F445400

General Info

Members Datasets Scaffolds Average Seq Length
445 301 890 304

Family's Representative Sequence

Representative Sequence 3300002987|JGI25159J45721_1012339|JGI25159J45721_10123392
Length 314
Sequence MIGYLVRRIVLAIPTLFVMLTAIFVLVRLVPGDAASVILGDQASAASLAALREKLGLDQPVHVQYLAFLGKILTGDFGESLSSGRSVIREVLLVLPSTIELTVAAITIGLLFGLPLGVAAALSRNGWVDYVSRVVSLVGLSFPAFVSGILMLIVFAIQLNWFPVLGNTSGAGSFAERMRALALPALNLGIIMIAYVMRVTRAAMLGVLTEDYIRTARAKGVGPAQLVVTHALRNGLIPIITVVGLYFGTLIGNSVLTEIIFNRPGLGKLIIGALNARDYTLLQGLMIIFAICVIVVNTLTDLAYGLVDPRVKYS

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
84 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
143 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
144 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
145 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
146 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
159 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
169 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
172 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
173 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
174 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
175 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
176 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
177 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
178 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
179 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
180 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
184 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
187 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
188 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
189 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
190 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
191 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
194 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
195 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
196 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
197 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
200 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
201 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
202 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
206 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
207 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
223 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
224 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
225 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
226 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
227 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
228 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
229 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
230 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
245 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
248 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
249 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
250 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
251 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
252 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
253 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
254 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
255 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
256 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
257 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
258 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
259 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
260 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
261 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
262 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
263 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
264 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
265 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
266 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
267 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
268 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
271 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
272 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
273 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
274 2643221621 Achromobacter sp. Root83 Isolate Unclassified
275 2643221734 Bosea sp. Root670 Isolate Unclassified
276 2643221736 Bosea sp. Root483D1 Isolate Unclassified
277 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
278 2818991467 Bosea vestrisii 3192 Isolate Unclassified
279 2841760612 Bosea sp. Tri-49 Isolate Nodule
280 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
281 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
282 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
283 2844104063 Bosea sp. Tri-39 Isolate Nodule
284 2851182111 Bosea sp. Tri-44 Isolate Nodule
285 2851246043 Bosea sp. Tri-54 Isolate Nodule
286 2855730933 Achromobacter sp. HZ28 Isolate Nodule
287 2855767633 Achromobacter sp. HZ34 Isolate Nodule
288 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
289 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
290 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
291 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
292 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
293 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
294 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
295 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
296 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
297 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
298 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
299 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
300 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
301 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.58
Metatranscriptomes 0
Isolates 7.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.46
Nodule 2.92
Rhizoplane 5.17
Rhizosphere 71.69
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1012339 3300002987 Bacteria 2044
2 JGI25151J46595_10000441 3300003187 Bacteria 40607
3 JGI25151J46595_10000584 3300003187 Bacteria 32416
4 JGI25151J46595_10061271 3300003187 Bacteria 1198
5 Ga0055526_1000027 3300003771 Bacteria 150957
6 Ga0065165_1000014 3300005262 Bacteria 292366
7 Ga0065715_10100394 3300005293 Bacteria 3308
8 Ga0070676_10014053 3300005328 Bacteria 4393
9 Ga0070683_100017757 3300005329 Bacteria 6286
10 Ga0070683_100033906 3300005329 Bacteria 4659
11 Ga0070670_100000782 3300005331 Bacteria 24722
12 Ga0070670_100059245 3300005331 Bacteria 3286
13 Ga0070677_10001013 3300005333 Bacteria 9080
14 Ga0068869_100012055 3300005334 Bacteria 5696
15 Ga0070666_10073503 3300005335 Bacteria 2329
16 Ga0070680_100296508 3300005336 Bacteria 1371
17 Ga0068868_100046821 3300005338 Bacteria 3385
18 Ga0070660_100046519 3300005339 Bacteria 3326
19 Ga0070687_100036650 3300005343 Bacteria 2446
20 Ga0070661_100000387 3300005344 Bacteria 34490
21 Ga0070661_100205346 3300005344 Bacteria 1507
22 Ga0070668_100002747 3300005347 Bacteria 12952
23 Ga0070669_100002018 3300005353 Bacteria 14694
24 Ga0070669_100109508 3300005353 Bacteria 2094
25 Ga0070675_100000313 3300005354 Bacteria 32680
26 Ga0070671_100007425 3300005355 Bacteria 8761
27 Ga0070671_100065440 3300005355 Bacteria 3028
28 Ga0070671_100102829 3300005355 Bacteria 2397
29 Ga0070674_100003130 3300005356 Bacteria 9219
30 Ga0070674_100252457 3300005356 Bacteria 1386
31 Ga0070659_100244235 3300005366 Bacteria 1487
32 Ga0070667_100121394 3300005367 Bacteria 2273
33 Ga0070667_100263216 3300005367 Bacteria 1545
34 Ga0070667_100326942 3300005367 Bacteria 1384
35 Ga0070714_100030392 3300005435 Bacteria 4496
36 Ga0070663_100055572 3300005455 Bacteria 2834
37 Ga0070678_100042218 3300005456 Bacteria 3240
38 Ga0070678_100109020 3300005456 Bacteria 2162
39 Ga0070678_100117760 3300005456 Bacteria 2089
40 Ga0070678_100229306 3300005456 Bacteria 1547
41 Ga0070662_100031752 3300005457 Bacteria 3709
42 Ga0070662_100059042 3300005457 Bacteria 2793
43 Ga0070681_10041059 3300005458 Bacteria 4636
44 Ga0068867_100022558 3300005459 Bacteria 4500
45 Ga0070698_100178862 3300005471 Bacteria 2060
46 Ga0070679_100006687 3300005530 Bacteria 10754
47 Ga0070679_100019143 3300005530 Bacteria 6652
48 Ga0070684_100005072 3300005535 Bacteria 10058
49 Ga0068853_100030736 3300005539 Bacteria 4538
50 Ga0070672_100000269 3300005543 Bacteria 29466
51 Ga0070672_100170198 3300005543 Bacteria 1811
52 Ga0070672_100225926 3300005543 Bacteria 1571
53 Ga0070693_100019868 3300005547 Bacteria 3532
54 Ga0070693_100136818 3300005547 Bacteria 1538
55 Ga0070665_100098411 3300005548 Bacteria 2930
56 Ga0068855_100003942 3300005563 Bacteria 18114
57 Ga0070664_100001228 3300005564 Bacteria 20492
58 Ga0070664_100183770 3300005564 Bacteria 1860
59 Ga0068857_100000661 3300005577 Bacteria 25473
60 Ga0068854_100147049 3300005578 Bacteria 1814
61 Ga0068854_100213812 3300005578 Bacteria 1522
62 Ga0068856_100003798 3300005614 Bacteria 15129
63 Ga0068852_100000815 3300005616 Bacteria 20579
64 Ga0068852_100167770 3300005616 Bacteria 2055
65 Ga0068859_100220160 3300005617 Bacteria 1986
66 Ga0068859_100486246 3300005617 Bacteria 1330
67 Ga0068864_100046186 3300005618 Bacteria 3736
68 Ga0068864_100071128 3300005618 Bacteria 3028
69 Ga0068864_100090980 3300005618 Bacteria 2690
70 Ga0068864_100172195 3300005618 Bacteria 1974
71 Ga0068864_100291871 3300005618 Bacteria 1524
72 Ga0068861_100001218 3300005719 Bacteria 16020
73 Ga0068861_100005248 3300005719 Bacteria 8732
74 Ga0068851_10005894 3300005834 Bacteria 5577
75 Ga0068851_10033271 3300005834 Bacteria 2569
76 Ga0068870_10183747 3300005840 Bacteria 1257
77 Ga0068863_100036241 3300005841 Bacteria 4699
78 Ga0068863_100069734 3300005841 Bacteria 3324
79 Ga0068863_100116395 3300005841 Bacteria 2547
80 Ga0068860_100049817 3300005843 Bacteria 3988
81 Ga0068860_100060185 3300005843 Bacteria 3609
82 Ga0068860_100121101 3300005843 Bacteria 2505
83 Ga0068860_100148090 3300005843 Bacteria 2260
84 Ga0068862_100302678 3300005844 Bacteria 1471
85 Ga0075365_10012772 3300006038 Bacteria 5001
86 Ga0075363_100072100 3300006048 Bacteria 1878
87 Ga0075363_100136338 3300006048 Bacteria 1379
88 Ga0075364_10006323 3300006051 Bacteria 6960
89 Ga0075364_10016107 3300006051 Bacteria 4646
90 Ga0075364_10046484 3300006051 Bacteria 2826
91 Ga0075367_10046969 3300006178 Bacteria 2538
92 Ga0097621_100013308 3300006237 Bacteria 6128
93 Ga0097621_100045138 3300006237 Bacteria 3558
94 Ga0097621_100074128 3300006237 Bacteria 2819
95 Ga0075370_10069057 3300006353 Bacteria 2019
96 Ga0068871_100038836 3300006358 Bacteria 3805
97 Ga0068871_100092778 3300006358 Bacteria 2518
98 Ga0068871_100173557 3300006358 Bacteria 1849
99 Ga0075428_100454247 3300006844 Bacteria 1372
100 Ga0075430_100191608 3300006846 Bacteria 1699
101 Ga0068865_100028710 3300006881 Bacteria 3684
102 Ga0068865_100320394 3300006881 Bacteria 1247
103 Ga0097620_100220159 3300006931 Bacteria 1986
104 Ga0097620_100486200 3300006931 Bacteria 1330
105 Ga0105240_10009471 3300009093 Bacteria 13790
106 Ga0105240_10765762 3300009093 Bacteria 1048
107 Ga0105245_10036246 3300009098 Bacteria 4380
108 Ga0105243_10182298 3300009148 Bacteria 1827
109 Ga0105241_10244627 3300009174 Bacteria 1518
110 Ga0105242_10215590 3300009176 Bacteria 1713
111 Ga0105248_10039921 3300009177 Bacteria 5261
112 Ga0105248_10103885 3300009177 Bacteria 3203
113 Ga0105248_10223714 3300009177 Bacteria 2118
114 Ga0105248_10254838 3300009177 Bacteria 1975
115 Ga0105238_10000239 3300009551 Bacteria 61402
116 Ga0105238_10003580 3300009551 Bacteria 15490
117 Ga0105249_10173746 3300009553 Bacteria 2091
118 Ga0157373_10016191 3300013100 Bacteria 5441
119 Ga0157371_10034798 3300013102 Bacteria 3612
120 Ga0157371_10097350 3300013102 Bacteria 2086
121 Ga0157370_10002344 3300013104 Bacteria 22871
122 Ga0157370_10034136 3300013104 Bacteria 4956
123 Ga0157369_10541523 3300013105 Bacteria 1203
124 Ga0157369_10668809 3300013105 Bacteria 1070
125 Ga0171462_1043 3300013250 Bacteria 56604
126 Ga0157374_10076479 3300013296 Bacteria 3166
127 Ga0157374_10132894 3300013296 Bacteria 2409
128 Ga0157374_10668795 3300013296 Bacteria 1051
129 Ga0163162_10268801 3300013306 Bacteria 1837
130 Ga0163162_10338999 3300013306 Bacteria 1636
131 Ga0163162_10749188 3300013306 Bacteria 1096
132 Ga0157372_10004938 3300013307 Bacteria 14162
133 Ga0157372_10055170 3300013307 Bacteria 4436
134 Ga0157372_10128364 3300013307 Bacteria 2916
135 Ga0157372_10800527 3300013307 Bacteria 1095
136 Ga0157375_10044109 3300013308 Bacteria 4329
137 Ga0157375_10183950 3300013308 Bacteria 2242
138 Ga0157375_10343367 3300013308 Bacteria 1658
139 Ga0163163_10053558 3300014325 Bacteria 3983
140 Ga0182008_10001409 3300014497 Bacteria 16139
141 Ga0182008_10101469 3300014497 Bacteria 1423
142 Ga0157379_10009378 3300014968 Bacteria 8528
143 Ga0157379_10148169 3300014968 Bacteria 2117
144 Ga0157376_10000947 3300014969 Bacteria 18887
145 Ga0182006_1001180 3300015261 Bacteria 16409
146 Ga0182007_10001942 3300015262 Bacteria 10705
147 Ga0213876_10004109 3300021384 Bacteria 8176
148 Ga0209672_105433 3300025228 Bacteria 2183
149 Ga0209565_1018307 3300025263 Bacteria 1516
150 Ga0209455_1001357 3300025272 Bacteria 11241
151 Ga0209130_1000024 3300025284 Bacteria 354212
152 Ga0209675_1000570 3300025291 Bacteria 26588
153 Ga0209025_1000017 3300025294 Bacteria 768983
154 Ga0209025_1000018 3300025294 Bacteria 686898
155 Ga0209025_1006499 3300025294 Bacteria 9042
156 Ga0209564_1000180 3300025295 Bacteria 151009
157 Ga0209256_1018689 3300025299 Bacteria 2238
158 Ga0207426_1046565 3300025302 Bacteria 1313
159 Ga0209257_1042372 3300025304 Bacteria 1344
160 Ga0207697_10007598 3300025315 Bacteria 4813
161 Ga0207656_10018399 3300025321 Bacteria 2751
162 Ga0207656_10029296 3300025321 Bacteria 2266
163 Ga0207656_10108801 3300025321 Bacteria 1279
164 Ga0207682_10000830 3300025893 Bacteria 14279
165 Ga0207645_10004381 3300025907 Bacteria 10455
166 Ga0207705_10122375 3300025909 Bacteria 1932
167 Ga0207707_10005745 3300025912 Bacteria 10848
168 Ga0207707_10053249 3300025912 Bacteria 3523
169 Ga0207695_10018006 3300025913 Bacteria 8180
170 Ga0207660_10288275 3300025917 Bacteria 1305
171 Ga0207662_10058940 3300025918 Bacteria 2300
172 Ga0207657_10007074 3300025919 Bacteria 11527
173 Ga0207657_10078446 3300025919 Bacteria 2781
174 Ga0207652_10040962 3300025921 Bacteria 3936
175 Ga0207681_10025918 3300025923 Bacteria 3777
176 Ga0207681_10072928 3300025923 Bacteria 2399
177 Ga0207694_10023448 3300025924 Bacteria 4684
178 Ga0207650_10001673 3300025925 Bacteria 15751
179 Ga0207650_10023687 3300025925 Bacteria 4358
180 Ga0207650_10077481 3300025925 Bacteria 2513
181 Ga0207659_10002368 3300025926 Bacteria 11222
182 Ga0207664_10022834 3300025929 Bacteria 4679
183 Ga0207664_10123720 3300025929 Bacteria 2169
184 Ga0207644_10002722 3300025931 Bacteria 11388
185 Ga0207644_10069226 3300025931 Bacteria 2576
186 Ga0207690_10192898 3300025932 Bacteria 1542
187 Ga0207706_10000416 3300025933 Bacteria 45659
188 Ga0207706_10107831 3300025933 Bacteria 2451
189 Ga0207709_10036461 3300025935 Bacteria 2914
190 Ga0207670_10118245 3300025936 Bacteria 1922
191 Ga0207669_10038791 3300025937 Bacteria 2746
192 Ga0207669_10305474 3300025937 Bacteria 1211
193 Ga0207704_10034067 3300025938 Bacteria 2903
194 Ga0207691_10000561 3300025940 Bacteria 37149
195 Ga0207711_10018097 3300025941 Bacteria 5859
196 Ga0207711_10023489 3300025941 Bacteria 5162
197 Ga0207711_10063334 3300025941 Bacteria 3192
198 Ga0207711_10173059 3300025941 Bacteria 1960
199 Ga0207711_10295616 3300025941 Bacteria 1493
200 Ga0207689_10000220 3300025942 Bacteria 50583
201 Ga0207689_10057044 3300025942 Bacteria 3213
202 Ga0207661_10125497 3300025944 Bacteria 2191
203 Ga0207679_10020457 3300025945 Bacteria 4466
204 Ga0207679_10286759 3300025945 Bacteria 1414
205 Ga0207667_10229098 3300025949 Bacteria 1903
206 Ga0207651_10187708 3300025960 Bacteria 1646
207 Ga0207651_10229764 3300025960 Bacteria 1505
208 Ga0207712_10083317 3300025961 Bacteria 2334
209 Ga0207668_10019485 3300025972 Bacteria 4291
210 Ga0207668_10211955 3300025972 Bacteria 1550
211 Ga0207658_10122267 3300025986 Bacteria 2077
212 Ga0207658_10245748 3300025986 Bacteria 1518
213 Ga0207639_10011834 3300026041 Bacteria 6067
214 Ga0207678_10102122 3300026067 Bacteria 2448
215 Ga0207678_10106499 3300026067 Bacteria 2392
216 Ga0207702_10003907 3300026078 Bacteria 13413
217 Ga0207702_10374776 3300026078 Bacteria 1367
218 Ga0207641_10083484 3300026088 Bacteria 2778
219 Ga0207648_10001824 3300026089 Bacteria 23286
220 Ga0207648_10016554 3300026089 Bacteria 6733
221 Ga0207676_10043554 3300026095 Bacteria 3457
222 Ga0207676_10066517 3300026095 Bacteria 2875
223 Ga0207676_10131021 3300026095 Bacteria 2132
224 Ga0207676_10442624 3300026095 Bacteria 1223
225 Ga0207674_10000605 3300026116 Bacteria 47083
226 Ga0207675_100000548 3300026118 Bacteria 36639
227 Ga0207675_100003122 3300026118 Bacteria 16252
228 Ga0207675_100044374 3300026118 Bacteria 4154
229 Ga0207683_10025715 3300026121 Bacteria 5078
230 Ga0207683_10144126 3300026121 Bacteria 2147
231 Ga0207683_10434640 3300026121 Bacteria 1209
232 Ga0207698_10001837 3300026142 Bacteria 12404
233 Ga0207698_10010341 3300026142 Bacteria 5987
234 Ga0207698_10348829 3300026142 Bacteria 1397
235 Ga0268266_10057615 3300028379 Bacteria 3344
236 Ga0268265_10164735 3300028380 Bacteria 1888
237 Ga0268264_10093881 3300028381 Bacteria 2593
238 Ga0265318_10012822 3300028577 Bacteria 3555
239 Ga0265332_10022895 3300031238 Bacteria 2756
240 Ga0265328_10007699 3300031239 Bacteria 4478
241 Ga0265320_10010529 3300031240 Bacteria 5502
242 Ga0265331_10032916 3300031250 Bacteria 2565
243 Ga0307513_10000458 3300031456 Bacteria 58799
244 Ga0307513_10351347 3300031456 Bacteria 1222
245 Ga0265314_10000277 3300031711 Bacteria 74718
246 Ga0265342_10037339 3300031712 Bacteria 2963
247 Ga0307405_10059876 3300031731 Bacteria 2401
248 Ga0307413_10016872 3300031824 Bacteria 3789
249 Ga0307410_10083511 3300031852 Bacteria 2249
250 Ga0307412_10000252 3300031911 Bacteria 34826
251 Ga0307412_10005252 3300031911 Bacteria 7263
252 Ga0307409_100027674 3300031995 Bacteria 4023
253 Ga0307416_100125002 3300032002 Bacteria 2302
254 Ga0307414_10018629 3300032004 Bacteria 4281
255 Ga0307411_10019456 3300032005 Bacteria 3922
256 Ga0307510_10000029 3300033180 Bacteria 115686
257 Ga0373951_0036538 3300035091 Bacteria 1173
258 Ga0373955_0058066 3300035172 Bacteria 2128
259 Ga0373931_0022196 3300035691 Bacteria 3192
260 Ga0373937_0359251 3300036401 Bacteria 1380
261 Ga0395898_0005759 3300037466 Bacteria 13337
262 Ga0395905_0000063 3300037471 Bacteria 187830
263 Ga0395905_0208326 3300037471 Bacteria 1832
264 Ga0436364_0933571 3300037853 Bacteria 1550
265 Ga0395901_0000026 3300038443 Bacteria 249248
266 Ga0395901_0000045 3300038443 Bacteria 188874
267 Ga0436365_0156089 3300039437 Bacteria 2229
268 Ga0436365_0161983 3300039437 Bacteria 9173
269 Ga0436365_0382394 3300039437 Bacteria 1245
270 Ga0436365_0614178 3300039437 Bacteria 3448
271 Ga0436365_0633965 3300039437 Bacteria 1593
272 Ga0436360_1090220 3300039438 Bacteria 3083
273 Ga0436361_0106719 3300039447 Bacteria 6126
274 Ga0436363_1233042 3300039450 Bacteria 1027
275 Ga0436363_1499244 3300039450 Bacteria 1372
276 Ga0439438_000303 3300041405 Bacteria 22066
277 Ga0439447_000174 3300041407 Bacteria 22394
278 Ga0439447_004186 3300041407 Bacteria 5008
279 Ga0439466_0000018 3300041411 Bacteria 103207
280 Ga0439465_0019229 3300041413 Bacteria 2135
281 Ga0451853_0671037 3300041512 Bacteria 1443
282 Ga0439452_002367 3300042010 Bacteria 7002
283 Ga0450906_006910 3300042145 Bacteria 2266
284 Ga0450907_004607 3300042146 Bacteria 2368
285 Ga0450910_000036 3300042147 Bacteria 15727
286 Ga0450908_000057 3300042184 Bacteria 22298
287 Ga0453684_0008467 3300044712 Bacteria 18410
288 Ga0451576_0029621 3300045051 Bacteria 5857
289 Ga0451576_0071024 3300045051 Bacteria 3624
290 Ga0495592_0258173 3300046454 Bacteria 1149
291 Ga0495603_0136467 3300046455 Bacteria 1428
292 Ga0495638_0061310 3300046460 Bacteria 2324
293 Ga0495653_0000340 3300046463 Bacteria 38062
294 Ga0495653_0121299 3300046463 Bacteria 1863
295 Ga0495650_0031274 3300046471 Bacteria 2398
296 Ga0495582_0105840 3300046473 Bacteria 1578
297 Ga0495585_0142682 3300046492 Bacteria 1253
298 Ga0495607_0000004 3300046501 Bacteria 317271
299 Ga0495607_0000782 3300046501 Bacteria 30333
300 Ga0495607_0001077 3300046501 Bacteria 24947
301 Ga0495583_0001011 3300046506 Bacteria 32138
302 Ga0495608_0135807 3300046511 Bacteria 1572
303 Ga0495610_0054196 3300046512 Bacteria 1938
304 Ga0495610_0082730 3300046512 Bacteria 1471
305 Ga0495632_0034140 3300046519 Bacteria 2606
306 Ga0495654_0000495 3300046530 Bacteria 32218
307 Ga0495654_0014932 3300046530 Bacteria 4126
308 Ga0495586_0110443 3300046535 Bacteria 1530
309 Ga0495609_0000091 3300046538 Bacteria 106458
310 Ga0495645_0132525 3300046543 Bacteria 1745
311 Ga0495625_0000173 3300046660 Bacteria 101216
312 Ga0495661_0006696 3300046665 Bacteria 8090
313 Ga0495588_0000211 3300046674 Bacteria 55979
314 Ga0495647_0041340 3300046681 Bacteria 1755
315 Ga0495613_0044047 3300046689 Bacteria 3302
316 Ga0495674_0134224 3300047319 Bacteria 2084
317 Ga0495687_004057 3300047443 Bacteria 10146
318 Ga0495687_013244 3300047443 Unclassified 4315
319 Ga0495681_0006350 3300047470 Bacteria 7781
320 Ga0495626_0135340 3300048091 Bacteria 1048
321 Ga0496101_0265933 3300048904 Bacteria 1338
322 Ga0496102_0102756 3300048905 Bacteria 2657
323 Ga0496102_0508736 3300048905 Bacteria 1127
324 Ga0496104_0000854 3300048907 Bacteria 26337
325 Ga0496104_0124240 3300048907 Bacteria 2478
326 Ga0496105_0002766 3300048908 Bacteria 12815
327 Ga0496105_0271539 3300048908 Bacteria 1369
328 Ga0496106_0033025 3300048909 Bacteria 3859
329 Ga0496107_0040428 3300048910 Bacteria 3347
330 Ga0496108_0053473 3300048911 Bacteria 3387
331 Ga0496108_0078255 3300048911 Bacteria 2798
332 Ga0496108_0181484 3300048911 Bacteria 1823
333 Ga0496109_0023033 3300048912 Bacteria 5522
334 Ga0496109_0075483 3300048912 Bacteria 3099
335 Ga0496109_0175537 3300048912 Bacteria 2011
336 Ga0496110_0052405 3300048913 Bacteria 3585
337 Ga0496110_0374246 3300048913 Bacteria 1298
338 Ga0496111_0040641 3300048914 Bacteria 3336
339 Ga0496112_0063874 3300048915 Bacteria 3632
340 Ga0496112_0482367 3300048915 Bacteria 1176
341 Ga0496113_0002812 3300048916 Bacteria 10241
342 Ga0496114_0020035 3300048917 Bacteria 5426
343 Ga0496115_0107344 3300048918 Bacteria 2292
344 Ga0496117_0023650 3300048920 Bacteria 4888
345 Ga0496117_0029315 3300048920 Bacteria 4245
346 Ga0496117_0053063 3300048920 Bacteria 2851
347 Ga0496118_0029213 3300048921 Bacteria 4627
348 Ga0496121_0016352 3300048924 Bacteria 7666
349 Ga0496121_0190317 3300048924 Bacteria 1472
350 Ga0496122_0016614 3300048925 Bacteria 6946
351 Ga0496122_0056743 3300048925 Bacteria 2916
352 Ga0496123_0013951 3300048926 Bacteria 6695
353 Ga0496123_0110811 3300048926 Bacteria 1569
354 Ga0496124_0000038 3300048927 Bacteria 312485
355 Ga0496124_0245303 3300048927 Bacteria 1329
356 Ga0496125_0120945 3300048928 Bacteria 1868
357 Ga0496126_0162604 3300048929 Bacteria 1907
358 Ga0501031_0000005 3300049568 Bacteria 183960
359 Ga0501032_0000337 3300049569 Bacteria 39238
360 Ga0501033_0000631 3300049570 Bacteria 32526
361 Ga0501033_0016211 3300049570 Bacteria 5643
362 Ga0501033_0151234 3300049570 Bacteria 1675
363 Ga0501034_0001953 3300049571 Bacteria 26109
364 Ga0501034_0044417 3300049571 Bacteria 4495
365 Ga0501036_0000014 3300049572 Bacteria 148705
366 Ga0501037_0000517 3300049573 Bacteria 30998
367 Ga0501038_0000024 3300049574 Bacteria 148705
368 Ga0501038_0069390 3300049574 Bacteria 2994
369 Ga0501039_0000122 3300049575 Bacteria 53871
370 Ga0501040_0014270 3300049576 Bacteria 5233
371 Ga0501043_0000987 3300049579 Bacteria 25068
372 Ga0501047_0001328 3300049581 Bacteria 24254
373 Ga0501047_0002249 3300049581 Bacteria 18472
374 Ga0501067_0011293 3300049583 Bacteria 4946
375 Ga0501070_0002802 3300049586 Bacteria 15213
376 Ga0501070_0171349 3300049586 Bacteria 1788
377 Ga0501074_0078651 3300049590 Bacteria 2367
378 Ga0501227_002667 3300049665 Bacteria 3915
379 Ga0501035_0000045 3300049822 Bacteria 148705
380 Ga0501035_0018636 3300049822 Bacteria 6392
381 Ga0501035_0302995 3300049822 Bacteria 1346
382 Ga0501044_0000044 3300049823 Bacteria 148705
383 Ga0501044_0003322 3300049823 Bacteria 18122
384 nmdc:mga03n38_58627_c1 3300050490 Bacteria 1745
385 nmdc:mga00v17_3430_c2 3300050491 Bacteria 4875
386 nmdc:mga0yw44_104797_c1 3300050492 Bacteria 1806
387 nmdc:mga0k408_71589_c1 3300050493 Bacteria 2024
388 nmdc:mga06z11_2217_c1 3300050494 Bacteria 7384
389 nmdc:mga06z11_25407_c1 3300050494 Bacteria 2807
390 nmdc:mga06z11_66485_c1 3300050494 Bacteria 1895
391 nmdc:mga06z11_82287_c1 3300050494 Bacteria 1730
392 nmdc:mga07m45_87930_c2 3300050496 Bacteria 1329
393 nmdc:mga0rr50_210801_c1 3300050513 Bacteria 1600
394 nmdc:mga0rr50_225491_c1 3300050513 Bacteria 1549
395 Ga0500610_0000690 3300053079 Bacteria 10468
396 Ga0495619_0259618 3300053085 Bacteria 1204
397 Ga0500572_000208 3300053111 Bacteria 20777
398 Ga0500608_072688 3300053122 Bacteria 1634
399 Ga0500618_002577 3300053125 Bacteria 6713
400 Ga0500559_0157567 3300053136 Bacteria 1066
401 Ga0500568_0003635 3300053139 Bacteria 8496
402 Ga0500568_0041809 3300053139 Bacteria 1840
403 Ga0500574_000022 3300053141 Bacteria 27422
404 Ga0500616_0000465 3300053153 Bacteria 52660
405 Ga0500616_0023023 3300053153 Bacteria 3474
406 Ga0500624_001856 3300053157 Bacteria 3059
407 Ga0500639_008527 3300053163 Bacteria 5349
408 Ga0500636_0003252 3300053177 Bacteria 9106
409 Ga0500576_059255 3300053725 Bacteria 1679
410 Ga0500596_000787 3300053735 Bacteria 6251
411 Ga0500661_009126 3300055283 Bacteria 1820
412 Ga0501082_0040593 3300060353 Bacteria 4013
413 2511169610 2510917026 Bacteria 7046020
414 2513587413 2513237086 Bacteria 7265287
415 2513721349 2513237104 Bacteria 10034502
416 2537876922 2537561587 Bacteria 5425293
417 2644124029 2643221621 Bacteria 6212786
418 2644736453 2643221734 Bacteria 5365412
419 2644742923 2643221736 Bacteria 6608466
420 2738899713 2738541309 Bacteria 6926455
421 2819718536 2818991467 Bacteria 5893227
422 2819722000 2818991467 Bacteria 5893227
423 2841765714 2841760612 Bacteria 6454112
424 2841914756 2841911363 Bacteria 6173697
425 2841920079 2841917233 Bacteria 6173500
426 2842335184 2842333319 Bacteria 8899485
427 2844107324 2844104063 Bacteria 6440972
428 2851187847 2851182111 Bacteria 6047226
429 2851249364 2851246043 Bacteria 6439203
430 2855731861 2855730933 Bacteria 7047938
431 2855768567 2855767633 Bacteria 7049357
432 2857544652 2857542790 Bacteria 5326616
433 2881415461 2881412998 Bacteria 6492157
434 2881930006 2881927736 Bacteria 3993927
435 2885270959 2885270888 Bacteria 9831543
436 2889791071 2889790730 Bacteria 5689708
437 2889915443 2889914905 Bacteria 5702301
438 2899262571 2899259804 Bacteria 3320927
439 2917702146 2917699015 Bacteria 7043791
440 2919119469 2919114240 Bacteria 5700270
441 2919177168 2919171160 Bacteria 6499771
442 3003670498 3003665799 Bacteria 7279786
443 8004396827 8004395343 Bacteria 6620908
444 8054564219 8054563764 Bacteria 5592885
445 8057532043 8057529695 Bacteria 6306553
446 JGI25159J45721_1012339
447 JGI25151J46595_10000441
448 JGI25151J46595_10000584
449 JGI25151J46595_10061271
450 Ga0055526_1000027
451 Ga0065165_1000014
452 Ga0065715_10100394
453 Ga0070676_10014053
454 Ga0070683_100017757
455 Ga0070683_100033906
456 Ga0070670_100000782
457 Ga0070670_100059245
458 Ga0070677_10001013
459 Ga0068869_100012055
460 Ga0070666_10073503
461 Ga0070680_100296508
462 Ga0068868_100046821
463 Ga0070660_100046519
464 Ga0070687_100036650
465 Ga0070661_100000387
466 Ga0070661_100205346
467 Ga0070668_100002747
468 Ga0070669_100002018
469 Ga0070669_100109508
470 Ga0070675_100000313
471 Ga0070671_100007425
472 Ga0070671_100065440
473 Ga0070671_100102829
474 Ga0070674_100003130
475 Ga0070674_100252457
476 Ga0070659_100244235
477 Ga0070667_100121394
478 Ga0070667_100263216
479 Ga0070667_100326942
480 Ga0070714_100030392
481 Ga0070663_100055572
482 Ga0070678_100042218
483 Ga0070678_100109020
484 Ga0070678_100117760
485 Ga0070678_100229306
486 Ga0070662_100031752
487 Ga0070662_100059042
488 Ga0070681_10041059
489 Ga0068867_100022558
490 Ga0070698_100178862
491 Ga0070679_100006687
492 Ga0070679_100019143
493 Ga0070684_100005072
494 Ga0068853_100030736
495 Ga0070672_100000269
496 Ga0070672_100170198
497 Ga0070672_100225926
498 Ga0070693_100019868
499 Ga0070693_100136818
500 Ga0070665_100098411
501 Ga0068855_100003942
502 Ga0070664_100001228
503 Ga0070664_100183770
504 Ga0068857_100000661
505 Ga0068854_100147049
506 Ga0068854_100213812
507 Ga0068856_100003798
508 Ga0068852_100000815
509 Ga0068852_100167770
510 Ga0068859_100220160
511 Ga0068859_100486246
512 Ga0068864_100046186
513 Ga0068864_100071128
514 Ga0068864_100090980
515 Ga0068864_100172195
516 Ga0068864_100291871
517 Ga0068861_100001218
518 Ga0068861_100005248
519 Ga0068851_10005894
520 Ga0068851_10033271
521 Ga0068870_10183747
522 Ga0068863_100036241
523 Ga0068863_100069734
524 Ga0068863_100116395
525 Ga0068860_100049817
526 Ga0068860_100060185
527 Ga0068860_100121101
528 Ga0068860_100148090
529 Ga0068862_100302678
530 Ga0075365_10012772
531 Ga0075363_100072100
532 Ga0075363_100136338
533 Ga0075364_10006323
534 Ga0075364_10016107
535 Ga0075364_10046484
536 Ga0075367_10046969
537 Ga0097621_100013308
538 Ga0097621_100045138
539 Ga0097621_100074128
540 Ga0075370_10069057
541 Ga0068871_100038836
542 Ga0068871_100092778
543 Ga0068871_100173557
544 Ga0075428_100454247
545 Ga0075430_100191608
546 Ga0068865_100028710
547 Ga0068865_100320394
548 Ga0097620_100220159
549 Ga0097620_100486200
550 Ga0105240_10009471
551 Ga0105240_10765762
552 Ga0105245_10036246
553 Ga0105243_10182298
554 Ga0105241_10244627
555 Ga0105242_10215590
556 Ga0105248_10039921
557 Ga0105248_10103885
558 Ga0105248_10223714
559 Ga0105248_10254838
560 Ga0105238_10000239
561 Ga0105238_10003580
562 Ga0105249_10173746
563 Ga0157373_10016191
564 Ga0157371_10034798
565 Ga0157371_10097350
566 Ga0157370_10002344
567 Ga0157370_10034136
568 Ga0157369_10541523
569 Ga0157369_10668809
570 Ga0171462_1043
571 Ga0157374_10076479
572 Ga0157374_10132894
573 Ga0157374_10668795
574 Ga0163162_10268801
575 Ga0163162_10338999
576 Ga0163162_10749188
577 Ga0157372_10004938
578 Ga0157372_10055170
579 Ga0157372_10128364
580 Ga0157372_10800527
581 Ga0157375_10044109
582 Ga0157375_10183950
583 Ga0157375_10343367
584 Ga0163163_10053558
585 Ga0182008_10001409
586 Ga0182008_10101469
587 Ga0157379_10009378
588 Ga0157379_10148169
589 Ga0157376_10000947
590 Ga0182006_1001180
591 Ga0182007_10001942
592 Ga0213876_10004109
593 Ga0209672_105433
594 Ga0209565_1018307
595 Ga0209455_1001357
596 Ga0209130_1000024
597 Ga0209675_1000570
598 Ga0209025_1000017
599 Ga0209025_1000018
600 Ga0209025_1006499
601 Ga0209564_1000180
602 Ga0209256_1018689
603 Ga0207426_1046565
604 Ga0209257_1042372
605 Ga0207697_10007598
606 Ga0207656_10018399
607 Ga0207656_10029296
608 Ga0207656_10108801
609 Ga0207682_10000830
610 Ga0207645_10004381
611 Ga0207705_10122375
612 Ga0207707_10005745
613 Ga0207707_10053249
614 Ga0207695_10018006
615 Ga0207660_10288275
616 Ga0207662_10058940
617 Ga0207657_10007074
618 Ga0207657_10078446
619 Ga0207652_10040962
620 Ga0207681_10025918
621 Ga0207681_10072928
622 Ga0207694_10023448
623 Ga0207650_10001673
624 Ga0207650_10023687
625 Ga0207650_10077481
626 Ga0207659_10002368
627 Ga0207664_10022834
628 Ga0207664_10123720
629 Ga0207644_10002722
630 Ga0207644_10069226
631 Ga0207690_10192898
632 Ga0207706_10000416
633 Ga0207706_10107831
634 Ga0207709_10036461
635 Ga0207670_10118245
636 Ga0207669_10038791
637 Ga0207669_10305474
638 Ga0207704_10034067
639 Ga0207691_10000561
640 Ga0207711_10018097
641 Ga0207711_10023489
642 Ga0207711_10063334
643 Ga0207711_10173059
644 Ga0207711_10295616
645 Ga0207689_10000220
646 Ga0207689_10057044
647 Ga0207661_10125497
648 Ga0207679_10020457
649 Ga0207679_10286759
650 Ga0207667_10229098
651 Ga0207651_10187708
652 Ga0207651_10229764
653 Ga0207712_10083317
654 Ga0207668_10019485
655 Ga0207668_10211955
656 Ga0207658_10122267
657 Ga0207658_10245748
658 Ga0207639_10011834
659 Ga0207678_10102122
660 Ga0207678_10106499
661 Ga0207702_10003907
662 Ga0207702_10374776
663 Ga0207641_10083484
664 Ga0207648_10001824
665 Ga0207648_10016554
666 Ga0207676_10043554
667 Ga0207676_10066517
668 Ga0207676_10131021
669 Ga0207676_10442624
670 Ga0207674_10000605
671 Ga0207675_100000548
672 Ga0207675_100003122
673 Ga0207675_100044374
674 Ga0207683_10025715
675 Ga0207683_10144126
676 Ga0207683_10434640
677 Ga0207698_10001837
678 Ga0207698_10010341
679 Ga0207698_10348829
680 Ga0268266_10057615
681 Ga0268265_10164735
682 Ga0268264_10093881
683 Ga0265318_10012822
684 Ga0265332_10022895
685 Ga0265328_10007699
686 Ga0265320_10010529
687 Ga0265331_10032916
688 Ga0307513_10000458
689 Ga0307513_10351347
690 Ga0265314_10000277
691 Ga0265342_10037339
692 Ga0307405_10059876
693 Ga0307413_10016872
694 Ga0307410_10083511
695 Ga0307412_10000252
696 Ga0307412_10005252
697 Ga0307409_100027674
698 Ga0307416_100125002
699 Ga0307414_10018629
700 Ga0307411_10019456
701 Ga0307510_10000029
702 Ga0373951_0036538
703 Ga0373955_0058066
704 Ga0373931_0022196
705 Ga0373937_0359251
706 Ga0395898_0005759
707 Ga0395905_0000063
708 Ga0395905_0208326
709 Ga0436364_0933571
710 Ga0395901_0000026
711 Ga0395901_0000045
712 Ga0436365_0156089
713 Ga0436365_0161983
714 Ga0436365_0382394
715 Ga0436365_0614178
716 Ga0436365_0633965
717 Ga0436360_1090220
718 Ga0436361_0106719
719 Ga0436363_1233042
720 Ga0436363_1499244
721 Ga0439438_000303
722 Ga0439447_000174
723 Ga0439447_004186
724 Ga0439466_0000018
725 Ga0439465_0019229
726 Ga0451853_0671037
727 Ga0439452_002367
728 Ga0450906_006910
729 Ga0450907_004607
730 Ga0450910_000036
731 Ga0450908_000057
732 Ga0453684_0008467
733 Ga0451576_0029621
734 Ga0451576_0071024
735 Ga0495592_0258173
736 Ga0495603_0136467
737 Ga0495638_0061310
738 Ga0495653_0000340
739 Ga0495653_0121299
740 Ga0495650_0031274
741 Ga0495582_0105840
742 Ga0495585_0142682
743 Ga0495607_0000004
744 Ga0495607_0000782
745 Ga0495607_0001077
746 Ga0495583_0001011
747 Ga0495608_0135807
748 Ga0495610_0054196
749 Ga0495610_0082730
750 Ga0495632_0034140
751 Ga0495654_0000495
752 Ga0495654_0014932
753 Ga0495586_0110443
754 Ga0495609_0000091
755 Ga0495645_0132525
756 Ga0495625_0000173
757 Ga0495661_0006696
758 Ga0495588_0000211
759 Ga0495647_0041340
760 Ga0495613_0044047
761 Ga0495674_0134224
762 Ga0495687_004057
763 Ga0495687_013244
764 Ga0495681_0006350
765 Ga0495626_0135340
766 Ga0496101_0265933
767 Ga0496102_0102756
768 Ga0496102_0508736
769 Ga0496104_0000854
770 Ga0496104_0124240
771 Ga0496105_0002766
772 Ga0496105_0271539
773 Ga0496106_0033025
774 Ga0496107_0040428
775 Ga0496108_0053473
776 Ga0496108_0078255
777 Ga0496108_0181484
778 Ga0496109_0023033
779 Ga0496109_0075483
780 Ga0496109_0175537
781 Ga0496110_0052405
782 Ga0496110_0374246
783 Ga0496111_0040641
784 Ga0496112_0063874
785 Ga0496112_0482367
786 Ga0496113_0002812
787 Ga0496114_0020035
788 Ga0496115_0107344
789 Ga0496117_0023650
790 Ga0496117_0029315
791 Ga0496117_0053063
792 Ga0496118_0029213
793 Ga0496121_0016352
794 Ga0496121_0190317
795 Ga0496122_0016614
796 Ga0496122_0056743
797 Ga0496123_0013951
798 Ga0496123_0110811
799 Ga0496124_0000038
800 Ga0496124_0245303
801 Ga0496125_0120945
802 Ga0496126_0162604
803 Ga0501031_0000005
804 Ga0501032_0000337
805 Ga0501033_0000631
806 Ga0501033_0016211
807 Ga0501033_0151234
808 Ga0501034_0001953
809 Ga0501034_0044417
810 Ga0501036_0000014
811 Ga0501037_0000517
812 Ga0501038_0000024
813 Ga0501038_0069390
814 Ga0501039_0000122
815 Ga0501040_0014270
816 Ga0501043_0000987
817 Ga0501047_0001328
818 Ga0501047_0002249
819 Ga0501067_0011293
820 Ga0501070_0002802
821 Ga0501070_0171349
822 Ga0501074_0078651
823 Ga0501227_002667
824 Ga0501035_0000045
825 Ga0501035_0018636
826 Ga0501035_0302995
827 Ga0501044_0000044
828 Ga0501044_0003322
829 nmdc:mga03n38_58627_c1
830 nmdc:mga00v17_3430_c2
831 nmdc:mga0yw44_104797_c1
832 nmdc:mga0k408_71589_c1
833 nmdc:mga06z11_2217_c1
834 nmdc:mga06z11_25407_c1
835 nmdc:mga06z11_66485_c1
836 nmdc:mga06z11_82287_c1
837 nmdc:mga07m45_87930_c2
838 nmdc:mga0rr50_210801_c1
839 nmdc:mga0rr50_225491_c1
840 Ga0500610_0000690
841 Ga0495619_0259618
842 Ga0500572_000208
843 Ga0500608_072688
844 Ga0500618_002577
845 Ga0500559_0157567
846 Ga0500568_0003635
847 Ga0500568_0041809
848 Ga0500574_000022
849 Ga0500616_0000465
850 Ga0500616_0023023
851 Ga0500624_001856
852 Ga0500639_008527
853 Ga0500636_0003252
854 Ga0500576_059255
855 Ga0500596_000787
856 Ga0500661_009126
857 Ga0501082_0040593
858 2511169610
859 2513587413
860 2513721349
861 2537876922
862 2644124029
863 2644736453
864 2644742923
865 2738899713
866 2819718536
867 2819722000
868 2841765714
869 2841914756
870 2841920079
871 2842335184
872 2844107324
873 2851187847
874 2851249364
875 2855731861
876 2855768567
877 2857544652
878 2881415461
879 2881930006
880 2885270959
881 2889791071
882 2889915443
883 2899262571
884 2917702146
885 2919119469
886 2919177168
887 3003670498
888 8004396827
889 8054564219
890 8057532043

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

113

313

0.96

PF19300

BPD_transp_1_N

Binding-prot-dependent transport system membrane comp, N-term

1

102

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.8338 91 308
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.8131 87 308
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7981 91 308
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.7892 88 308
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7822 87 308
ID Description Score Start End Superfamily
af_P33591_90_303_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9262 88 308 1.10.3720.10
af_Q2G1F7_265_478_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9226 87 304 1.10.3720.10
af_P0AFH2_84_300_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9186 85 306 1.10.3720.10
af_Q2FZR7_83_297_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9182 85 306 1.10.3720.10
af_P33591_90_303_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.918 88 308 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A5N9DP11-F1-model_v4 ABC transporter permease 0.9482 1 312 GO:0005886
GO:0071916
AF-A0A8A5YY99-F1-model_v4 deleted 0.9452 1 312
AF-A0A5K7YRU6-F1-model_v4 Peptide ABC transporter permease 0.9435 1 311 GO:0005886
GO:0071916
AF-A0A3G1KXG7-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9427 1 314 GO:0005886
GO:0055085
AF-A0A3P3ESG9-F1-model_v4 ABC transporter permease 0.9426 1 311 GO:0005886
GO:0071916

Map