5782
138 Ga0157373_10152970 3300013100 Bacteria 1623
139 Ga0157370_10025774 3300013104 Bacteria 5818
140 Ga0157370_11603128 3300013104 Bacteria 585
141 Ga0157370_11667324 3300013104 Bacteria 572
142 Ga0157369_10133762 3300013105 Bacteria 2626
143 Ga0157374_10365013 3300013296 Bacteria 1436
144 Ga0157378_10156954 3300013297 Bacteria 2125
145 Ga0163162_10060819 3300013306 Bacteria 3814
146 Ga0163162_10503157 3300013306 Bacteria 1342
147 Ga0157372_10138783 3300013307 Bacteria 2800
148 Ga0157372_10509317 3300013307 Bacteria 1403
149 Ga0163163_10101070 3300014325 Bacteria 2906
150 Ga0157380_10000304 3300014326 Bacteria 29589
151 Ga0157380_10000363 3300014326 Bacteria 27231
152 Ga0157380_10183104 3300014326 Bacteria 1842
153 Ga0157379_10007070 3300014968 Bacteria 9701
154 Ga0157379_10027796 3300014968 Bacteria 5035
155 Ga0163161_10000115 3300017792 Bacteria 76319
156 Ga0213876_10432585 3300021384 Bacteria 700
157 Ga0213875_10001461 3300021388 Bacteria 15300
158 Ga0209675_1000190 3300025291 Bacteria 67514
159 Ga0209676_1000081 3300025292 Bacteria 285297
160 Ga0209676_1000133 3300025292 Bacteria 184430
161 Ga0209676_1000769 3300025292 Bacteria 42909
162 Ga0209025_1015501 3300025294 Bacteria 4587
163 Ga0209050_1000067 3300025298 Bacteria 304206
164 Ga0209050_1001738 3300025298 Bacteria 21673
165 Ga0209050_1011629 3300025298 Bacteria 4145
166 Ga0209257_1000132 3300025304 Bacteria 210870
167 Ga0209257_1000206 3300025304 Bacteria 142184
168 Ga0207656_10002142 3300025321 Bacteria 6593
169 Ga0207696_1167430 3300025711 Bacteria 583
170 Ga0207713_1003473 3300025735 Bacteria 10729
171 Ga0207710_10018928 3300025900 Bacteria 2934
172 Ga0207710_10065620 3300025900 Bacteria 1655
173 Ga0207680_10000004 3300025903 Bacteria 827324
174 Ga0207680_10019012 3300025903 Bacteria 3668
175 Ga0207647_10000069 3300025904 Bacteria 80952
176 Ga0207705_10225117 3300025909 Bacteria 1425
177 Ga0207654_10006741 3300025911 Bacteria 5775
178 Ga0207707_10405559 3300025912 Bacteria 1170
179 Ga0207695_10007597 3300025913 Bacteria 13744
180 Ga0207695_10009337 3300025913 Bacteria 12132
181 Ga0207671_10001601 3300025914 Bacteria 25733
182 Ga0207657_10029090 3300025919 Bacteria 5034
183 Ga0207652_11444563 3300025921 Bacteria 591
184 Ga0207681_10000001 3300025923 Bacteria 1105841
185 Ga0207681_10000130 3300025923 Bacteria 61067
186 Ga0207681_10069244 3300025923 Bacteria 2454
187 Ga0207681_10122918 3300025923 Bacteria 1906
188 Ga0207694_10013118 3300025924 Bacteria 6239
189 Ga0207694_10014424 3300025924 Bacteria 5957
190 Ga0207694_10049465 3300025924 Bacteria 3254
191 Ga0207650_10000018 3300025925 Bacteria 352120
192 Ga0207650_10000294 3300025925 Bacteria 50141
193 Ga0207650_10004568 3300025925 Bacteria 9467
194 Ga0207650_10008589 3300025925 Bacteria 6974
195 Ga0207644_10000197 3300025931 Bacteria 42679
196 Ga0207644_10056031 3300025931 Bacteria 2843
197 Ga0207706_10011916 3300025933 Bacteria 7916
198 Ga0207706_10192545 3300025933 Bacteria 1789
199 Ga0207706_11060792 3300025933 Bacteria 679
200 Ga0207670_10010788 3300025936 Bacteria 5271
201 Ga0207691_10093950 3300025940 Bacteria 2684
202 Ga0207711_10000022 3300025941 Bacteria 340441
203 Ga0207711_10001064 3300025941 Bacteria 26287
204 Ga0207711_10010013 3300025941 Bacteria 7878
205 Ga0207711_10416240 3300025941 Bacteria 1250
206 Ga0207679_10238592 3300025945 Bacteria 1539
207 Ga0207667_10000651 3300025949 Bacteria 45008
208 Ga0207667_10005163 3300025949 Bacteria 15952
209 Ga0207651_10367660 3300025960 Bacteria 1216
210 Ga0207712_10000001 3300025961 Bacteria 750309
211 Ga0207712_10000224 3300025961 Bacteria 55674
212 Ga0207712_10213795 3300025961 Bacteria 1537
213 Ga0207712_10611587 3300025961 Bacteria 944
214 Ga0207668_10000026 3300025972 Bacteria 128309
215 Ga0207668_10309219 3300025972 Bacteria 1307
216 Ga0207668_10557372 3300025972 Bacteria 993
217 Ga0207640_10008627 3300025981 Bacteria 5665
218 Ga0207640_10011938 3300025981 Bacteria 4933
219 Ga0207640_10045658 3300025981 Bacteria 2814
220 Ga0207640_10182577 3300025981 Bacteria 1574
221 Ga0207658_10000002 3300025986 Bacteria 1364188
222 Ga0207658_10000364 3300025986 Bacteria 44527
223 Ga0207658_10000902 3300025986 Bacteria 24720
224 Ga0207658_10002462 3300025986 Bacteria 13518
225 Ga0207703_10000404 3300026035 Bacteria 46297
226 Ga0207703_10002475 3300026035 Bacteria 16017
227 Ga0207703_11504355 3300026035 Bacteria 648
228 Ga0207639_10016543 3300026041 Bacteria 5221
229 Ga0207639_10131249 3300026041 Bacteria 2074
230 Ga0207639_10469477 3300026041 Bacteria 1145
231 Ga0207678_10187042 3300026067 Bacteria 1769
232 Ga0207702_10003987 3300026078 Bacteria 13255
233 Ga0207702_10003988 3300026078 Bacteria 13255
234 Ga0207702_10076647 3300026078 Bacteria 2890
235 Ga0207641_10000002 3300026088 Bacteria 981004
236 Ga0207641_10000033 3300026088 Bacteria 219261
237 Ga0207641_10004973 3300026088 Bacteria 11403
238 Ga0207641_10006503 3300026088 Bacteria 9839
239 Ga0207676_10000004 3300026095 Bacteria 725417
240 Ga0207676_10000040 3300026095 Bacteria 167947
241 Ga0207676_10000546 3300026095 Bacteria 31410
242 Ga0207674_10012150 3300026116 Bacteria 9640
243 Ga0207674_10142596 3300026116 Bacteria 2355
244 Ga0207674_10143991 3300026116 Bacteria 2342
245 Ga0207674_10249348 3300026116 Bacteria 1722
246 Ga0207674_10279210 3300026116 Bacteria 1618
247 Ga0207675_100003280 3300026118 Bacteria 15849
248 Ga0207675_100004115 3300026118 Bacteria 14077
249 Ga0207675_100132806 3300026118 Bacteria 2360
250 Ga0207698_10026565 3300026142 Bacteria 4096
251 Ga0207698_10101825 3300026142 Bacteria 2383
252 Ga0207698_10524414 3300026142 Bacteria 1157
253 Ga0268266_10000028 3300028379 Bacteria 425294
254 Ga0268266_10001270 3300028379 Bacteria 30813
255 Ga0268265_10000002 3300028380 Bacteria 1035381
256 Ga0268265_10000003 3300028380 Bacteria 949201
257 Ga0268265_10000071 3300028380 Bacteria 132890
258 Ga0268265_10001985 3300028380 Bacteria 16188
259 Ga0268264_10000006 3300028381 Bacteria 827324
260 Ga0268264_10000101 3300028381 Bacteria 225109
261 Ga0268264_10754516 3300028381 Bacteria 970
262 Ga0307517_10511383 3300028786 Bacteria 609
263 Ga0307513_10614222 3300031456 Bacteria 796
264 Ga0307408_100253979 3300031548 Bacteria 1451
265 Ga0307408_101781625 3300031548 Bacteria 588
266 Ga0307405_10057984 3300031731 Bacteria 2435
267 Ga0307405_10068751 3300031731 Bacteria 2268
268 Ga0307405_10071128 3300031731 Bacteria 2237
269 Ga0307405_10458954 3300031731 Bacteria 1012
270 Ga0307410_10274723 3300031852 Bacteria 1320
271 Ga0307406_10103171 3300031901 Bacteria 1947
272 Ga0307412_10000165 3300031911 Bacteria 46841
273 Ga0307412_10000329 3300031911 Bacteria 30093
274 Ga0307412_10014384 3300031911 Bacteria 4665
275 Ga0307412_10022690 3300031911 Bacteria 3853
276 Ga0307412_10036493 3300031911 Bacteria 3150
277 Ga0307412_10162631 3300031911 Bacteria 1660
278 Ga0307416_100570300 3300032002 Bacteria 1208
279 Ga0307416_101789066 3300032002 Bacteria 718
280 Ga0307414_10000177 3300032004 Bacteria 43274
281 Ga0307414_10012210 3300032004 Bacteria 5068
282 Ga0307414_10189099 3300032004 Bacteria 1664
283 Ga0307414_10942952 3300032004 Bacteria 793
284 Ga0307411_10118034 3300032005 Bacteria 1913
285 Ga0307510_10151301 3300033180 Bacteria 1939
286 Ga0436364_0852694 3300037853 Bacteria 36694
287 Ga0237819_01727 3300038705 Bacteria 5207
288 Ga0436365_1329751 3300039437 Bacteria 890
289 Ga0436363_0443886 3300039450 Bacteria 4840
290 Ga0451793_0683499 3300041452 Bacteria 1342
291 Ga0451795_0780312 3300041456 Bacteria 1369
292 Ga0451802_0177882 3300041460 Bacteria 800
293 Ga0451804_0547077 3300041463 Bacteria 1096
294 Ga0451807_0425266 3300041486 Bacteria 1136
295 Ga0451807_2507748 3300041486 Bacteria 760
296 Ga0451853_2694079 3300041512 Bacteria 743
297 Ga0495585_0199770 3300046492 Bacteria 1019
298 Ga0495607_0041186 3300046501 Bacteria 2745
299 Ga0495616_0101965 3300046513 Bacteria 1345
300 Ga0495632_0134120 3300046519 Bacteria 1151
301 Ga0495663_0004262 3300046525 Bacteria 4033
302 Ga0495663_0024293 3300046525 Bacteria 1761
303 Ga0495654_0000736 3300046530 Bacteria 25435
304 Ga0495597_0012717 3300046542 Bacteria 4054
305 Ga0495668_0000076 3300046616 Bacteria 161826
306 Ga0495668_0001456 3300046616 Bacteria 22791
307 Ga0495668_0018394 3300046616 Bacteria 4037
308 Ga0495625_0000520 3300046660 Bacteria 56778
309 Ga0495589_0032112 3300046794 Bacteria 2641
310 Ga0495685_109341 3300047447 Bacteria 910
311 Ga0495686_0005031 3300047472 Bacteria 10612
312 Ga0496101_0080171 3300048904 Bacteria 2411
313 Ga0496101_0295850 3300048904 Bacteria 1267
314 Ga0496102_0003647 3300048905 Bacteria 13024
315 Ga0496102_0190213 3300048905 Bacteria 1934
316 Ga0496103_0000840 3300048906 Bacteria 22462
317 Ga0496103_0007333 3300048906 Bacteria 6572
318 Ga0496104_0591090 3300048907 Bacteria 1020
319 Ga0496105_0178867 3300048908 Bacteria 1737
320 Ga0496106_0050458 3300048909 Bacteria 3136
321 Ga0496107_0670902 3300048910 Bacteria 763
322 Ga0496108_0308095 3300048911 Bacteria 1380
323 Ga0496111_0348596 3300048914 Bacteria 1096
324 Ga0496116_0062100 3300048919 Bacteria 2414
325 Ga0496117_0037195 3300048920 Bacteria 3629
326 Ga0496118_0004860 3300048921 Bacteria 15648
327 Ga0496120_0015001 3300048923 Bacteria 5131
328 Ga0496121_0122657 3300048924 Bacteria 1959
329 Ga0496121_0182983 3300048924 Bacteria 1510
330 Ga0496122_0343163 3300048925 Bacteria 783
331 Ga0496123_0101512 3300048926 Bacteria 1672
332 Ga0496124_0002002 3300048927 Bacteria 27746
333 Ga0496124_0007069 3300048927 Bacteria 12023
334 Ga0496124_0131155 3300048927 Bacteria 1991
335 Ga0496124_0238959 3300048927 Bacteria 1352
336 Ga0496125_0177437 3300048928 Bacteria 1424
337 Ga0496125_0242506 3300048928 Bacteria 1143
338 Ga0496125_0311330 3300048928 Bacteria 959
339 Ga0496126_0096034 3300048929 Bacteria 2599
340 Ga0495678_068031 3300049459 Bacteria 1314
341 Ga0501290_000086 3300049513 Bacteria 13288
342 Ga0501290_017867 3300049513 Bacteria 952
343 Ga0501292_000019 3300049515 Bacteria 55694
344 Ga0501294_000190 3300049517 Bacteria 7585
345 Ga0501300_000128 3300049523 Bacteria 11180
346 Ga0501301_005570 3300049524 Bacteria 927
347 Ga0501031_0036268 3300049568 Bacteria 3216
348 Ga0501032_0016683 3300049569 Bacteria 5161
349 Ga0501032_0043876 3300049569 Bacteria 3027
350 Ga0501033_0321697 3300049570 Bacteria 1086
351 Ga0501034_0035875 3300049571 Bacteria 5027
352 Ga0501034_0530466 3300049571 Bacteria 1088
353 Ga0501036_0104308 3300049572 Bacteria 2397
354 Ga0501037_0053881 3300049573 Bacteria 2942
355 Ga0501038_0021428 3300049574 Bacteria 5800
356 Ga0501039_0029745 3300049575 Bacteria 4208
357 Ga0501040_0782656 3300049576 Bacteria 690
358 Ga0501043_0368799 3300049579 Bacteria 1088
359 Ga0501046_0148635 3300049580 Bacteria 1768
360 Ga0501047_0000402 3300049581 Bacteria 48648
361 Ga0501047_0131015 3300049581 Bacteria 2388
362 Ga0501048_0235742 3300049582 Bacteria 1298
363 Ga0501073_0400842 3300049589 Bacteria 948
364 Ga0501202_014388 3300049652 Bacteria 1515
365 Ga0501206_002061 3300049653 Bacteria 2537
366 Ga0501222_000809 3300049662 Bacteria 4497
367 Ga0501222_002076 3300049662 Bacteria 2772
368 Ga0501223_008808 3300049663 Bacteria 2054
369 Ga0501223_022810 3300049663 Bacteria 1222
370 Ga0501224_003397 3300049664 Bacteria 2217
371 Ga0501224_017889 3300049664 Bacteria 1055
372 Ga0501227_004681 3300049665 Bacteria 2936
373 Ga0501233_028842 3300049668 Bacteria 1241
374 Ga0501235_000351 3300049669 Bacteria 8794
375 Ga0501235_052167 3300049669 Bacteria 949
376 Ga0501236_002609 3300049670 Bacteria 2078
377 Ga0501249_000545 3300049679 Bacteria 9066
378 Ga0501257_071740 3300049686 Bacteria 885
379 Ga0501259_004339 3300049688 Bacteria 2258
380 Ga0501261_000061 3300049690 Bacteria 19269
381 Ga0501221_093313 3300049704 Bacteria 738
382 Ga0501225_0002229 3300049705 Bacteria 5993
383 Ga0501225_0009588 3300049705 Bacteria 2751
384 Ga0501245_005097 3300049708 Bacteria 1816
385 Ga0501279_000008 3300049775 Bacteria 125267
386 Ga0501280_000131 3300049776 Bacteria 19531
387 Ga0501280_007674 3300049776 Bacteria 1506
388 Ga0501281_00097 3300049777 Bacteria 10413
389 Ga0501282_002885 3300049778 Bacteria 1860
390 Ga0501282_009683 3300049778 Bacteria 1034
391 Ga0501283_005982 3300049779 Bacteria 1689
392 Ga0501035_0045752 3300049822 Bacteria 3936
393 Ga0501044_0015438 3300049823 Bacteria 8225
394 Ga0501044_0128928 3300049823 Bacteria 2525
395 Ga0501045_0241061 3300049824 Bacteria 1346
396 Ga0501204_008578 3300049850 Bacteria 1169
397 Ga0501284_10670 3300050005 Bacteria 564
398 Ga0500643_000338 3300053087 Bacteria 37288
399 Ga0500643_000351 3300053087 Bacteria 36635
400 Ga0500643_001549 3300053087 Bacteria 13025
401 Ga0500643_028605 3300053087 Bacteria 1722
402 Ga0500647_0044368 3300053091 Bacteria 2134
403 Ga0500651_0042612 3300053093 Bacteria 2860
404 Ga0500566_0071474 3300053094 Bacteria 1947
405 Ga0500569_069374 3300053109 Bacteria 1106
406 Ga0500592_000232 3300053116 Bacteria 10092
407 Ga0500592_000578 3300053116 Bacteria 6035
408 Ga0500607_160345 3300053121 Bacteria 1029
409 Ga0500618_011999 3300053125 Bacteria 2281
410 Ga0500642_0018625 3300053130 Bacteria 2690
411 Ga0500655_011842 3300053133 Bacteria 1583
412 Ga0500658_0077662 3300053134 Bacteria 1414
413 Ga0500658_0112069 3300053134 Bacteria 1202
414 Ga0500559_0007211 3300053136 Bacteria 4944
415 Ga0500568_0003694 3300053139 Bacteria 8399
416 Ga0500568_0007935 3300053139 Bacteria 5159
417 Ga0500577_0039468 3300053142 Bacteria 1711
418 Ga0500588_0058586 3300053146 Bacteria 1226
419 Ga0500590_005065 3300053148 Bacteria 6310
420 Ga0500604_0000053 3300053151 Bacteria 41228
421 Ga0500604_0014126 3300053151 Bacteria 2171
422 Ga0500604_0269082 3300053151 Bacteria 590
423 Ga0500616_0000411 3300053153 Bacteria 57962
424 Ga0500622_0038995 3300053156 Bacteria 2477
425 Ga0500627_0000757 3300053158 Bacteria 8582
426 Ga0500627_0002521 3300053158 Bacteria 5454
427 Ga0500627_0075720 3300053158 Bacteria 1496
428 Ga0500627_0231290 3300053158 Bacteria 822
429 Ga0500570_001921 3300053724 Bacteria 9977
430 Ga0500645_028013 3300053730 Bacteria 1706
431 Ga0500587_001709 3300053739 Bacteria 3119
432 2585260491 2582581305 Bacteria 4895574
433 2600225829 2599185359 Bacteria 4772316
434 2643730528 2643221541 Bacteria 5498788
435 2643819760 2643221560 Bacteria 4801179
436 2644037503 2643221605 Bacteria 4772303
437 2644043697 2643221606 Bacteria 5588032
438 2644393856 2643221671 Bacteria 5496681
439 2819716368 2818991466 Bacteria 4748179
440 2852654387 2852653556 Bacteria 4050083
441 2928528825 2928526807 Bacteria 4760224
442 2928970378 2928968154 Bacteria 4633371
443 2946787628 2946787523 Bacteria 4366789
444 8057101632 8057101203 Bacteria 5034064
445 Ga0500646_0028382
446 SwRhRL2b_contig_1505805
447 SwRhRL2b_contig_3439718
448 JGI24741J21665_1013465
449 JGI24752J21851_1003188
450 JGI24740J21852_10002064
451 JGI24740J21852_10034057
452 JGI24739J22299_10001692
453 JGI24737J22298_10024726
454 JGI24735J21928_10005665
455 JGI24748J21848_1000029
456 JGI24738J21930_10000138
457 JGI24738J21930_10003295
458 JGI24749J21850_1000094
459 JGI24749J21850_1001913
460 JGI24034J26672_10000006
461 JGI24742J22300_10002513
462 JGI24751J29686_10000093
463 JGI24751J29686_10008583
464 JGI24751J29686_10021088
465 Ga0055536_1010070
466 Ga0055534_1019334
467 Ga0055530_10000083
468 Ga0055530_10068130
469 Ga0055531_10000316
470 Ga0055531_10001717
471 Ga0065704_10078399
472 Ga0065704_10202209
473 Ga0065715_10916673
474 Ga0065707_10082105
475 Ga0065707_10082467
476 Ga0065707_10141585
477 Ga0065707_10484423
478 Ga0070658_10137441
479 Ga0070658_10160617
480 Ga0070690_100000002
481 Ga0070670_100000005
482 Ga0070670_100000169
483 Ga0070670_100000528
484 Ga0070670_100073948
485 Ga0070666_10000002
486 Ga0070666_10035929
487 Ga0070689_100007860
488 Ga0070668_100000007
489 Ga0070668_100324389
490 Ga0070668_100609554
491 Ga0070669_100000195
492 Ga0070669_100000440
493 Ga0070669_100034494
494 Ga0070671_100000388
495 Ga0070671_100027243
496 Ga0070674_100707454
497 Ga0070673_101380978
498 Ga0070688_100011582
499 Ga0070659_100042467
500 Ga0070659_100369057
501 Ga0070667_100000003
502 Ga0070667_100000327
503 Ga0070667_100001850
504 Ga0070667_100008584
505 Ga0070663_100185239
506 Ga0070662_100006250
507 Ga0070662_100060346
508 Ga0070662_100608194
509 Ga0070662_101024679
510 Ga0070681_10237857
511 Ga0070685_10000056
512 Ga0070679_100354019
513 Ga0070684_100693090
514 Ga0068853_100096736
515 Ga0070672_100229285
516 Ga0070686_100000002
517 Ga0070693_100829250
518 Ga0070665_100000025
519 Ga0070665_100004060
520 Ga0070665_100657668
521 Ga0068855_100004366
522 Ga0068857_100015964
523 Ga0068857_100134454
524 Ga0068857_100166790
525 Ga0068854_100029193
526 Ga0068854_100036277
527 Ga0068854_100322165
528 Ga0068856_100058625
529 Ga0068852_100215479
530 Ga0068859_100008939
531 Ga0068859_100012055
532 Ga0068859_100012820
533 Ga0068859_100025890
534 Ga0068864_100000004
535 Ga0068864_100000011
536 Ga0068864_100004976
537 Ga0068861_100220277
538 Ga0068851_10027890
539 Ga0068863_100000002
540 Ga0068863_100000070
541 Ga0068863_100003398
542 Ga0068863_100017965
543 Ga0068858_100001881
544 Ga0068858_100002924
545 Ga0068860_100000001
546 Ga0068860_100000045
547 Ga0068860_100040511
548 Ga0068862_100000002
549 Ga0068862_100000011
550 Ga0068862_100000020
551 Ga0068862_100000989
552 Ga0081540_1056312
553 Ga0097620_100008939
554 Ga0097620_100012054
555 Ga0097620_100012820
556 Ga0097620_100025890
557 Ga0105251_10000342
558 Ga0105250_10260431
559 Ga0105240_10009282
560 Ga0111539_10382741
561 Ga0105247_10017026
562 Ga0105247_10041415
563 Ga0105241_10230273
564 Ga0105248_10000016
565 Ga0105248_10000069
566 Ga0105248_10065895
567 Ga0105248_10509668
568 Ga0105237_10224635
569 Ga0105237_10586709
570 Ga0105237_10599018
571 Ga0105238_10051291
572 Ga0105238_10072055
573 Ga0105238_11100422
574 Ga0105249_10000005
575 Ga0105249_10000106
576 Ga0105249_10369014
577 Ga0105249_10810158
578 Ga0105239_10446539
579 Ga0105239_10509252
580 Ga0105239_10852509
581 Ga0157326_1000303
582 Ga0157373_10152970
583 Ga0157370_10025774
584 Ga0157370_11603128
585 Ga0157370_11667324
586 Ga0157369_10133762
587 Ga0157374_10365013
588 Ga0157378_10156954
589 Ga0163162_10060819
590 Ga0163162_10503157
591 Ga0157372_10138783
592 Ga0157372_10509317
593 Ga0163163_10101070
594 Ga0157380_10000304
595 Ga0157380_10000363
596 Ga0157380_10183104
597 Ga0157379_10007070
598 Ga0157379_10027796
599 Ga0163161_10000115
600 Ga0213876_10432585
601 Ga0213875_10001461
602 Ga0209675_1000190
603 Ga0209676_1000081
604 Ga0209676_1000133
605 Ga0209676_1000769
606 Ga0209025_1015501
607 Ga0209050_1000067
608 Ga0209050_1001738
609 Ga0209050_1011629
610 Ga0209257_1000132
611 Ga0209257_1000206
612 Ga0207656_10002142
613 Ga0207696_1167430
614 Ga0207713_1003473
615 Ga0207710_10018928
616 Ga0207710_10065620
617 Ga0207680_10000004
618 Ga0207680_10019012
619 Ga0207647_10000069
620 Ga0207705_10225117
621 Ga0207654_10006741
622 Ga0207707_10405559
623 Ga0207695_10007597
624 Ga0207695_10009337
625 Ga0207671_10001601
626 Ga0207657_10029090
627 Ga0207652_11444563
628 Ga0207681_10000001
629 Ga0207681_10000130
630 Ga0207681_10069244
631 Ga0207681_10122918
632 Ga0207694_10013118
633 Ga0207694_10014424
634 Ga0207694_10049465
635 Ga0207650_10000018
636 Ga0207650_10000294
637 Ga0207650_10004568
638 Ga0207650_10008589
639 Ga0207644_10000197
640 Ga0207644_10056031
641 Ga0207706_10011916
642 Ga0207706_10192545
643 Ga0207706_11060792
644 Ga0207670_10010788
645 Ga0207691_10093950
646 Ga0207711_10000022
647 Ga0207711_10001064
648 Ga0207711_10010013
649 Ga0207711_10416240
650 Ga0207679_10238592
651 Ga0207667_10000651
652 Ga0207667_10005163
653 Ga0207651_10367660
654 Ga0207712_10000001
655 Ga0207712_10000224
656 Ga0207712_10213795
657 Ga0207712_10611587
658 Ga0207668_10000026
659 Ga0207668_10309219
660 Ga0207668_10557372
661 Ga0207640_10008627
662 Ga0207640_10011938
663 Ga0207640_10045658
664 Ga0207640_10182577
665 Ga0207658_10000002
666 Ga0207658_10000364
667 Ga0207658_10000902
668 Ga0207658_10002462
669 Ga0207703_10000404
670 Ga0207703_10002475
671 Ga0207703_11504355
672 Ga0207639_10016543
673 Ga0207639_10131249
674 Ga0207639_10469477
675 Ga0207678_10187042
676 Ga0207702_10003987
677 Ga0207702_10003988
678 Ga0207702_10076647
679 Ga0207641_10000002
680 Ga0207641_10000033
681 Ga0207641_10004973
682 Ga0207641_10006503
683 Ga0207676_10000004
684 Ga0207676_10000040
685 Ga0207676_10000546
686 Ga0207674_10012150
687 Ga0207674_10142596
688 Ga0207674_10143991
689 Ga0207674_10249348
690 Ga0207674_10279210
691 Ga0207675_100003280
692 Ga0207675_100004115
693 Ga0207675_100132806
694 Ga0207698_10026565
695 Ga0207698_10101825
696 Ga0207698_10524414
697 Ga0268266_10000028
698 Ga0268266_10001270
699 Ga0268265_10000002
700 Ga0268265_10000003
701 Ga0268265_10000071
702 Ga0268265_10001985
703 Ga0268264_10000006
704 Ga0268264_10000101
705 Ga0268264_10754516
706 Ga0307517_10511383
707 Ga0307513_10614222
708 Ga0307408_100253979
709 Ga0307408_101781625
710 Ga0307405_10057984
711 Ga0307405_10068751
712 Ga0307405_10071128
713 Ga0307405_10458954
714 Ga0307410_10274723
715 Ga0307406_10103171
716 Ga0307412_10000165
717 Ga0307412_10000329
718 Ga0307412_10014384
719 Ga0307412_10022690
720 Ga0307412_10036493
721 Ga0307412_10162631
722 Ga0307416_100570300
723 Ga0307416_101789066
724 Ga0307414_10000177
725 Ga0307414_10012210
726 Ga0307414_10189099
727 Ga0307414_10942952
728 Ga0307411_10118034
729 Ga0307510_10151301
730 Ga0436364_0852694
731 Ga0237819_01727
732 Ga0436365_1329751
733 Ga0436363_0443886
734 Ga0451793_0683499
735 Ga0451795_0780312
736 Ga0451802_0177882
737 Ga0451804_0547077
738 Ga0451807_0425266
739 Ga0451807_2507748
740 Ga0451853_2694079
741 Ga0495585_0199770
742 Ga0495607_0041186
743 Ga0495616_0101965
744 Ga0495632_0134120
745 Ga0495663_0004262
746 Ga0495663_0024293
747 Ga0495654_0000736
748 Ga0495597_0012717
749 Ga0495668_0000076
750 Ga0495668_0001456
751 Ga0495668_0018394
752 Ga0495625_0000520
753 Ga0495589_0032112
754 Ga0495685_109341
755 Ga0495686_0005031
756 Ga0496101_0080171
757 Ga0496101_0295850
758 Ga0496102_0003647
759 Ga0496102_0190213
760 Ga0496103_0000840
761 Ga0496103_0007333
762 Ga0496104_0591090
763 Ga0496105_0178867
764 Ga0496106_0050458
765 Ga0496107_0670902
766 Ga0496108_0308095
767 Ga0496111_0348596
768 Ga0496116_0062100
769 Ga0496117_0037195
770 Ga0496118_0004860
771 Ga0496120_0015001
772 Ga0496121_0122657
773 Ga0496121_0182983
774 Ga0496122_0343163
775 Ga0496123_0101512
776 Ga0496124_0002002
777 Ga0496124_0007069
778 Ga0496124_0131155
779 Ga0496124_0238959
780 Ga0496125_0177437
781 Ga0496125_0242506
782 Ga0496125_0311330
783 Ga0496126_0096034
784 Ga0495678_068031
785 Ga0501290_000086
786 Ga0501290_017867
787 Ga0501292_000019
788 Ga0501294_000190
789 Ga0501300_000128
790 Ga0501301_005570
791 Ga0501031_0036268
792 Ga0501032_0016683
793 Ga0501032_0043876
794 Ga0501033_0321697
795 Ga0501034_0035875
796 Ga0501034_0530466
797 Ga0501036_0104308
798 Ga0501037_0053881
799 Ga0501038_0021428
800 Ga0501039_0029745
801 Ga0501040_0782656
802 Ga0501043_0368799
803 Ga0501046_0148635
804 Ga0501047_0000402
805 Ga0501047_0131015
806 Ga0501048_0235742
807 Ga0501073_0400842
808 Ga0501202_014388
809 Ga0501206_002061
810 Ga0501222_000809
811 Ga0501222_002076
812 Ga0501223_008808
813 Ga0501223_022810
814 Ga0501224_003397
815 Ga0501224_017889
816 Ga0501227_004681
817 Ga0501233_028842
818 Ga0501235_000351
819 Ga0501235_052167
820 Ga0501236_002609
821 Ga0501249_000545
822 Ga0501257_071740
823 Ga0501259_004339
824 Ga0501261_000061
825 Ga0501221_093313
826 Ga0501225_0002229
827 Ga0501225_0009588
828 Ga0501245_005097
829 Ga0501279_000008
830 Ga0501280_000131
831 Ga0501280_007674
832 Ga0501281_00097
833 Ga0501282_002885
834 Ga0501282_009683
835 Ga0501283_005982
836 Ga0501035_0045752
837 Ga0501044_0015438
838 Ga0501044_0128928
839 Ga0501045_0241061
840 Ga0501204_008578
841 Ga0501284_10670
842 Ga0500643_000338
843 Ga0500643_000351
844 Ga0500643_001549
845 Ga0500643_028605
846 Ga0500647_0044368
847 Ga0500651_0042612
848 Ga0500566_0071474
849 Ga0500569_069374
850 Ga0500592_000232
851 Ga0500592_000578
852 Ga0500607_160345
853 Ga0500618_011999
854 Ga0500642_0018625
855 Ga0500655_011842
856 Ga0500658_0077662
857 Ga0500658_0112069
858 Ga0500559_0007211
859 Ga0500568_0003694
860 Ga0500568_0007935
861 Ga0500577_0039468
862 Ga0500588_0058586
863 Ga0500590_005065
864 Ga0500604_0000053
865 Ga0500604_0014126
866 Ga0500604_0269082
867 Ga0500616_0000411
868 Ga0500622_0038995
869 Ga0500627_0000757
870 Ga0500627_0002521
871 Ga0500627_0075720
872 Ga0500627_0231290
873 Ga0500570_001921
874 Ga0500645_028013
875 Ga0500587_001709
876 2585260491
877 2600225829
878 2643730528
879 2643819760
880 2644037503
881 2644043697
882 2644393856
883 2819716368
884 2852654387
885 2928528825
886 2928970378
887 2946787628
888 8057101632

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

5

137

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b7b-assembly1.cif.gz_A crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 5-methoxy-2-methyl-1h-indole 0.9388 1 160
6b7d-assembly1.cif.gz_A crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 3-(4-chlorophenyl)-6-methoxy-4,5-dimethylpyridazine 0.9346 1 160
6g6v-assembly1.cif.gz_A phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 4-(2-carboxybenzoyl)-2-nitrobenzoic acid at 1.9a resolution. 0.9295 3 159
7yy8-assembly1.cif.gz_B-2 crystal structure of mycobacterium abscessus phosphopantetheine adenylyltransferase in complex with fragment 12 0.9285 3 159
6b7b-assembly1.cif.gz_A crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 5-methoxy-2-methyl-1h-indole 0.9273 1 160
ID Description Score Start End Superfamily
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9224 3 159 3.40.50.620
3nbkD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9154 1 159 3.40.50.620
5ts2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9135 1 159 3.40.50.620
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9045 3 159 3.40.50.620
4natB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8944 1 159 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A520HSR6-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) 0.9836 1 90 GO:0004595
GO:0005737
GO:0015937
AF-A0A520HSR6-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) 0.9729 1 90 GO:0004595
GO:0005737
GO:0015937
AF-A0A520DEJ7-F1-model_v4 deleted 0.9588 1 105
AF-A0A660VY32-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9474 3 162 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A5V280-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9472 3 167 GO:0004595
GO:0005524
GO:0005737
GO:0015937

Map