F445404

General Info

Members Datasets Scaffolds Average Seq Length
445 329 891 209

Family's Representative Sequence

Representative Sequence 3300003215|JGI25153J46596_10005014|JGI25153J46596_100050145
Length 246
Sequence MCNGKVANKGDNCQSLTFRRCFGRAMIICSTSMNFVQAVMEKTMGNGIQDVLDIYHAMIETEHNSPRELPPGGRDGGQDQRLRAVGPETGQFINILARSLKAPTILELGTSXGYSGIWLAEAARASGGRLITMEMHXYKSAYARDMAVRAGLAEYVEFXVGDAVQMXGXLSSGIXFVLVDLWKDLYVPCLEAFYPKLNPGAIIVADNMLRPGGDDLKRYGEAVRAKPGISSVLLPVGSGLEVSRFD

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
57 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
65 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
66 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
67 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
68 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
69 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
70 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
72 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
104 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
123 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
126 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
127 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
128 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
129 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
130 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
131 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
132 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
133 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
134 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
135 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
139 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
140 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
141 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
142 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
143 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
144 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
145 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
146 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
147 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
148 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
149 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
150 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
151 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
152 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
153 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
154 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
155 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
156 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
159 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
160 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
161 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
162 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
163 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
164 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
165 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
166 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
167 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
168 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
169 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
170 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
171 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
182 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
185 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
188 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
193 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
200 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
201 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
202 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
205 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
206 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
207 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
208 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
209 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
210 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
211 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
212 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
213 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
214 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
215 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
216 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
217 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
218 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
219 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
220 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
221 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
222 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
223 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
224 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
225 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
226 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
229 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
230 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
231 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
232 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
233 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
234 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
235 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
236 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
237 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
238 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
239 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
240 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
241 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
242 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
243 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
244 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
245 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
246 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
247 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
248 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
249 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
250 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
251 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
252 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
253 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
254 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
255 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
256 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
257 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
258 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
259 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
260 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
261 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
262 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
263 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
264 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
265 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
266 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
267 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
268 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
269 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
270 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
271 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
272 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
273 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
274 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
275 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
276 2791355263 Rhizobium chutanense C5 Isolate Nodule
277 2791355267 Rhizobium sp. L18 Isolate Nodule
278 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
279 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
280 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
281 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
282 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
283 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
284 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
285 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
286 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
287 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
288 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
289 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
290 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
291 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
292 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
293 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
294 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
295 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
296 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
297 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
298 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
299 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
300 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
301 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
302 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
303 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
304 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
305 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
306 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
307 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
308 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
309 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
310 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
311 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
312 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
313 2936381700 Rhizobium chutanense C16 Isolate Unclassified
314 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
315 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
316 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
317 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
318 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
319 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
320 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
321 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
322 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
323 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
324 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
325 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
326 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
327 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
328 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
329 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.08
Metatranscriptomes 0
Isolates 22.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.12
Nodule 15.06
Rhizoplane 3.15
Rhizosphere 46.29
Stem 0
Stem Tuber 0
Unclassified 1.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10005014 3300003215 Bacteria 7017
2 JGI25156J39149_1000327 3300002705 Bacteria 31279
3 JGI25162J39368_1001983 3300002737 Bacteria 9167
4 JGI25158J39367_1000053 3300002739 Bacteria 26622
5 JGI25152J39213_1002422 3300002773 Bacteria 7105
6 JGI25152J39213_1014016 3300002773 Bacteria 1643
7 JGI25150J39212_1003266 3300002774 Bacteria 3825
8 JGI25159J45721_1001345 3300002987 Bacteria 10303
9 JGI25151J46595_10011803 3300003187 Bacteria 4003
10 JGI25165J46597_1001534 3300003214 Bacteria 11512
11 JGI25153J46596_10007447 3300003215 Bacteria 5386
12 JGI25153J46596_10022083 3300003215 Bacteria 2356
13 rootH1_10012775 3300003316 Bacteria 3030
14 rootH1_10012775 3300003323 Bacteria 1296
15 JGI25160J50197_1013838 3300003354 Bacteria 2730
16 JGI25160J50197_1026574 3300003354 Bacteria 1593
17 JGI25161J50226_1000134 3300003374 Bacteria 51546
18 JGI25161J50226_1000140 3300003374 Bacteria 50175
19 JGI25161J50226_1000242 3300003374 Bacteria 32920
20 Ga0055539_1006202 3300003752 Bacteria 1532
21 Ga0055526_1000783 3300003771 Bacteria 23705
22 Ga0055524_1039483 3300003775 Bacteria 1218
23 Ga0055524_1050709 3300003775 Bacteria 943
24 Ga0055524_1050715 3300003775 Bacteria 943
25 Ga0055528_1016866 3300003790 Bacteria 2558
26 Ga0055540_1000192 3300003792 Bacteria 58828
27 Ga0055540_1002652 3300003792 Bacteria 9251
28 Ga0055540_1017888 3300003792 Bacteria 1961
29 Ga0055543_1000128 3300004625 Bacteria 63029
30 Ga0065165_1015392 3300005262 Bacteria 2918
31 Ga0070676_10459059 3300005328 Bacteria 897
32 Ga0070683_100111013 3300005329 Bacteria 2587
33 Ga0070683_100312766 3300005329 Bacteria 1495
34 Ga0070670_100629697 3300005331 Bacteria 961
35 Ga0070666_10004913 3300005335 Bacteria 8172
36 Ga0070689_100001813 3300005340 Bacteria 13734
37 Ga0070689_100024599 3300005340 Bacteria 4519
38 Ga0070668_100476896 3300005347 Bacteria 1077
39 Ga0070669_100402960 3300005353 Bacteria 1120
40 Ga0070669_100465988 3300005353 Bacteria 1043
41 Ga0070675_100158190 3300005354 Bacteria 1947
42 Ga0070688_100212225 3300005365 Bacteria 1360
43 Ga0070701_10088804 3300005438 Bacteria 1689
44 Ga0070678_100059507 3300005456 Bacteria 2808
45 Ga0070706_100054996 3300005467 Bacteria 3674
46 Ga0070699_100103652 3300005518 Bacteria 2495
47 Ga0070697_100029183 3300005536 Bacteria 4421
48 Ga0068853_100298705 3300005539 Bacteria 1488
49 Ga0070672_100268812 3300005543 Bacteria 1439
50 Ga0070665_100207300 3300005548 Bacteria 1961
51 Ga0070665_100215436 3300005548 Bacteria 1921
52 Ga0070665_100592539 3300005548 Bacteria 1121
53 Ga0068855_100328273 3300005563 Bacteria 1689
54 Ga0068855_101395170 3300005563 Bacteria 722
55 Ga0070664_100008459 3300005564 Bacteria 8321
56 Ga0068854_100192631 3300005578 Bacteria 1598
57 Ga0068856_100007129 3300005614 Bacteria 10906
58 Ga0068852_100079848 3300005616 Bacteria 2899
59 Ga0068852_100793763 3300005616 Bacteria 961
60 Ga0068859_100033646 3300005617 Bacteria 5148
61 Ga0068859_100247954 3300005617 Bacteria 1871
62 Ga0068870_10374300 3300005840 Bacteria 920
63 Ga0068860_100026634 3300005843 Bacteria 5573
64 Ga0075365_10000344 3300006038 Bacteria 16625
65 Ga0075369_10034711 3300006186 Bacteria 2142
66 Ga0075369_10125972 3300006186 Bacteria 1162
67 Ga0075370_10005738 3300006353 Bacteria 6201
68 Ga0075430_100062534 3300006846 Bacteria 3127
69 Ga0068865_100137972 3300006881 Bacteria 1835
70 Ga0097620_100033645 3300006931 Bacteria 5148
71 Ga0097620_100247981 3300006931 Bacteria 1871
72 Ga0105244_10196320 3300009036 Bacteria 953
73 Ga0105240_10000012 3300009093 Bacteria 496639
74 Ga0105248_10045785 3300009177 Bacteria 4905
75 Ga0105248_10747881 3300009177 Bacteria 1103
76 Ga0105237_10015105 3300009545 Bacteria 8048
77 Ga0105249_10453099 3300009553 Bacteria 1322
78 Ga0123342_1017765 3300009766 Bacteria 5841
79 Ga0105035_100515 3300009988 Bacteria 2393
80 Ga0105239_10026862 3300010375 Bacteria 6336
81 Ga0157370_10005220 3300013104 Bacteria 14636
82 Ga0157369_10302823 3300013105 Bacteria 1663
83 Ga0163162_10008449 3300013306 Bacteria 10044
84 Ga0157375_10024322 3300013308 Bacteria 5604
85 Ga0182008_10127772 3300014497 Bacteria 1266
86 Ga0182005_1003664 3300015265 Bacteria 5151
87 Ga0213872_10023754 3300021361 Bacteria 2820
88 Ga0213871_10000746 3300021441 Bacteria 4804
89 Ga0209436_100029 3300025208 Bacteria 85964
90 Ga0209437_100040 3300025233 Bacteria 448096
91 Ga0207425_1006905 3300025245 Bacteria 3061
92 Ga0207425_1027648 3300025245 Bacteria 1156
93 Ga0209677_100584 3300025253 Bacteria 19941
94 Ga0209759_1000052 3300025256 Bacteria 213964
95 Ga0209129_1007012 3300025258 Bacteria 3466
96 Ga0209129_1012364 3300025258 Bacteria 1965
97 Ga0209129_1023916 3300025258 Bacteria 1082
98 Ga0209233_1000051 3300025261 Bacteria 447617
99 Ga0209233_1000146 3300025261 Bacteria 187269
100 Ga0209673_1004436 3300025273 Bacteria 7521
101 Ga0209673_1068876 3300025273 Bacteria 851
102 Ga0209130_1000472 3300025284 Bacteria 41433
103 Ga0209025_1020677 3300025294 Bacteria 3584
104 Ga0209564_1001299 3300025295 Bacteria 26951
105 Ga0209758_1001861 3300025297 Bacteria 23130
106 Ga0209758_1007792 3300025297 Bacteria 7156
107 Ga0209758_1018477 3300025297 Bacteria 3413
108 Ga0209758_1034730 3300025297 Bacteria 2000
109 Ga0209050_1006618 3300025298 Bacteria 6799
110 Ga0209256_1002853 3300025299 Bacteria 13162
111 Ga0209256_1019085 3300025299 Bacteria 2197
112 Ga0209256_1051338 3300025299 Bacteria 995
113 Ga0207426_1000008 3300025302 Bacteria 848730
114 Ga0207426_1002717 3300025302 Bacteria 10772
115 Ga0207426_1035899 3300025302 Bacteria 1579
116 Ga0207426_1048298 3300025302 Bacteria 1279
117 Ga0209051_1000253 3300025303 Bacteria 90622
118 Ga0209051_1002465 3300025303 Bacteria 13237
119 Ga0209051_1008262 3300025303 Bacteria 5538
120 Ga0209051_1032905 3300025303 Bacteria 1970
121 Ga0209257_1002797 3300025304 Bacteria 16431
122 Ga0209257_1040539 3300025304 Bacteria 1388
123 Ga0207680_10052392 3300025903 Bacteria 2445
124 Ga0207645_10382229 3300025907 Bacteria 945
125 Ga0207684_10087722 3300025910 Bacteria 2651
126 Ga0207695_10000120 3300025913 Bacteria 234247
127 Ga0207695_10089008 3300025913 Bacteria 3105
128 Ga0207671_10000023 3300025914 Bacteria 274756
129 Ga0207681_10252128 3300025923 Bacteria 1378
130 Ga0207659_10124816 3300025926 Bacteria 1978
131 Ga0207659_10653666 3300025926 Bacteria 899
132 Ga0207644_10512033 3300025931 Bacteria 991
133 Ga0207670_10058943 3300025936 Bacteria 2610
134 Ga0207661_10176491 3300025944 Bacteria 1863
135 Ga0207667_10245682 3300025949 Bacteria 1831
136 Ga0207667_10683358 3300025949 Bacteria 1030
137 Ga0207667_10909308 3300025949 Bacteria 871
138 Ga0207640_10167403 3300025981 Bacteria 1634
139 Ga0207640_10298979 3300025981 Bacteria 1272
140 Ga0207703_10255012 3300026035 Bacteria 1583
141 Ga0207639_10135963 3300026041 Bacteria 2041
142 Ga0207639_10480905 3300026041 Bacteria 1132
143 Ga0207702_10013214 3300026078 Bacteria 6866
144 Ga0207702_10345351 3300026078 Bacteria 1423
145 Ga0207683_10152572 3300026121 Bacteria 2085
146 Ga0207698_10188714 3300026142 Bacteria 1834
147 Ga0268266_10019290 3300028379 Bacteria 5808
148 Ga0268266_10188702 3300028379 Bacteria 1881
149 Ga0268265_10140130 3300028380 Bacteria 2024
150 Ga0265326_10024651 3300028558 Bacteria 1717
151 Ga0265334_10027775 3300028573 Bacteria 2277
152 Ga0265338_10009406 3300028800 Bacteria 11659
153 Ga0265338_10178720 3300028800 Bacteria 1620
154 Ga0265338_10214084 3300028800 Bacteria 1444
155 Ga0265327_10032816 3300031251 Bacteria 2903
156 Ga0307408_100287581 3300031548 Bacteria 1371
157 Ga0265314_10232125 3300031711 Bacteria 1070
158 Ga0307405_10361330 3300031731 Bacteria 1123
159 Ga0307413_10387201 3300031824 Bacteria 1091
160 Ga0307410_10699024 3300031852 Bacteria 854
161 Ga0307406_10188113 3300031901 Bacteria 1509
162 Ga0307407_10125146 3300031903 Bacteria 1636
163 Ga0307412_10031188 3300031911 Bacteria 3364
164 Ga0307414_10049894 3300032004 Bacteria 2896
165 Ga0307411_10289749 3300032005 Bacteria 1307
166 Ga0373961_0068040 3300035241 Bacteria 1096
167 Ga0373947_0528587 3300035725 Bacteria 802
168 Ga0373925_0252081 3300037068 Bacteria 1416
169 Ga0395900_0446768 3300037418 Bacteria 1250
170 Ga0395905_0167090 3300037471 Bacteria 2067
171 Ga0436360_0783284 3300039438 Bacteria 10314
172 Ga0436361_1148557 3300039447 Bacteria 4707
173 Ga0436363_1412148 3300039450 Bacteria 1007
174 Ga0439465_0006296 3300041413 Bacteria 3768
175 Ga0451798_0304899 3300041458 Bacteria 2042
176 Ga0451804_0486008 3300041463 Bacteria 1379
177 Ga0451833_0271586 3300041491 Bacteria 2619
178 Ga0451835_0111837 3300041492 Bacteria 1984
179 Ga0451837_0458588 3300041494 Bacteria 3072
180 Ga0451837_1600647 3300041494 Bacteria 1162
181 Ga0451839_0421304 3300041496 Bacteria 3147
182 Ga0451849_1139822 3300041505 Bacteria 1819
183 Ga0451851_1181860 3300041507 Bacteria 2068
184 Ga0451843_1150161 3300041509 Bacteria 908
185 Ga0451853_0613702 3300041512 Bacteria 2465
186 Ga0451853_1137069 3300041512 Bacteria 1106
187 Ga0451853_2292606 3300041512 Bacteria 1144
188 Ga0466967_0130275 3300045976 Bacteria 2334
189 Ga0495638_0006005 3300046460 Bacteria 8898
190 Ga0495605_0005848 3300046474 Bacteria 7114
191 Ga0495584_0061551 3300046491 Bacteria 1887
192 Ga0495585_0030197 3300046492 Bacteria 3083
193 Ga0495585_0047837 3300046492 Bacteria 2380
194 Ga0495585_0227434 3300046492 Bacteria 939
195 Ga0495596_0049400 3300046500 Bacteria 1649
196 Ga0495607_0000101 3300046501 Bacteria 91495
197 Ga0495607_0005399 3300046501 Bacteria 9155
198 Ga0495607_0096076 3300046501 Bacteria 1596
199 Ga0495583_0000010 3300046506 Bacteria 353523
200 Ga0495583_0022147 3300046506 Bacteria 3250
201 Ga0495606_0014267 3300046507 Bacteria 6213
202 Ga0495610_0015238 3300046512 Bacteria 4475
203 Ga0495610_0024255 3300046512 Bacteria 3277
204 Ga0495610_0068786 3300046512 Bacteria 1658
205 Ga0495610_0111899 3300046512 Bacteria 1208
206 Ga0495616_0225992 3300046513 Unclassified 813
207 Ga0495620_0003970 3300046515 Bacteria 8410
208 Ga0495620_0019710 3300046515 Bacteria 3311
209 Ga0495631_0026771 3300046518 Bacteria 2644
210 Ga0495631_0132347 3300046518 Bacteria 1071
211 Ga0495631_0146997 3300046518 Bacteria 1011
212 Ga0495632_0011198 3300046519 Bacteria 5251
213 Ga0495632_0024191 3300046519 Bacteria 3231
214 Ga0495632_0042081 3300046519 Bacteria 2292
215 Ga0495643_0001887 3300046522 Bacteria 17753
216 Ga0495643_0011261 3300046522 Bacteria 5459
217 Ga0495643_0061074 3300046522 Bacteria 1999
218 Ga0495643_0067054 3300046522 Bacteria 1892
219 Ga0495648_0031675 3300046524 Bacteria 3480
220 Ga0495654_0055426 3300046530 Bacteria 1919
221 Ga0495609_0031220 3300046538 Bacteria 2423
222 Ga0495609_0123856 3300046538 Bacteria 1110
223 Ga0495597_0004692 3300046542 Bacteria 7415
224 Ga0495668_0010534 3300046616 Bacteria 5589
225 Ga0495668_0017449 3300046616 Bacteria 4163
226 Ga0495668_0083069 3300046616 Unclassified 1757
227 Ga0495611_0004484 3300046648 Bacteria 6043
228 Ga0495625_0000508 3300046660 Bacteria 57754
229 Ga0495625_0009325 3300046660 Bacteria 8225
230 Ga0495625_0012026 3300046660 Bacteria 7025
231 Ga0495625_0015606 3300046660 Bacteria 6009
232 Ga0495625_0024002 3300046660 Bacteria 4649
233 Ga0495661_0083430 3300046665 Bacteria 1837
234 Ga0495671_0072333 3300046692 Bacteria 1693
235 Ga0495649_0235360 3300046694 Bacteria 944
236 Ga0495589_0023547 3300046794 Bacteria 3137
237 Ga0495660_0010064 3300046810 Bacteria 5501
238 Ga0495636_0119690 3300047318 Bacteria 1164
239 Ga0495683_0036013 3300047323 Bacteria 2514
240 Ga0495687_004989 3300047443 Bacteria 8677
241 Ga0495687_013525 3300047443 Bacteria 4253
242 Ga0495687_161502 3300047443 Bacteria 753
243 Ga0495679_045042 3300047446 Bacteria 1349
244 Ga0495673_0177525 3300047469 Bacteria 808
245 Ga0495681_0017580 3300047470 Bacteria 3965
246 Ga0495686_0000278 3300047472 Bacteria 90520
247 Ga0495686_0001455 3300047472 Bacteria 25795
248 Ga0495686_0003836 3300047472 Bacteria 12735
249 Ga0495686_0017875 3300047472 Bacteria 4768
250 Ga0495686_0021566 3300047472 Bacteria 4274
251 Ga0495686_0046485 3300047472 Bacteria 2743
252 Ga0495686_0139148 3300047472 Bacteria 1433
253 Ga0495615_0000780 3300048090 Bacteria 4465
254 Ga0495626_0019461 3300048091 Bacteria 3397
255 Ga0496101_0009259 3300048904 Bacteria 6466
256 Ga0496101_0335887 3300048904 Bacteria 1186
257 Ga0496102_0006671 3300048905 Bacteria 9865
258 Ga0496103_0006841 3300048906 Bacteria 6807
259 Ga0496106_0001359 3300048909 Bacteria 18315
260 Ga0496106_0115570 3300048909 Bacteria 2093
261 Ga0496106_0428985 3300048909 Bacteria 1062
262 Ga0496107_0012662 3300048910 Bacteria 5891
263 Ga0496109_0279923 3300048912 Bacteria 1572
264 Ga0496113_0048489 3300048916 Bacteria 3160
265 Ga0496114_0628909 3300048917 Unclassified 945
266 Ga0496115_0082204 3300048918 Bacteria 2624
267 Ga0496116_0007077 3300048919 Bacteria 10044
268 Ga0496116_0014411 3300048919 Bacteria 6315
269 Ga0496116_0035375 3300048919 Bacteria 3509
270 Ga0496117_0001348 3300048920 Bacteria 36026
271 Ga0496117_0038374 3300048920 Bacteria 3552
272 Ga0496117_0127946 3300048920 Bacteria 1546
273 Ga0496117_0188801 3300048920 Bacteria 1176
274 Ga0496117_0400415 3300048920 Unclassified 693
275 Ga0496118_0006857 3300048921 Bacteria 12345
276 Ga0496118_0030476 3300048921 Bacteria 4501
277 Ga0496119_0018741 3300048922 Bacteria 5133
278 Ga0496119_0214925 3300048922 Bacteria 987
279 Ga0496120_0002158 3300048923 Bacteria 20963
280 Ga0496121_0000466 3300048924 Bacteria 78934
281 Ga0496121_0006947 3300048924 Bacteria 13794
282 Ga0496121_0023875 3300048924 Bacteria 5868
283 Ga0496121_0380263 3300048924 Bacteria 931
284 Ga0496122_0010148 3300048925 Bacteria 9759
285 Ga0496122_0017511 3300048925 Bacteria 6694
286 Ga0496122_0026555 3300048925 Bacteria 4986
287 Ga0496122_0047623 3300048925 Bacteria 3307
288 Ga0496122_0087582 3300048925 Bacteria 2138
289 Ga0496123_0000335 3300048926 Bacteria 89251
290 Ga0496123_0006910 3300048926 Bacteria 10855
291 Ga0496123_0032152 3300048926 Bacteria 3805
292 Ga0496123_0108401 3300048926 Bacteria 1594
293 Ga0496124_0001939 3300048927 Bacteria 28328
294 Ga0496124_0029659 3300048927 Bacteria 4868
295 Ga0496124_0086849 3300048927 Bacteria 2559
296 Ga0496124_0309184 3300048927 Bacteria 1137
297 Ga0496125_0026928 3300048928 Bacteria 5222
298 Ga0496125_0067618 3300048928 Bacteria 2814
299 Ga0496125_0276849 3300048928 Bacteria 1042
300 Ga0496125_0330669 3300048928 Bacteria 919
301 Ga0496125_0463543 3300048928 Bacteria 722
302 Ga0496126_0170327 3300048929 Bacteria 1855
303 Ga0495678_002473 3300049459 Bacteria 12461
304 Ga0495678_025779 3300049459 Bacteria 2520
305 Ga0495682_0107377 3300049460 Bacteria 1000
306 Ga0495682_0200465 3300049460 Bacteria 708
307 Ga0501032_0119832 3300049569 Bacteria 1740
308 Ga0501034_0029409 3300049571 Bacteria 5583
309 Ga0501038_0252661 3300049574 Bacteria 1396
310 Ga0501046_0048937 3300049580 Bacteria 3346
311 Ga0501047_0183390 3300049581 Bacteria 1959
312 Ga0501073_0072365 3300049589 Bacteria 2401
313 nmdc:mga03n38_161160_c1 3300050490 Bacteria 1136
314 nmdc:mga0yw44_328409_c1 3300050492 Bacteria 1028
315 nmdc:mga07m45_197191_c1 3300050496 Bacteria 1171
316 nmdc:mga0qj67_41623_c1 3300050509 Bacteria 3614
317 nmdc:mga0sz30_34764_c2 3300050516 Bacteria 1082
318 Ga0500610_0151999 3300053079 Bacteria 1159
319 Ga0500578_0081123 3300053086 Bacteria 2062
320 Ga0500643_047859 3300053087 Bacteria 1231
321 Ga0500651_0159431 3300053093 Bacteria 1350
322 Ga0500650_0242307 3300053098 Bacteria 811
323 Ga0500555_000684 3300053103 Bacteria 12890
324 Ga0500556_0000013 3300053104 Bacteria 243797
325 Ga0500557_130982 3300053105 Bacteria 830
326 Ga0500569_058538 3300053109 Bacteria 1183
327 Ga0500594_0001139 3300053118 Bacteria 5715
328 Ga0500617_068275 3300053124 Bacteria 1562
329 Ga0500618_001900 3300053125 Bacteria 8628
330 Ga0500618_016727 3300053125 Bacteria 1831
331 Ga0500642_0000002 3300053130 Bacteria 795093
332 Ga0500658_0016492 3300053134 Bacteria 2752
333 Ga0500658_0031787 3300053134 Bacteria 2066
334 Ga0500568_0003524 3300053139 Bacteria 8676
335 Ga0500588_0118484 3300053146 Bacteria 931
336 Ga0500604_0016238 3300053151 Bacteria 2048
337 Ga0500616_0003848 3300053153 Bacteria 11090
338 Ga0500616_0131809 3300053153 Bacteria 1180
339 Ga0500622_0000614 3300053156 Bacteria 32273
340 Ga0500622_0175307 3300053156 Unclassified 995
341 Ga0500633_0002647 3300053160 Bacteria 3733
342 Ga0500636_0080998 3300053177 Bacteria 1870
343 Ga0500645_002578 3300053730 Bacteria 7968
344 Ga0501082_0632388 3300060353 Bacteria 936
345 2509392427 2509276021 Bacteria 7634384
346 2510894955 2510461076 Bacteria 8618824
347 2511135570 2510917022 Bacteria 6504556
348 2511187218 2510917028 Bacteria 6185411
349 2511196111 2510917030 Bacteria 7460662
350 2513577525 2513237085 Bacteria 7695351
351 2513629826 2513237093 Bacteria 7545552
352 2513708460 2513237103 Bacteria 7647401
353 2513867608 2513237138 Bacteria 7368160
354 2515112556 2515075009 Bacteria 7288508
355 2515632892 2515154113 Bacteria 7807172
356 2515640036 2515154114 Bacteria 7848616
357 2515655766 2515154116 Bacteria 7552979
358 2515740218 2515154134 Bacteria 7220242
359 2517036280 2516653077 Bacteria 7555578
360 2517076641 2516653085 Bacteria 7346596
361 2517095416 2517093000 Bacteria 7412387
362 2517407013 2517287029 Bacteria 6905599
363 2585204846 2582581294 Bacteria 6626667
364 2585222704 2582581298 Bacteria 7315509
365 2585272645 2582581307 Bacteria 6597605
366 2585278364 2582581308 Bacteria 7413247
367 2585324794 2582581315 Bacteria 7318924
368 2585332225 2582581316 Bacteria 7774528
369 2585403411 2582581867 Bacteria 7184437
370 2585527034 2585427526 Bacteria 7258840
371 2585531980 2585427527 Bacteria 7273426
372 2585537791 2585427528 Bacteria 6842387
373 2585545287 2585427529 Bacteria 7395659
374 2585552340 2585427530 Bacteria 7383882
375 2585562313 2585427531 Bacteria 6992870
376 2585823707 2585427590 Bacteria 6824633
377 2585835741 2585427593 Bacteria 7141551
378 2585896757 2585427608 Bacteria 6544331
379 2585906520 2585427609 Bacteria 6667127
380 2587981942 2585428125 Bacteria 6662905
381 2616307882 2615840626 Bacteria 7921970
382 2616552458 2615840698 Bacteria 7319877
383 2617381803 2617270742 Bacteria 6808054
384 2720492222 2718218199 Bacteria 6740745
385 2720620363 2718218233 Bacteria 6662049
386 2723027133 2721755556 Bacteria 6745503
387 2723560745 2721755684 Bacteria 6859907
388 2724110410 2721755823 Bacteria 6752556
389 2725950518 2724679232 Bacteria 7646494
390 2730108069 2728369352 Bacteria 6745171
391 2738948025 2738541317 Bacteria 5340176
392 2766066882 2765235942 Bacteria 7445910
393 2793341727 2791355263 Bacteria 6872478
394 2793366947 2791355267 Bacteria 7222458
395 2819640225 2818991453 Bacteria 7181617
396 2838018008 2838016132 Bacteria 6577831
397 2838043645 2838042994 Bacteria 6046894
398 2838692028 2838686498 Bacteria 7807632
399 2838732826 2838729681 Bacteria 7400765
400 2838745704 2838742623 Bacteria 7396178
401 2841855838 2841851746 Bacteria 7532261
402 2841864329 2841864319 Bacteria 6742987
403 2842114151 2842110456 Bacteria 7656360
404 2842157170 2842156927 Bacteria 6894975
405 2842167831 2842163707 Bacteria 6916235
406 2842181246 2842180545 Bacteria 6888678
407 2842217511 2842217011 Bacteria 7497767
408 2842230703 2842229732 Bacteria 7475766
409 2842245197 2842243621 Bacteria 7421798
410 2842259010 2842257432 Bacteria 7401195
411 2842265843 2842264693 Bacteria 6472963
412 2842276320 2842271015 Bacteria 7807131
413 2842304537 2842304105 Bacteria 7023636
414 2842345335 2842341865 Bacteria 7003929
415 2842364784 2842363717 Bacteria 6844742
416 2842429520 2842428310 Bacteria 6767288
417 2842436133 2842434925 Bacteria 6502746
418 2842442480 2842441272 Bacteria 6769273
419 2842463941 2842462802 Bacteria 6588055
420 2842470462 2842469257 Bacteria 6752936
421 2842484041 2842482326 Bacteria 7212537
422 2844458917 2844454524 Bacteria 7952546
423 2891634964 2891633521 Bacteria 4602265
424 2900641734 2900634093 Bacteria 10263517
425 2913312764 2913308742 Bacteria 5350706
426 2919106589 2919100787 Bacteria 7710546
427 2933571810 2933570622 Bacteria 7023390
428 2933590247 2933586486 Bacteria 7667493
429 2935905441 2935901341 Bacteria 7341747
430 2936388417 2936381700 Bacteria 7006523
431 3005448317 3005445848 Bacteria 6906074
432 642615778 642555113 Bacteria 8214658
433 8005312409 8005307578 Bacteria 7395396
434 8005431710 8005430974 Bacteria 6689030
435 8005463229 8005460587 Bacteria 7157962
436 8005547311 8005542996 Bacteria 7077758
437 8005557447 8005556819 Bacteria 6908598
438 8005568626 8005563573 Bacteria 7153261
439 8005621913 8005619151 Bacteria 7030230
440 8005627155 8005626139 Bacteria 6534237
441 8005671954 8005668836 Bacteria 6953162
442 8005684083 8005682033 Bacteria 6726518
443 8018166537 8018163183 Bacteria 7277977
444 8023685139 8023680758 Bacteria 7729763
445 8056376833 8056375014 Bacteria 7006639
446 8057874788 8057874678 Bacteria 7494653
447 JGI25153J46596_10005014
448 JGI25156J39149_1000327
449 JGI25162J39368_1001983
450 JGI25158J39367_1000053
451 JGI25152J39213_1002422
452 JGI25152J39213_1014016
453 JGI25150J39212_1003266
454 JGI25159J45721_1001345
455 JGI25151J46595_10011803
456 JGI25165J46597_1001534
457 JGI25153J46596_10007447
458 JGI25153J46596_10022083
459 rootH1_10012775
460 JGI25160J50197_1013838
461 JGI25160J50197_1026574
462 JGI25161J50226_1000134
463 JGI25161J50226_1000140
464 JGI25161J50226_1000242
465 Ga0055539_1006202
466 Ga0055526_1000783
467 Ga0055524_1039483
468 Ga0055524_1050709
469 Ga0055524_1050715
470 Ga0055528_1016866
471 Ga0055540_1000192
472 Ga0055540_1002652
473 Ga0055540_1017888
474 Ga0055543_1000128
475 Ga0065165_1015392
476 Ga0070676_10459059
477 Ga0070683_100111013
478 Ga0070683_100312766
479 Ga0070670_100629697
480 Ga0070666_10004913
481 Ga0070689_100001813
482 Ga0070689_100024599
483 Ga0070668_100476896
484 Ga0070669_100402960
485 Ga0070669_100465988
486 Ga0070675_100158190
487 Ga0070688_100212225
488 Ga0070701_10088804
489 Ga0070678_100059507
490 Ga0070706_100054996
491 Ga0070699_100103652
492 Ga0070697_100029183
493 Ga0068853_100298705
494 Ga0070672_100268812
495 Ga0070665_100207300
496 Ga0070665_100215436
497 Ga0070665_100592539
498 Ga0068855_100328273
499 Ga0068855_101395170
500 Ga0070664_100008459
501 Ga0068854_100192631
502 Ga0068856_100007129
503 Ga0068852_100079848
504 Ga0068852_100793763
505 Ga0068859_100033646
506 Ga0068859_100247954
507 Ga0068870_10374300
508 Ga0068860_100026634
509 Ga0075365_10000344
510 Ga0075369_10034711
511 Ga0075369_10125972
512 Ga0075370_10005738
513 Ga0075430_100062534
514 Ga0068865_100137972
515 Ga0097620_100033645
516 Ga0097620_100247981
517 Ga0105244_10196320
518 Ga0105240_10000012
519 Ga0105248_10045785
520 Ga0105248_10747881
521 Ga0105237_10015105
522 Ga0105249_10453099
523 Ga0123342_1017765
524 Ga0105035_100515
525 Ga0105239_10026862
526 Ga0157370_10005220
527 Ga0157369_10302823
528 Ga0163162_10008449
529 Ga0157375_10024322
530 Ga0182008_10127772
531 Ga0182005_1003664
532 Ga0213872_10023754
533 Ga0213871_10000746
534 Ga0209436_100029
535 Ga0209437_100040
536 Ga0207425_1006905
537 Ga0207425_1027648
538 Ga0209677_100584
539 Ga0209759_1000052
540 Ga0209129_1007012
541 Ga0209129_1012364
542 Ga0209129_1023916
543 Ga0209233_1000051
544 Ga0209233_1000146
545 Ga0209673_1004436
546 Ga0209673_1068876
547 Ga0209130_1000472
548 Ga0209025_1020677
549 Ga0209564_1001299
550 Ga0209758_1001861
551 Ga0209758_1007792
552 Ga0209758_1018477
553 Ga0209758_1034730
554 Ga0209050_1006618
555 Ga0209256_1002853
556 Ga0209256_1019085
557 Ga0209256_1051338
558 Ga0207426_1000008
559 Ga0207426_1002717
560 Ga0207426_1035899
561 Ga0207426_1048298
562 Ga0209051_1000253
563 Ga0209051_1002465
564 Ga0209051_1008262
565 Ga0209051_1032905
566 Ga0209257_1002797
567 Ga0209257_1040539
568 Ga0207680_10052392
569 Ga0207645_10382229
570 Ga0207684_10087722
571 Ga0207695_10000120
572 Ga0207695_10089008
573 Ga0207671_10000023
574 Ga0207681_10252128
575 Ga0207659_10124816
576 Ga0207659_10653666
577 Ga0207644_10512033
578 Ga0207670_10058943
579 Ga0207661_10176491
580 Ga0207667_10245682
581 Ga0207667_10683358
582 Ga0207667_10909308
583 Ga0207640_10167403
584 Ga0207640_10298979
585 Ga0207703_10255012
586 Ga0207639_10135963
587 Ga0207639_10480905
588 Ga0207702_10013214
589 Ga0207702_10345351
590 Ga0207683_10152572
591 Ga0207698_10188714
592 Ga0268266_10019290
593 Ga0268266_10188702
594 Ga0268265_10140130
595 Ga0265326_10024651
596 Ga0265334_10027775
597 Ga0265338_10009406
598 Ga0265338_10178720
599 Ga0265338_10214084
600 Ga0265327_10032816
601 Ga0307408_100287581
602 Ga0265314_10232125
603 Ga0307405_10361330
604 Ga0307413_10387201
605 Ga0307410_10699024
606 Ga0307406_10188113
607 Ga0307407_10125146
608 Ga0307412_10031188
609 Ga0307414_10049894
610 Ga0307411_10289749
611 Ga0373961_0068040
612 Ga0373947_0528587
613 Ga0373925_0252081
614 Ga0395900_0446768
615 Ga0395905_0167090
616 Ga0436360_0783284
617 Ga0436361_1148557
618 Ga0436363_1412148
619 Ga0439465_0006296
620 Ga0451798_0304899
621 Ga0451804_0486008
622 Ga0451833_0271586
623 Ga0451835_0111837
624 Ga0451837_0458588
625 Ga0451837_1600647
626 Ga0451839_0421304
627 Ga0451849_1139822
628 Ga0451851_1181860
629 Ga0451843_1150161
630 Ga0451853_0613702
631 Ga0451853_1137069
632 Ga0451853_2292606
633 Ga0466967_0130275
634 Ga0495638_0006005
635 Ga0495605_0005848
636 Ga0495584_0061551
637 Ga0495585_0030197
638 Ga0495585_0047837
639 Ga0495585_0227434
640 Ga0495596_0049400
641 Ga0495607_0000101
642 Ga0495607_0005399
643 Ga0495607_0096076
644 Ga0495583_0000010
645 Ga0495583_0022147
646 Ga0495606_0014267
647 Ga0495610_0015238
648 Ga0495610_0024255
649 Ga0495610_0068786
650 Ga0495610_0111899
651 Ga0495616_0225992
652 Ga0495620_0003970
653 Ga0495620_0019710
654 Ga0495631_0026771
655 Ga0495631_0132347
656 Ga0495631_0146997
657 Ga0495632_0011198
658 Ga0495632_0024191
659 Ga0495632_0042081
660 Ga0495643_0001887
661 Ga0495643_0011261
662 Ga0495643_0061074
663 Ga0495643_0067054
664 Ga0495648_0031675
665 Ga0495654_0055426
666 Ga0495609_0031220
667 Ga0495609_0123856
668 Ga0495597_0004692
669 Ga0495668_0010534
670 Ga0495668_0017449
671 Ga0495668_0083069
672 Ga0495611_0004484
673 Ga0495625_0000508
674 Ga0495625_0009325
675 Ga0495625_0012026
676 Ga0495625_0015606
677 Ga0495625_0024002
678 Ga0495661_0083430
679 Ga0495671_0072333
680 Ga0495649_0235360
681 Ga0495589_0023547
682 Ga0495660_0010064
683 Ga0495636_0119690
684 Ga0495683_0036013
685 Ga0495687_004989
686 Ga0495687_013525
687 Ga0495687_161502
688 Ga0495679_045042
689 Ga0495673_0177525
690 Ga0495681_0017580
691 Ga0495686_0000278
692 Ga0495686_0001455
693 Ga0495686_0003836
694 Ga0495686_0017875
695 Ga0495686_0021566
696 Ga0495686_0046485
697 Ga0495686_0139148
698 Ga0495615_0000780
699 Ga0495626_0019461
700 Ga0496101_0009259
701 Ga0496101_0335887
702 Ga0496102_0006671
703 Ga0496103_0006841
704 Ga0496106_0001359
705 Ga0496106_0115570
706 Ga0496106_0428985
707 Ga0496107_0012662
708 Ga0496109_0279923
709 Ga0496113_0048489
710 Ga0496114_0628909
711 Ga0496115_0082204
712 Ga0496116_0007077
713 Ga0496116_0014411
714 Ga0496116_0035375
715 Ga0496117_0001348
716 Ga0496117_0038374
717 Ga0496117_0127946
718 Ga0496117_0188801
719 Ga0496117_0400415
720 Ga0496118_0006857
721 Ga0496118_0030476
722 Ga0496119_0018741
723 Ga0496119_0214925
724 Ga0496120_0002158
725 Ga0496121_0000466
726 Ga0496121_0006947
727 Ga0496121_0023875
728 Ga0496121_0380263
729 Ga0496122_0010148
730 Ga0496122_0017511
731 Ga0496122_0026555
732 Ga0496122_0047623
733 Ga0496122_0087582
734 Ga0496123_0000335
735 Ga0496123_0006910
736 Ga0496123_0032152
737 Ga0496123_0108401
738 Ga0496124_0001939
739 Ga0496124_0029659
740 Ga0496124_0086849
741 Ga0496124_0309184
742 Ga0496125_0026928
743 Ga0496125_0067618
744 Ga0496125_0276849
745 Ga0496125_0330669
746 Ga0496125_0463543
747 Ga0496126_0170327
748 Ga0495678_002473
749 Ga0495678_025779
750 Ga0495682_0107377
751 Ga0495682_0200465
752 Ga0501032_0119832
753 Ga0501034_0029409
754 Ga0501038_0252661
755 Ga0501046_0048937
756 Ga0501047_0183390
757 Ga0501073_0072365
758 nmdc:mga03n38_161160_c1
759 nmdc:mga0yw44_328409_c1
760 nmdc:mga07m45_197191_c1
761 nmdc:mga0qj67_41623_c1
762 nmdc:mga0sz30_34764_c2
763 Ga0500610_0151999
764 Ga0500578_0081123
765 Ga0500643_047859
766 Ga0500651_0159431
767 Ga0500650_0242307
768 Ga0500555_000684
769 Ga0500556_0000013
770 Ga0500557_130982
771 Ga0500569_058538
772 Ga0500594_0001139
773 Ga0500617_068275
774 Ga0500618_001900
775 Ga0500618_016727
776 Ga0500642_0000002
777 Ga0500658_0016492
778 Ga0500658_0031787
779 Ga0500568_0003524
780 Ga0500588_0118484
781 Ga0500604_0016238
782 Ga0500616_0003848
783 Ga0500616_0131809
784 Ga0500622_0000614
785 Ga0500622_0175307
786 Ga0500633_0002647
787 Ga0500636_0080998
788 Ga0500645_002578
789 Ga0501082_0632388
790 2509392427
791 2510894955
792 2511135570
793 2511187218
794 2511196111
795 2513577525
796 2513629826
797 2513708460
798 2513867608
799 2515112556
800 2515632892
801 2515640036
802 2515655766
803 2515740218
804 2517036280
805 2517076641
806 2517095416
807 2517407013
808 2585204846
809 2585222704
810 2585272645
811 2585278364
812 2585324794
813 2585332225
814 2585403411
815 2585527034
816 2585531980
817 2585537791
818 2585545287
819 2585552340
820 2585562313
821 2585823707
822 2585835741
823 2585896757
824 2585906520
825 2587981942
826 2616307882
827 2616552458
828 2617381803
829 2720492222
830 2720620363
831 2723027133
832 2723560745
833 2724110410
834 2725950518
835 2730108069
836 2738948025
837 2766066882
838 2793341727
839 2793366947
840 2819640225
841 2838018008
842 2838043645
843 2838692028
844 2838732826
845 2838745704
846 2841855838
847 2841864329
848 2842114151
849 2842157170
850 2842167831
851 2842181246
852 2842217511
853 2842230703
854 2842245197
855 2842259010
856 2842265843
857 2842276320
858 2842304537
859 2842345335
860 2842364784
861 2842429520
862 2842436133
863 2842442480
864 2842463941
865 2842470462
866 2842484041
867 2844458917
868 2891634964
869 2900641734
870 2913312764
871 2919106589
872 2933571810
873 2933590247
874 2935905441
875 2936388417
876 3005448317
877 642615778
878 8005312409
879 8005431710
880 8005463229
881 8005547311
882 8005557447
883 8005568626
884 8005621913
885 8005627155
886 8005671954
887 8005684083
888 8018166537
889 8023685139
890 8056376833
891 8057874788

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13578

Methyltransf_24

Methyltransferase domain

106

208

0.94

PF01596

Methyltransf_3

O-methyltransferase

78

244

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c9v-assembly1.cif.gz_A-2 o-methyltransferase from desulfuromonas acetoxidans 0.9115 37 204
5zy6-assembly1.cif.gz_A catechol methyltransferase spcomt 0.898 48 203
4pca-assembly1.cif.gz_A x-ray crystal structure of an o-methyltransferase from anaplasma phagocytophilum bound to sah and manganese 0.8884 47 203
5zy6-assembly2.cif.gz_B catechol methyltransferase spcomt 0.8858 48 203
5fhr-assembly1.cif.gz_B crystal structure of y200l mutant of rat catechol-o-methyltransferase in complex with adomet and 3,5-dinitrocatechol 0.8776 47 185
ID Description Score Start End Superfamily
af_K7N0B7_9_135_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.904 41 156 3.40.50.150
af_A0A0R0IR39_2_192_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9001 45 202 3.40.50.150
af_Q9M266_77_290_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8874 47 204 3.40.50.150
af_F4IAT4_68_291_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8747 45 203 3.40.50.150
4pyjA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8721 46 185 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6P0Q6H9-F1-model_v4 deleted 0.9668 58 204
AF-A0A2H0L3A8-F1-model_v4 Methyltransferase 0.9501 46 202 GO:0008171
GO:0032259
AF-A0A842TSK0-F1-model_v4 Methyltransferase domain-containing protein 0.949 46 204 GO:0008171
GO:0032259
AF-A0A1F5AUH4-F1-model_v4 Methyltransferase 0.9475 46 204 GO:0008171
GO:0032259
AF-A0A369X2F7-F1-model_v4 deleted 0.9465 48 204

Map