F445423

General Info

Members Datasets Scaffolds Average Seq Length
445 222 890 507

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_100009578|Ga0070661_1000095786
Length 507
Sequence MTKRKVILVIMDGWGLGKVKSSDAIQNANVPFVSSLYSKYPNTTLTTCGEAVGLPEGQMGNSEVGHLNLGAGRVVYQELQRINVAVRDGEFAKNKTLLESINYAKQNNKPLHLLGLVSNGGVHSHINHLKAILDVCNQQRLQQVFIHAFTDGRDCDPKSGLGFIKELAEHAQKTVGKIATVSGRYVAMDRDNRWERVKLAYDAMVKGIGVHATSAIEAVEKSYGENVTDEFIKPTVIIENDKPVASIKDGDVAICFNFRTDRCREITKALTQMEFPQQDMHPLQLHYTTMTEYDATFKNVNIIFENDNLNNTLGEVIQQNSLKQIRIAETEKYPHVTFFFSGGREKPFEGESRILIPSPKVATYDLQPEMSAYEVTAAILPEIEKGEASFICLNYANADMVGHTGVWQAAVKAVETVDKCVEQVVTTALKNGYTVFLTADHGNADYLVNEDGTPNTAHTLNLVPFFIIDKEWKGKIKQGKLGDLAPTILKMMDLPIPPEMNGNILID

Samples

Sample ID Description Type Environment
1 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
87 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
88 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
89 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
143 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
144 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
145 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
146 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
155 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
158 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
159 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
163 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
168 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
174 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
175 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
192 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
193 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
194 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
198 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
202 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
203 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
204 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
205 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
206 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
207 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
208 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
209 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
210 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
211 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
212 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
213 2738541278 Niastella sp. CF465 Isolate Unclassified
214 2818991444 Filimonas endophytica 3197 Isolate Unclassified
215 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
216 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
217 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
218 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
219 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
220 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
221 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
222 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.75
Metatranscriptomes 0
Isolates 2.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.64
Nodule 0
Rhizoplane 0
Rhizosphere 86.07
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070661_100009578 3300005344 Bacteria 6710
2 JGI24739J22299_10006978 3300001989 Bacteria 4255
3 JGI24751J29686_10000360 3300002459 Bacteria 15823
4 JGI25153J46596_10004852 3300003215 Bacteria 7164
5 rootH1_10050342 3300003316 Bacteria 2981
6 rootH2_10025296 3300003320 Bacteria 24414
7 rootH2_10135667 3300003320 Bacteria 7351
8 rootH1_10045167 3300003323 Bacteria 3460
9 JGI25160J50197_1005331 3300003354 Bacteria 5372
10 JGI25160J50197_1007445 3300003354 Bacteria 4281
11 JGI25160J50197_1010103 3300003354 Bacteria 3440
12 Ga0055526_1014309 3300003771 Bacteria 3274
13 Ga0055528_1000648 3300003790 Bacteria 25373
14 Ga0055530_10003884 3300003791 Bacteria 8162
15 Ga0065165_1000042 3300005262 Bacteria 203874
16 Ga0065712_10001246 3300005290 Bacteria 8768
17 Ga0065712_10023681 3300005290 Bacteria 2538
18 Ga0065715_10004024 3300005293 Bacteria 4807
19 Ga0070658_10021161 3300005327 Bacteria 5210
20 Ga0070676_10006291 3300005328 Bacteria 6341
21 Ga0070683_100004596 3300005329 Bacteria 11396
22 Ga0070683_100149606 3300005329 Bacteria 2213
23 Ga0070670_100005255 3300005331 Bacteria 10908
24 Ga0070670_100068422 3300005331 Bacteria 3048
25 Ga0070670_100068851 3300005331 Bacteria 3038
26 Ga0070670_100091885 3300005331 Bacteria 2610
27 Ga0070670_100114077 3300005331 Bacteria 2330
28 Ga0070670_100128439 3300005331 Bacteria 2188
29 Ga0068869_100086205 3300005334 Bacteria 2353
30 Ga0070666_10000086 3300005335 Bacteria 66096
31 Ga0070666_10033625 3300005335 Bacteria 3393
32 Ga0068868_100097188 3300005338 Bacteria 2379
33 Ga0070689_100035973 3300005340 Bacteria 3786
34 Ga0070661_100000111 3300005344 Bacteria 68066
35 Ga0070661_100029829 3300005344 Bacteria 3938
36 Ga0070668_100009821 3300005347 Bacteria 7091
37 Ga0070669_100058880 3300005353 Bacteria 2820
38 Ga0070669_100160158 3300005353 Bacteria 1748
39 Ga0070675_100018336 3300005354 Bacteria 5570
40 Ga0070675_100029464 3300005354 Bacteria 4428
41 Ga0070674_100047455 3300005356 Bacteria 2943
42 Ga0070674_100062132 3300005356 Bacteria 2609
43 Ga0070674_100090920 3300005356 Bacteria 2203
44 Ga0070673_100030971 3300005364 Bacteria 4010
45 Ga0070673_100077968 3300005364 Bacteria 2679
46 Ga0070688_100055919 3300005365 Bacteria 2476
47 Ga0070659_100007898 3300005366 Bacteria 7749
48 Ga0070667_100009085 3300005367 Bacteria 8223
49 Ga0070667_100069096 3300005367 Bacteria 3006
50 Ga0070667_100134955 3300005367 Bacteria 2157
51 Ga0070678_100028680 3300005456 Bacteria 3800
52 Ga0070681_10084875 3300005458 Bacteria 3119
53 Ga0068867_100007969 3300005459 Bacteria 7483
54 Ga0068867_100011772 3300005459 Bacteria 6178
55 Ga0068867_100027792 3300005459 Bacteria 4069
56 Ga0070698_100001074 3300005471 Bacteria 30038
57 Ga0070679_100083370 3300005530 Bacteria 3185
58 Ga0070684_100008247 3300005535 Bacteria 8142
59 Ga0070684_100012077 3300005535 Bacteria 6906
60 Ga0070684_100012277 3300005535 Bacteria 6860
61 Ga0068853_100018696 3300005539 Bacteria 5738
62 Ga0068853_100037373 3300005539 Bacteria 4131
63 Ga0070672_100057200 3300005543 Bacteria 3061
64 Ga0070665_100000014 3300005548 Bacteria 484881
65 Ga0070665_100007232 3300005548 Bacteria 11278
66 Ga0068855_100021819 3300005563 Bacteria 7681
67 Ga0068855_100022619 3300005563 Bacteria 7531
68 Ga0070664_100000243 3300005564 Bacteria 39166
69 Ga0068857_100001483 3300005577 Bacteria 18682
70 Ga0068857_100002097 3300005577 Bacteria 16192
71 Ga0068857_100078885 3300005577 Bacteria 2939
72 Ga0068857_100080451 3300005577 Bacteria 2909
73 Ga0068856_100010109 3300005614 Bacteria 9171
74 Ga0068856_100019904 3300005614 Bacteria 6514
75 Ga0068856_100075018 3300005614 Bacteria 3350
76 Ga0068852_100002957 3300005616 Bacteria 11805
77 Ga0068852_100015068 3300005616 Bacteria 5980
78 Ga0068852_100055192 3300005616 Bacteria 3428
79 Ga0068852_100081869 3300005616 Bacteria 2867
80 Ga0068859_100000025 3300005617 Bacteria 191679
81 Ga0068859_100007026 3300005617 Bacteria 11428
82 Ga0068859_100024673 3300005617 Bacteria 6034
83 Ga0068859_100064288 3300005617 Bacteria 3701
84 Ga0068859_100117779 3300005617 Bacteria 2721
85 Ga0068859_100156454 3300005617 Bacteria 2357
86 Ga0068864_100006400 3300005618 Bacteria 9651
87 Ga0068864_100019781 3300005618 Bacteria 5629
88 Ga0068864_100022205 3300005618 Bacteria 5320
89 Ga0068864_100031973 3300005618 Bacteria 4468
90 Ga0068864_100119642 3300005618 Bacteria 2353
91 Ga0068870_10037677 3300005840 Bacteria 2493
92 Ga0068863_100001503 3300005841 Bacteria 23075
93 Ga0068863_100027761 3300005841 Bacteria 5402
94 Ga0068863_100130422 3300005841 Bacteria 2400
95 Ga0068863_100148847 3300005841 Bacteria 2240
96 Ga0068858_100043979 3300005842 Bacteria 4140
97 Ga0068858_100190819 3300005842 Bacteria 1936
98 Ga0068860_100000394 3300005843 Bacteria 57127
99 Ga0068860_100000443 3300005843 Bacteria 52294
100 Ga0068860_100001434 3300005843 Bacteria 25816
101 Ga0068860_100004753 3300005843 Bacteria 13841
102 Ga0068862_100033339 3300005844 Bacteria 4352
103 Ga0068862_100105735 3300005844 Bacteria 2467
104 Ga0081540_1007841 3300005983 Bacteria 7550
105 Ga0081539_10000893 3300005985 Bacteria 57031
106 Ga0070715_10008603 3300006163 Bacteria 3563
107 Ga0070715_10018822 3300006163 Bacteria 2639
108 Ga0075366_10015186 3300006195 Bacteria 4410
109 Ga0075366_10041158 3300006195 Bacteria 2735
110 Ga0097621_100006956 3300006237 Bacteria 8054
111 Ga0097621_100026485 3300006237 Bacteria 4549
112 Ga0097621_100054364 3300006237 Bacteria 3265
113 Ga0097621_100068836 3300006237 Bacteria 2921
114 Ga0068871_100014874 3300006358 Bacteria 5813
115 Ga0068871_100025305 3300006358 Bacteria 4615
116 Ga0075428_100012646 3300006844 Bacteria 9385
117 Ga0075428_100012683 3300006844 Bacteria 9372
118 Ga0075428_100109955 3300006844 Bacteria 3002
119 Ga0075431_100015973 3300006847 Bacteria 7617
120 Ga0068865_100021658 3300006881 Bacteria 4183
121 Ga0068865_100024576 3300006881 Bacteria 3954
122 Ga0097620_100000025 3300006931 Bacteria 191679
123 Ga0097620_100007026 3300006931 Bacteria 11428
124 Ga0097620_100024672 3300006931 Bacteria 6034
125 Ga0097620_100064290 3300006931 Bacteria 3701
126 Ga0097620_100117783 3300006931 Bacteria 2721
127 Ga0097620_100156453 3300006931 Bacteria 2357
128 Ga0105240_10005867 3300009093 Bacteria 18198
129 Ga0105240_10006669 3300009093 Bacteria 16930
130 Ga0105240_10008412 3300009093 Bacteria 14764
131 Ga0105240_10013970 3300009093 Bacteria 10992
132 Ga0105240_10017244 3300009093 Bacteria 9740
133 Ga0105240_10098645 3300009093 Bacteria 3557
134 Ga0105247_10004482 3300009101 Bacteria 8906
135 Ga0105247_10035179 3300009101 Bacteria 3052
136 Ga0105241_10000460 3300009174 Bacteria 30681
137 Ga0105241_10000583 3300009174 Bacteria 27510
138 Ga0105242_10014258 3300009176 Bacteria 6156
139 Ga0105242_10043907 3300009176 Bacteria 3618
140 Ga0105237_10000191 3300009545 Bacteria 87065
141 Ga0105237_10001055 3300009545 Bacteria 37018
142 Ga0105237_10002339 3300009545 Bacteria 23551
143 Ga0105237_10009688 3300009545 Bacteria 10307
144 Ga0105237_10010072 3300009545 Bacteria 10083
145 Ga0105237_10027106 3300009545 Bacteria 5852
146 Ga0105238_10000488 3300009551 Bacteria 41712
147 Ga0105238_10019337 3300009551 Bacteria 6936
148 Ga0105249_10008333 3300009553 Bacteria 9026
149 Ga0105249_10008489 3300009553 Bacteria 8951
150 Ga0105249_10021033 3300009553 Bacteria 5840
151 Ga0105249_10049085 3300009553 Bacteria 3849
152 Ga0105239_10000468 3300010375 Bacteria 59019
153 Ga0105239_10001833 3300010375 Bacteria 27816
154 Ga0105239_10031959 3300010375 Bacteria 5783
155 Ga0105239_10032094 3300010375 Bacteria 5771
156 Ga0105246_10017282 3300011119 Bacteria 4581
157 Ga0157371_10006884 3300013102 Bacteria 9281
158 Ga0157371_10033267 3300013102 Bacteria 3705
159 Ga0157370_10001571 3300013104 Bacteria 28252
160 Ga0157370_10139495 3300013104 Bacteria 2259
161 Ga0157369_10025886 3300013105 Bacteria 6509
162 Ga0157369_10031399 3300013105 Bacteria 5849
163 Ga0157374_10000011 3300013296 Bacteria 466749
164 Ga0157374_10007442 3300013296 Bacteria 9340
165 Ga0157374_10018424 3300013296 Bacteria 6160
166 Ga0157374_10050953 3300013296 Bacteria 3851
167 Ga0157378_10001083 3300013297 Bacteria 24880
168 Ga0157378_10005756 3300013297 Bacteria 10857
169 Ga0157378_10023648 3300013297 Bacteria 5405
170 Ga0157378_10076885 3300013297 Bacteria 3009
171 Ga0157378_10098664 3300013297 Bacteria 2664
172 Ga0157378_10236415 3300013297 Bacteria 1743
173 Ga0163162_10000424 3300013306 Bacteria 38989
174 Ga0163162_10002193 3300013306 Bacteria 18320
175 Ga0163162_10003040 3300013306 Bacteria 16029
176 Ga0163162_10003535 3300013306 Bacteria 14954
177 Ga0163162_10024611 3300013306 Bacteria 5945
178 Ga0157372_10001323 3300013307 Bacteria 26827
179 Ga0157372_10001983 3300013307 Bacteria 22252
180 Ga0157372_10018207 3300013307 Bacteria 7551
181 Ga0157372_10085995 3300013307 Bacteria 3567
182 Ga0157372_10159645 3300013307 Bacteria 2605
183 Ga0157372_10171113 3300013307 Bacteria 2513
184 Ga0157372_10276993 3300013307 Bacteria 1950
185 Ga0157375_10102739 3300013308 Bacteria 2944
186 Ga0157375_10104376 3300013308 Bacteria 2923
187 Ga0157375_10254844 3300013308 Bacteria 1916
188 Ga0163163_10184042 3300014325 Bacteria 2136
189 Ga0157380_10000043 3300014326 Bacteria 75738
190 Ga0157380_10018730 3300014326 Bacteria 5146
191 Ga0157380_10053645 3300014326 Bacteria 3197
192 Ga0157377_10008049 3300014745 Bacteria 5126
193 Ga0157377_10010005 3300014745 Bacteria 4678
194 Ga0157377_10010998 3300014745 Bacteria 4500
195 Ga0157377_10036370 3300014745 Bacteria 2708
196 Ga0157379_10104287 3300014968 Bacteria 2545
197 Ga0157376_10001885 3300014969 Bacteria 13999
198 Ga0157376_10004408 3300014969 Bacteria 9798
199 Ga0157376_10006599 3300014969 Bacteria 8210
200 Ga0163161_10006695 3300017792 Bacteria 7974
201 Ga0163161_10036242 3300017792 Bacteria 3532
202 Ga0163161_10057309 3300017792 Bacteria 2831
203 Ga0213876_10005600 3300021384 Bacteria 6897
204 Ga0213876_10026593 3300021384 Bacteria 3051
205 Ga0209436_100091 3300025208 Bacteria 44391
206 Ga0209646_1000031 3300025246 Bacteria 381260
207 Ga0209646_1000428 3300025246 Bacteria 23332
208 Ga0209026_1000019 3300025250 Bacteria 381260
209 Ga0209673_1000666 3300025273 Bacteria 49900
210 Ga0209130_1003551 3300025284 Bacteria 6529
211 Ga0209564_1013887 3300025295 Bacteria 3386
212 Ga0209564_1016111 3300025295 Bacteria 2995
213 Ga0209758_1006162 3300025297 Bacteria 8781
214 Ga0209050_1000216 3300025298 Bacteria 128896
215 Ga0207426_1000024 3300025302 Bacteria 534075
216 Ga0207426_1000827 3300025302 Bacteria 33011
217 Ga0207426_1002236 3300025302 Bacteria 12905
218 Ga0209257_1002445 3300025304 Bacteria 18465
219 Ga0207682_10031937 3300025893 Bacteria 2115
220 Ga0207710_10005590 3300025900 Bacteria 5409
221 Ga0207710_10059366 3300025900 Bacteria 1731
222 Ga0207688_10002147 3300025901 Bacteria 10604
223 Ga0207688_10012418 3300025901 Bacteria 4633
224 Ga0207688_10127296 3300025901 Bacteria 1490
225 Ga0207680_10000180 3300025903 Bacteria 30911
226 Ga0207680_10007029 3300025903 Bacteria 5467
227 Ga0207647_10000096 3300025904 Bacteria 67468
228 Ga0207647_10013169 3300025904 Bacteria 5745
229 Ga0207645_10000326 3300025907 Bacteria 39738
230 Ga0207645_10023895 3300025907 Bacteria 3967
231 Ga0207643_10004929 3300025908 Bacteria 7140
232 Ga0207643_10114154 3300025908 Bacteria 1594
233 Ga0207654_10031081 3300025911 Bacteria 2938
234 Ga0207707_10096394 3300025912 Bacteria 2585
235 Ga0207695_10000351 3300025913 Bacteria 105891
236 Ga0207695_10001387 3300025913 Bacteria 40927
237 Ga0207695_10002698 3300025913 Bacteria 25889
238 Ga0207695_10014473 3300025913 Bacteria 9339
239 Ga0207695_10038130 3300025913 Bacteria 5178
240 Ga0207671_10001741 3300025914 Bacteria 24461
241 Ga0207671_10007428 3300025914 Bacteria 9509
242 Ga0207671_10007829 3300025914 Bacteria 9188
243 Ga0207671_10012287 3300025914 Bacteria 6895
244 Ga0207671_10033595 3300025914 Bacteria 3815
245 Ga0207671_10053598 3300025914 Bacteria 2989
246 Ga0207662_10051603 3300025918 Bacteria 2447
247 Ga0207657_10027080 3300025919 Bacteria 5255
248 Ga0207649_10087760 3300025920 Bacteria 2030
249 Ga0207694_10002191 3300025924 Bacteria 16050
250 Ga0207650_10015592 3300025925 Bacteria 5296
251 Ga0207659_10016850 3300025926 Bacteria 4764
252 Ga0207659_10025743 3300025926 Bacteria 3959
253 Ga0207644_10097081 3300025931 Bacteria 2207
254 Ga0207644_10144514 3300025931 Bacteria 1835
255 Ga0207706_10001440 3300025933 Bacteria 23805
256 Ga0207706_10005261 3300025933 Bacteria 12070
257 Ga0207706_10020556 3300025933 Bacteria 5933
258 Ga0207686_10001189 3300025934 Bacteria 15075
259 Ga0207670_10019099 3300025936 Bacteria 4179
260 Ga0207670_10057742 3300025936 Bacteria 2633
261 Ga0207670_10117925 3300025936 Bacteria 1924
262 Ga0207691_10007066 3300025940 Bacteria 10832
263 Ga0207691_10008770 3300025940 Bacteria 9702
264 Ga0207691_10017962 3300025940 Bacteria 6700
265 Ga0207691_10093056 3300025940 Bacteria 2700
266 Ga0207689_10000208 3300025942 Bacteria 51706
267 Ga0207689_10001060 3300025942 Bacteria 26468
268 Ga0207689_10007932 3300025942 Bacteria 9273
269 Ga0207689_10009934 3300025942 Bacteria 8207
270 Ga0207689_10064912 3300025942 Bacteria 3003
271 Ga0207661_10005152 3300025944 Bacteria 9184
272 Ga0207661_10014985 3300025944 Bacteria 5692
273 Ga0207661_10021073 3300025944 Bacteria 4882
274 Ga0207679_10000091 3300025945 Bacteria 78725
275 Ga0207679_10018927 3300025945 Bacteria 4621
276 Ga0207667_10023030 3300025949 Bacteria 6865
277 Ga0207667_10024123 3300025949 Bacteria 6685
278 Ga0207667_10085216 3300025949 Bacteria 3271
279 Ga0207651_10027471 3300025960 Bacteria 3574
280 Ga0207651_10103502 3300025960 Bacteria 2119
281 Ga0207651_10107890 3300025960 Bacteria 2082
282 Ga0207712_10003706 3300025961 Bacteria 9642
283 Ga0207712_10005164 3300025961 Bacteria 8260
284 Ga0207712_10037790 3300025961 Bacteria 3296
285 Ga0207712_10047684 3300025961 Bacteria 2976
286 Ga0207658_10030114 3300025986 Bacteria 3840
287 Ga0207658_10033296 3300025986 Bacteria 3675
288 Ga0207658_10058580 3300025986 Bacteria 2867
289 Ga0207677_10069381 3300026023 Bacteria 2479
290 Ga0207639_10001397 3300026041 Bacteria 16299
291 Ga0207639_10114103 3300026041 Bacteria 2207
292 Ga0207639_10199656 3300026041 Bacteria 1714
293 Ga0207678_10025516 3300026067 Bacteria 5159
294 Ga0207641_10000132 3300026088 Bacteria 109247
295 Ga0207641_10009890 3300026088 Bacteria 7853
296 Ga0207641_10038936 3300026088 Bacteria 3975
297 Ga0207641_10067079 3300026088 Bacteria 3073
298 Ga0207641_10128886 3300026088 Bacteria 2269
299 Ga0207648_10001340 3300026089 Bacteria 27318
300 Ga0207648_10008642 3300026089 Bacteria 9835
301 Ga0207648_10015275 3300026089 Bacteria 7063
302 Ga0207648_10063699 3300026089 Bacteria 3213
303 Ga0207676_10012403 3300026095 Bacteria 6106
304 Ga0207676_10044849 3300026095 Bacteria 3413
305 Ga0207676_10101590 3300026095 Bacteria 2385
306 Ga0207674_10006694 3300026116 Bacteria 13532
307 Ga0207674_10006896 3300026116 Bacteria 13314
308 Ga0207674_10083665 3300026116 Bacteria 3190
309 Ga0207674_10134246 3300026116 Bacteria 2438
310 Ga0207675_100011340 3300026118 Bacteria 8340
311 Ga0207675_100016346 3300026118 Bacteria 6927
312 Ga0207675_100075726 3300026118 Bacteria 3150
313 Ga0207675_100098129 3300026118 Bacteria 2759
314 Ga0207683_10005340 3300026121 Bacteria 11024
315 Ga0207683_10016473 3300026121 Bacteria 6291
316 Ga0207698_10000340 3300026142 Bacteria 27673
317 Ga0207698_10010238 3300026142 Bacteria 6012
318 Ga0207698_10011519 3300026142 Bacteria 5738
319 Ga0207698_10035407 3300026142 Bacteria 3652
320 Ga0268266_10000068 3300028379 Bacteria 241100
321 Ga0268266_10079924 3300028379 Bacteria 2848
322 Ga0268265_10077436 3300028380 Bacteria 2612
323 Ga0268264_10000559 3300028381 Bacteria 45910
324 Ga0268264_10002198 3300028381 Bacteria 17332
325 Ga0268264_10004188 3300028381 Bacteria 12320
326 Ga0265334_10025690 3300028573 Bacteria 2383
327 Ga0307515_10000437 3300028794 Bacteria 100047
328 Ga0265327_10000115 3300031251 Bacteria 173854
329 Ga0307513_10168713 3300031456 Bacteria 2069
330 Ga0307509_10013957 3300031507 Bacteria 9471
331 Ga0307509_10076208 3300031507 Bacteria 3481
332 Ga0307509_10120571 3300031507 Bacteria 2601
333 Ga0307508_10000606 3300031616 Bacteria 42966
334 Ga0307508_10114220 3300031616 Bacteria 2301
335 Ga0307516_10001546 3300031730 Bacteria 31635
336 Ga0307510_10001895 3300033180 Bacteria 23475
337 Ga0373936_0028021 3300035113 Bacteria 2212
338 Ga0373955_0016181 3300035172 Bacteria 3667
339 Ga0373927_0006136 3300035695 Bacteria 8224
340 Ga0373933_0011503 3300035724 Bacteria 4882
341 Ga0373937_0028695 3300036401 Bacteria 5036
342 Ga0395905_0000001 3300037471 Bacteria 2037079
343 Ga0395901_0132498 3300038443 Bacteria 2619
344 Ga0436365_0111081 3300039437 Bacteria 39407
345 Ga0436365_0548634 3300039437 Bacteria 13605
346 Ga0439436_0000892 3300041404 Bacteria 8160
347 Ga0439457_000874 3300042014 Bacteria 9102
348 Ga0451577_0034814 3300042876 Bacteria 4538
349 Ga0466969_0004965 3300044656 Bacteria 7083
350 Ga0466972_0000365 3300044658 Bacteria 24444
351 Ga0466972_0014246 3300044658 Bacteria 3984
352 Ga0453683_0051027 3300044673 Bacteria 2592
353 Ga0453683_0084453 3300044673 Bacteria 1989
354 Ga0466966_0000038 3300044684 Bacteria 97255
355 Ga0466961_0084761 3300044693 Bacteria 2004
356 Ga0466968_0018309 3300044735 Bacteria 2809
357 Ga0466970_0005297 3300044765 Bacteria 6393
358 Ga0466957_0002514 3300044842 Bacteria 9870
359 Ga0466957_0007550 3300044842 Bacteria 6146
360 Ga0466959_0000289 3300045049 Bacteria 30468
361 Ga0466959_0035071 3300045049 Bacteria 3712
362 Ga0451576_0000003 3300045051 Bacteria 1550573
363 Ga0495592_0071033 3300046454 Bacteria 2535
364 Ga0495618_0027258 3300046514 Bacteria 3557
365 Ga0495630_0014167 3300046517 Bacteria 5804
366 Ga0495648_0004618 3300046524 Bacteria 11716
367 Ga0495668_0004320 3300046616 Bacteria 10158
368 Ga0495634_0034313 3300046642 Bacteria 3483
369 Ga0495672_0013590 3300047320 Bacteria 5610
370 Ga0495672_0017207 3300047320 Bacteria 4840
371 Ga0495687_000058 3300047443 Bacteria 185830
372 Ga0495686_0000005 3300047472 Bacteria 827143
373 Ga0495686_0015581 3300047472 Bacteria 5185
374 Ga0501031_0000120 3300049568 Bacteria 42915
375 Ga0501031_0032193 3300049568 Bacteria 3419
376 Ga0501032_0005001 3300049569 Bacteria 9914
377 Ga0501032_0015727 3300049569 Bacteria 5334
378 Ga0501033_0000004 3300049570 Bacteria 441310
379 Ga0501034_0000216 3300049571 Bacteria 109908
380 Ga0501034_0062096 3300049571 Bacteria 3751
381 Ga0501034_0093743 3300049571 Bacteria 2999
382 Ga0501036_0010166 3300049572 Bacteria 7755
383 Ga0501036_0032651 3300049572 Bacteria 4400
384 Ga0501037_0014098 3300049573 Bacteria 5888
385 Ga0501037_0015291 3300049573 Bacteria 5646
386 Ga0501038_0002703 3300049574 Bacteria 16537
387 Ga0501038_0004730 3300049574 Bacteria 12664
388 Ga0501038_0027273 3300049574 Bacteria 5084
389 Ga0501039_0003281 3300049575 Bacteria 12101
390 Ga0501039_0048934 3300049575 Bacteria 3268
391 Ga0501043_0000650 3300049579 Bacteria 30653
392 Ga0501043_0003152 3300049579 Bacteria 13648
393 Ga0501043_0003493 3300049579 Bacteria 12916
394 Ga0501046_0033115 3300049580 Bacteria 4179
395 Ga0501047_0004866 3300049581 Bacteria 12612
396 Ga0501047_0008279 3300049581 Bacteria 9816
397 Ga0501047_0011501 3300049581 Bacteria 8378
398 Ga0501047_0032529 3300049581 Bacteria 5035
399 Ga0501048_0016937 3300049582 Bacteria 5372
400 Ga0501068_0050427 3300049584 Bacteria 2516
401 Ga0501070_0066890 3300049586 Bacteria 2976
402 Ga0501070_0210092 3300049586 Bacteria 1598
403 Ga0501074_0004850 3300049590 Bacteria 9645
404 Ga0501243_005972 3300049675 Bacteria 1840
405 Ga0501245_003871 3300049708 Bacteria 2046
406 Ga0501083_0007173 3300049744 Bacteria 7913
407 Ga0501266_000767 3300049763 Bacteria 4173
408 Ga0501035_0002099 3300049822 Bacteria 19816
409 Ga0501035_0009272 3300049822 Bacteria 9150
410 Ga0501035_0010218 3300049822 Bacteria 8711
411 Ga0501035_0012287 3300049822 Bacteria 7915
412 Ga0501035_0262737 3300049822 Bacteria 1463
413 Ga0501044_0000500 3300049823 Bacteria 47679
414 Ga0501044_0005264 3300049823 Bacteria 14391
415 Ga0501044_0012837 3300049823 Bacteria 9070
416 Ga0501044_0014761 3300049823 Bacteria 8421
417 Ga0501045_0000279 3300049824 Bacteria 29797
418 nmdc:mga09592_33858_c1 3300050508 Bacteria 4269
419 nmdc:mga06r32_27533_c1 3300050510 Bacteria 5311
420 nmdc:mga08y16_125161_c1 3300050511 Bacteria 2674
421 Ga0500578_0001471 3300053086 Bacteria 23470
422 Ga0500578_0037224 3300053086 Bacteria 3125
423 Ga0500583_0000111 3300053092 Bacteria 40256
424 Ga0500651_0138758 3300053093 Bacteria 1467
425 Ga0500562_000005 3300053108 Bacteria 266746
426 Ga0500642_0001723 3300053130 Bacteria 6309
427 Ga0500652_001259 3300053131 Bacteria 8054
428 Ga0500652_009099 3300053131 Bacteria 3344
429 Ga0500568_0001592 3300053139 Bacteria 14355
430 Ga0500588_0018626 3300053146 Bacteria 1832
431 Ga0500616_0009915 3300053153 Bacteria 5736
432 Ga0500622_0000835 3300053156 Bacteria 26334
433 Ga0500622_0007310 3300053156 Bacteria 6289
434 Ga0501084_0034594 3300054114 Bacteria 4224
435 Ga0466962_0025746 3300061719 Bacteria 2824
436 2738725875 2738541278 Bacteria 9755573
437 2819589713 2818991444 Bacteria 6968812
438 2819677191 2818991460 Bacteria 7595395
439 2884797043 2884791551 Bacteria 8511252
440 2929159879 2929154850 Bacteria 6753285
441 2929177403 2929177148 Bacteria 7883697
442 2929921496 2929921140 Bacteria 8649150
443 2945979770 2945977869 Bacteria 7777518
444 2946014363 2946013367 Bacteria 7766675
445 8003152040 8003151029 Bacteria 8187759
446 Ga0070661_100009578
447 JGI24739J22299_10006978
448 JGI24751J29686_10000360
449 JGI25153J46596_10004852
450 rootH1_10050342
451 rootH2_10025296
452 rootH2_10135667
453 rootH1_10045167
454 JGI25160J50197_1005331
455 JGI25160J50197_1007445
456 JGI25160J50197_1010103
457 Ga0055526_1014309
458 Ga0055528_1000648
459 Ga0055530_10003884
460 Ga0065165_1000042
461 Ga0065712_10001246
462 Ga0065712_10023681
463 Ga0065715_10004024
464 Ga0070658_10021161
465 Ga0070676_10006291
466 Ga0070683_100004596
467 Ga0070683_100149606
468 Ga0070670_100005255
469 Ga0070670_100068422
470 Ga0070670_100068851
471 Ga0070670_100091885
472 Ga0070670_100114077
473 Ga0070670_100128439
474 Ga0068869_100086205
475 Ga0070666_10000086
476 Ga0070666_10033625
477 Ga0068868_100097188
478 Ga0070689_100035973
479 Ga0070661_100000111
480 Ga0070661_100029829
481 Ga0070668_100009821
482 Ga0070669_100058880
483 Ga0070669_100160158
484 Ga0070675_100018336
485 Ga0070675_100029464
486 Ga0070674_100047455
487 Ga0070674_100062132
488 Ga0070674_100090920
489 Ga0070673_100030971
490 Ga0070673_100077968
491 Ga0070688_100055919
492 Ga0070659_100007898
493 Ga0070667_100009085
494 Ga0070667_100069096
495 Ga0070667_100134955
496 Ga0070678_100028680
497 Ga0070681_10084875
498 Ga0068867_100007969
499 Ga0068867_100011772
500 Ga0068867_100027792
501 Ga0070698_100001074
502 Ga0070679_100083370
503 Ga0070684_100008247
504 Ga0070684_100012077
505 Ga0070684_100012277
506 Ga0068853_100018696
507 Ga0068853_100037373
508 Ga0070672_100057200
509 Ga0070665_100000014
510 Ga0070665_100007232
511 Ga0068855_100021819
512 Ga0068855_100022619
513 Ga0070664_100000243
514 Ga0068857_100001483
515 Ga0068857_100002097
516 Ga0068857_100078885
517 Ga0068857_100080451
518 Ga0068856_100010109
519 Ga0068856_100019904
520 Ga0068856_100075018
521 Ga0068852_100002957
522 Ga0068852_100015068
523 Ga0068852_100055192
524 Ga0068852_100081869
525 Ga0068859_100000025
526 Ga0068859_100007026
527 Ga0068859_100024673
528 Ga0068859_100064288
529 Ga0068859_100117779
530 Ga0068859_100156454
531 Ga0068864_100006400
532 Ga0068864_100019781
533 Ga0068864_100022205
534 Ga0068864_100031973
535 Ga0068864_100119642
536 Ga0068870_10037677
537 Ga0068863_100001503
538 Ga0068863_100027761
539 Ga0068863_100130422
540 Ga0068863_100148847
541 Ga0068858_100043979
542 Ga0068858_100190819
543 Ga0068860_100000394
544 Ga0068860_100000443
545 Ga0068860_100001434
546 Ga0068860_100004753
547 Ga0068862_100033339
548 Ga0068862_100105735
549 Ga0081540_1007841
550 Ga0081539_10000893
551 Ga0070715_10008603
552 Ga0070715_10018822
553 Ga0075366_10015186
554 Ga0075366_10041158
555 Ga0097621_100006956
556 Ga0097621_100026485
557 Ga0097621_100054364
558 Ga0097621_100068836
559 Ga0068871_100014874
560 Ga0068871_100025305
561 Ga0075428_100012646
562 Ga0075428_100012683
563 Ga0075428_100109955
564 Ga0075431_100015973
565 Ga0068865_100021658
566 Ga0068865_100024576
567 Ga0097620_100000025
568 Ga0097620_100007026
569 Ga0097620_100024672
570 Ga0097620_100064290
571 Ga0097620_100117783
572 Ga0097620_100156453
573 Ga0105240_10005867
574 Ga0105240_10006669
575 Ga0105240_10008412
576 Ga0105240_10013970
577 Ga0105240_10017244
578 Ga0105240_10098645
579 Ga0105247_10004482
580 Ga0105247_10035179
581 Ga0105241_10000460
582 Ga0105241_10000583
583 Ga0105242_10014258
584 Ga0105242_10043907
585 Ga0105237_10000191
586 Ga0105237_10001055
587 Ga0105237_10002339
588 Ga0105237_10009688
589 Ga0105237_10010072
590 Ga0105237_10027106
591 Ga0105238_10000488
592 Ga0105238_10019337
593 Ga0105249_10008333
594 Ga0105249_10008489
595 Ga0105249_10021033
596 Ga0105249_10049085
597 Ga0105239_10000468
598 Ga0105239_10001833
599 Ga0105239_10031959
600 Ga0105239_10032094
601 Ga0105246_10017282
602 Ga0157371_10006884
603 Ga0157371_10033267
604 Ga0157370_10001571
605 Ga0157370_10139495
606 Ga0157369_10025886
607 Ga0157369_10031399
608 Ga0157374_10000011
609 Ga0157374_10007442
610 Ga0157374_10018424
611 Ga0157374_10050953
612 Ga0157378_10001083
613 Ga0157378_10005756
614 Ga0157378_10023648
615 Ga0157378_10076885
616 Ga0157378_10098664
617 Ga0157378_10236415
618 Ga0163162_10000424
619 Ga0163162_10002193
620 Ga0163162_10003040
621 Ga0163162_10003535
622 Ga0163162_10024611
623 Ga0157372_10001323
624 Ga0157372_10001983
625 Ga0157372_10018207
626 Ga0157372_10085995
627 Ga0157372_10159645
628 Ga0157372_10171113
629 Ga0157372_10276993
630 Ga0157375_10102739
631 Ga0157375_10104376
632 Ga0157375_10254844
633 Ga0163163_10184042
634 Ga0157380_10000043
635 Ga0157380_10018730
636 Ga0157380_10053645
637 Ga0157377_10008049
638 Ga0157377_10010005
639 Ga0157377_10010998
640 Ga0157377_10036370
641 Ga0157379_10104287
642 Ga0157376_10001885
643 Ga0157376_10004408
644 Ga0157376_10006599
645 Ga0163161_10006695
646 Ga0163161_10036242
647 Ga0163161_10057309
648 Ga0213876_10005600
649 Ga0213876_10026593
650 Ga0209436_100091
651 Ga0209646_1000031
652 Ga0209646_1000428
653 Ga0209026_1000019
654 Ga0209673_1000666
655 Ga0209130_1003551
656 Ga0209564_1013887
657 Ga0209564_1016111
658 Ga0209758_1006162
659 Ga0209050_1000216
660 Ga0207426_1000024
661 Ga0207426_1000827
662 Ga0207426_1002236
663 Ga0209257_1002445
664 Ga0207682_10031937
665 Ga0207710_10005590
666 Ga0207710_10059366
667 Ga0207688_10002147
668 Ga0207688_10012418
669 Ga0207688_10127296
670 Ga0207680_10000180
671 Ga0207680_10007029
672 Ga0207647_10000096
673 Ga0207647_10013169
674 Ga0207645_10000326
675 Ga0207645_10023895
676 Ga0207643_10004929
677 Ga0207643_10114154
678 Ga0207654_10031081
679 Ga0207707_10096394
680 Ga0207695_10000351
681 Ga0207695_10001387
682 Ga0207695_10002698
683 Ga0207695_10014473
684 Ga0207695_10038130
685 Ga0207671_10001741
686 Ga0207671_10007428
687 Ga0207671_10007829
688 Ga0207671_10012287
689 Ga0207671_10033595
690 Ga0207671_10053598
691 Ga0207662_10051603
692 Ga0207657_10027080
693 Ga0207649_10087760
694 Ga0207694_10002191
695 Ga0207650_10015592
696 Ga0207659_10016850
697 Ga0207659_10025743
698 Ga0207644_10097081
699 Ga0207644_10144514
700 Ga0207706_10001440
701 Ga0207706_10005261
702 Ga0207706_10020556
703 Ga0207686_10001189
704 Ga0207670_10019099
705 Ga0207670_10057742
706 Ga0207670_10117925
707 Ga0207691_10007066
708 Ga0207691_10008770
709 Ga0207691_10017962
710 Ga0207691_10093056
711 Ga0207689_10000208
712 Ga0207689_10001060
713 Ga0207689_10007932
714 Ga0207689_10009934
715 Ga0207689_10064912
716 Ga0207661_10005152
717 Ga0207661_10014985
718 Ga0207661_10021073
719 Ga0207679_10000091
720 Ga0207679_10018927
721 Ga0207667_10023030
722 Ga0207667_10024123
723 Ga0207667_10085216
724 Ga0207651_10027471
725 Ga0207651_10103502
726 Ga0207651_10107890
727 Ga0207712_10003706
728 Ga0207712_10005164
729 Ga0207712_10037790
730 Ga0207712_10047684
731 Ga0207658_10030114
732 Ga0207658_10033296
733 Ga0207658_10058580
734 Ga0207677_10069381
735 Ga0207639_10001397
736 Ga0207639_10114103
737 Ga0207639_10199656
738 Ga0207678_10025516
739 Ga0207641_10000132
740 Ga0207641_10009890
741 Ga0207641_10038936
742 Ga0207641_10067079
743 Ga0207641_10128886
744 Ga0207648_10001340
745 Ga0207648_10008642
746 Ga0207648_10015275
747 Ga0207648_10063699
748 Ga0207676_10012403
749 Ga0207676_10044849
750 Ga0207676_10101590
751 Ga0207674_10006694
752 Ga0207674_10006896
753 Ga0207674_10083665
754 Ga0207674_10134246
755 Ga0207675_100011340
756 Ga0207675_100016346
757 Ga0207675_100075726
758 Ga0207675_100098129
759 Ga0207683_10005340
760 Ga0207683_10016473
761 Ga0207698_10000340
762 Ga0207698_10010238
763 Ga0207698_10011519
764 Ga0207698_10035407
765 Ga0268266_10000068
766 Ga0268266_10079924
767 Ga0268265_10077436
768 Ga0268264_10000559
769 Ga0268264_10002198
770 Ga0268264_10004188
771 Ga0265334_10025690
772 Ga0307515_10000437
773 Ga0265327_10000115
774 Ga0307513_10168713
775 Ga0307509_10013957
776 Ga0307509_10076208
777 Ga0307509_10120571
778 Ga0307508_10000606
779 Ga0307508_10114220
780 Ga0307516_10001546
781 Ga0307510_10001895
782 Ga0373936_0028021
783 Ga0373955_0016181
784 Ga0373927_0006136
785 Ga0373933_0011503
786 Ga0373937_0028695
787 Ga0395905_0000001
788 Ga0395901_0132498
789 Ga0436365_0111081
790 Ga0436365_0548634
791 Ga0439436_0000892
792 Ga0439457_000874
793 Ga0451577_0034814
794 Ga0466969_0004965
795 Ga0466972_0000365
796 Ga0466972_0014246
797 Ga0453683_0051027
798 Ga0453683_0084453
799 Ga0466966_0000038
800 Ga0466961_0084761
801 Ga0466968_0018309
802 Ga0466970_0005297
803 Ga0466957_0002514
804 Ga0466957_0007550
805 Ga0466959_0000289
806 Ga0466959_0035071
807 Ga0451576_0000003
808 Ga0495592_0071033
809 Ga0495618_0027258
810 Ga0495630_0014167
811 Ga0495648_0004618
812 Ga0495668_0004320
813 Ga0495634_0034313
814 Ga0495672_0013590
815 Ga0495672_0017207
816 Ga0495687_000058
817 Ga0495686_0000005
818 Ga0495686_0015581
819 Ga0501031_0000120
820 Ga0501031_0032193
821 Ga0501032_0005001
822 Ga0501032_0015727
823 Ga0501033_0000004
824 Ga0501034_0000216
825 Ga0501034_0062096
826 Ga0501034_0093743
827 Ga0501036_0010166
828 Ga0501036_0032651
829 Ga0501037_0014098
830 Ga0501037_0015291
831 Ga0501038_0002703
832 Ga0501038_0004730
833 Ga0501038_0027273
834 Ga0501039_0003281
835 Ga0501039_0048934
836 Ga0501043_0000650
837 Ga0501043_0003152
838 Ga0501043_0003493
839 Ga0501046_0033115
840 Ga0501047_0004866
841 Ga0501047_0008279
842 Ga0501047_0011501
843 Ga0501047_0032529
844 Ga0501048_0016937
845 Ga0501068_0050427
846 Ga0501070_0066890
847 Ga0501070_0210092
848 Ga0501074_0004850
849 Ga0501243_005972
850 Ga0501245_003871
851 Ga0501083_0007173
852 Ga0501266_000767
853 Ga0501035_0002099
854 Ga0501035_0009272
855 Ga0501035_0010218
856 Ga0501035_0012287
857 Ga0501035_0262737
858 Ga0501044_0000500
859 Ga0501044_0005264
860 Ga0501044_0012837
861 Ga0501044_0014761
862 Ga0501045_0000279
863 nmdc:mga09592_33858_c1
864 nmdc:mga06r32_27533_c1
865 nmdc:mga08y16_125161_c1
866 Ga0500578_0001471
867 Ga0500578_0037224
868 Ga0500583_0000111
869 Ga0500651_0138758
870 Ga0500562_000005
871 Ga0500642_0001723
872 Ga0500652_001259
873 Ga0500652_009099
874 Ga0500568_0001592
875 Ga0500588_0018626
876 Ga0500616_0009915
877 Ga0500622_0000835
878 Ga0500622_0007310
879 Ga0501084_0034594
880 Ga0466962_0025746
881 2738725875
882 2819589713
883 2819677191
884 2884797043
885 2929159879
886 2929177403
887 2929921496
888 2945979770
889 2946014363
890 8003152040

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06415

iPGM_N

BPG-independent PGAM N-terminus (iPGM_N)

82

295

0.98

PF01676

Metalloenzyme

Metalloenzyme superfamily

4

496

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ify-assembly1.cif.gz_A structure of bacillus anthracis cofactor-independent phosphoglucerate mutase 0.9389 4 506
2ify-assembly1.cif.gz_A structure of bacillus anthracis cofactor-independent phosphoglucerate mutase 0.93 4 506
7knf-assembly2.cif.gz_B 1.80a resolution structure of independent phosphoglycerate mutase from c. elegans in complex with a macrocyclic peptide inhibitor (ce-1 nhoh) 0.9245 3 506
7knf-assembly1.cif.gz_A 1.80a resolution structure of independent phosphoglycerate mutase from c. elegans in complex with a macrocyclic peptide inhibitor (ce-1 nhoh) 0.9217 3 506
7kng-assembly1.cif.gz_A 2.10a resolution structure of independent phosphoglycerate mutase from c. elegans in complex with a macrocyclic peptide inhibitor (ce-2 y7f) 0.9185 4 507
ID Description Score Start End Superfamily
af_Q2G029_311_465_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.99 315 466 3.40.720.10
1ejjA02 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.9699 3 506 3.40.720.10
af_Q2G029_311_465_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.9648 315 466 3.40.720.10
1ejjA02 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.9593 3 506 3.40.720.10
af_G5EFZ1_349_538_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.958 324 506 3.40.720.10
ID Description Score Start End GO Terms
AF-A0A7C4XY45-F1-model_v4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase 0.9999 339 506 GO:0005829
GO:0006007
GO:0030145
GO:0046537
AF-A0A6L5DGG7-F1-model_v4 deleted 0.9964 315 506
AF-A0A7K0F4W8-F1-model_v4 deleted 0.9951 311 414
AF-A0A4V1UT05-F1-model_v4 Metalloenzyme domain-containing protein 0.995 371 506 GO:0005829
GO:0006007
GO:0030145
GO:0046537
AF-A0A4Q3VC43-F1-model_v4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase 0.9941 311 507 GO:0005829
GO:0006007
GO:0030145
GO:0046537

Map