F445425

General Info

Members Datasets Scaffolds Average Seq Length
445 293 890 407

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100021348|Ga0070669_1000213482
Length 448
Sequence MNAAVHSANARPAARADAGHTQATRLDAITGRYDGWLLGLSVALASLGVVMVASSSIAIGEGLDVGPFYFLTRHLLFLAIGIGLAIWAMRTELKTVEHYNQLLLLGCFVLLLLVFVPGIGSTVNGAKRWINLGVSKFQTVEAVKLLYIVWLSSYLVRFRDEVNATWPAMLKPLGVAVALVALLLLQPDFGSSSLLLAITAGMLVLGGVNLPRMSMPIVFGLPVFAFIAILEPYRVSRLTSFLDPWKDQLGSGYQLSNALMAVGRGEWTGVGLGASVQKLSYLPEAHTDFIFSVIAEELGFVGVCLVIALYVGLVGRAFWVGYRCVGMRRHFAGYCAFGVALWISLQSFVSIGVNLGILPTKGLTLPMISSGGSSVLMTCAALGLLLRVSYELDRAERQVARLRGEGAQAPVGNVPATAQPAAPAAHPAAARGTSRLRQRVEPTFGRSA

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
14 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
15 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
73 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
74 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
75 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
76 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
83 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
85 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
88 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
134 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
135 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
136 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
137 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
146 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
147 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
148 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
149 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
150 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
151 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
157 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
160 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
161 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
162 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
163 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
164 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
165 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
166 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
167 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
168 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
171 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
172 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
173 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
174 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
175 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
182 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
183 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
184 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
187 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
188 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
189 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
190 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
201 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
202 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
203 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
204 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
205 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
206 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
211 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
212 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
224 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
225 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
236 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
237 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
238 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
239 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
240 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
241 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
245 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
246 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
247 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
248 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
249 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
250 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
251 2643221593 Lysobacter sp. Root690 Isolate Unclassified
252 2643221695 Lysobacter sp. Root494 Isolate Unclassified
253 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
254 2734482264 Dyella sp. AD052 Isolate Unclassified
255 2738543009 Luteibacter sp. OK325 Isolate Unclassified
256 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
257 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
258 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
259 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
260 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
261 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
262 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
263 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
264 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
265 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
266 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
267 2884411467 Dyella sp. AD56 Isolate Rhizosphere
268 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
269 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
270 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
271 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
272 2919085039 Luteibacter sp. 1214 Isolate Unclassified
273 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
274 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
275 2919404418 Luteibacter sp. 3190 Isolate Unclassified
276 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
277 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
278 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
279 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
280 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
281 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
282 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
283 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
284 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
285 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
286 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
287 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
288 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
289 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
290 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
291 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
292 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
293 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.76
Metatranscriptomes 0.22
Isolates 11.01

Biome Distribution

Category Percentage (%)
Aerial Root 0.22
Bulb 0
Endosphere 16.85
Nodule 0.22
Rhizoplane 2.25
Rhizosphere 65.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100021348 3300005353 Bacteria 4627
2 SwRhRL2b_contig_2863456 2162886007 Bacteria 1484
3 JGI24744J21845_10007693 3300002077 Bacteria 2226
4 JGI25156J39149_1009976 3300002705 Bacteria 2267
5 JGI25162J39368_1001140 3300002737 Bacteria 15933
6 JGI25157J39369_1000133 3300002741 Bacteria 62143
7 JGI25157J39369_1000314 3300002741 Bacteria 34899
8 JGI25163J39215_1000210 3300002771 Bacteria 22204
9 JGI25164J39214_1000075 3300002772 Bacteria 97713
10 JGI25151J46595_10000048 3300003187 Bacteria 166842
11 JGI25165J46597_1000178 3300003214 Bacteria 97713
12 rootH2_10015921 3300003320 Bacteria 7394
13 rootH1_10218632 3300003323 Bacteria 2524
14 Ga0006562J51391_1000525 3300003578 Bacteria 10975
15 Ga0055538_1000590 3300003751 Bacteria 12121
16 Ga0055535_1000350 3300003761 Bacteria 45642
17 Ga0055542_1001122 3300003762 Bacteria 15933
18 Ga0055529_1000153 3300003763 Bacteria 97713
19 Ga0055526_1000005 3300003771 Bacteria 344542
20 Ga0055526_1002585 3300003771 Bacteria 12096
21 Ga0055537_1000270 3300003773 Bacteria 37693
22 Ga0055537_1000884 3300003773 Bacteria 14283
23 Ga0055524_1000005 3300003775 Bacteria 344542
24 Ga0055536_1002013 3300003781 Bacteria 11659
25 Ga0055536_1012163 3300003781 Bacteria 3218
26 Ga0055534_1000002 3300003784 Bacteria 390762
27 Ga0055534_1000187 3300003784 Bacteria 45318
28 Ga0055528_1000002 3300003790 Bacteria 368879
29 Ga0055528_1001833 3300003790 Bacteria 12128
30 Ga0055530_10005809 3300003791 Bacteria 5723
31 Ga0055530_10005825 3300003791 Bacteria 5714
32 Ga0055531_10005465 3300003794 Bacteria 7436
33 Ga0058692_1000037 3300003856 Bacteria 143875
34 Ga0065704_10073655 3300005289 Bacteria 6918
35 Ga0065715_10158516 3300005293 Bacteria 1652
36 Ga0070658_10289344 3300005327 Bacteria 1396
37 Ga0070676_10083494 3300005328 Bacteria 1943
38 Ga0070670_100162986 3300005331 Bacteria 1933
39 Ga0068869_100122561 3300005334 Bacteria 1990
40 Ga0070666_10000888 3300005335 Bacteria 18197
41 Ga0070682_100159267 3300005337 Bacteria 1557
42 Ga0070661_100096982 3300005344 Bacteria 2188
43 Ga0070668_100002651 3300005347 Bacteria 13146
44 Ga0070674_100117884 3300005356 Bacteria 1961
45 Ga0070667_100007577 3300005367 Bacteria 9006
46 Ga0070667_100153889 3300005367 Bacteria 2022
47 Ga0070667_100240922 3300005367 Bacteria 1615
48 Ga0070663_100222727 3300005455 Bacteria 1482
49 Ga0070678_100120830 3300005456 Bacteria 2066
50 Ga0070681_10143216 3300005458 Bacteria 2319
51 Ga0068853_100001171 3300005539 Bacteria 18661
52 Ga0068853_100001415 3300005539 Bacteria 17334
53 Ga0070696_100001750 3300005546 Bacteria 14237
54 Ga0070665_100000092 3300005548 Bacteria 174397
55 Ga0070665_100054405 3300005548 Bacteria 4014
56 Ga0070665_100236214 3300005548 Bacteria 1828
57 Ga0070665_100271902 3300005548 Bacteria 1696
58 Ga0068855_100001101 3300005563 Bacteria 33595
59 Ga0068855_100025589 3300005563 Bacteria 7059
60 Ga0068855_100059306 3300005563 Bacteria 4478
61 Ga0068857_100021270 3300005577 Bacteria 5710
62 Ga0068857_100074018 3300005577 Bacteria 3036
63 Ga0068856_100000495 3300005614 Bacteria 43612
64 Ga0068856_100260708 3300005614 Bacteria 1749
65 Ga0068870_10032132 3300005840 Bacteria 2664
66 Ga0068863_100029737 3300005841 Bacteria 5216
67 Ga0068860_100004984 3300005843 Bacteria 13532
68 Ga0075364_10047426 3300006051 Bacteria 2798
69 Ga0075369_10045434 3300006186 Bacteria 1889
70 Ga0097621_100051897 3300006237 Bacteria 3338
71 Ga0068865_100001698 3300006881 Bacteria 12909
72 Ga0105251_10007819 3300009011 Bacteria 6513
73 Ga0105244_10060732 3300009036 Bacteria 1904
74 Ga0105240_10019583 3300009093 Bacteria 9039
75 Ga0105247_10031840 3300009101 Bacteria 3202
76 Ga0105243_10008935 3300009148 Bacteria 7661
77 Ga0105242_10006944 3300009176 Bacteria 8740
78 Ga0105237_10000815 3300009545 Bacteria 42625
79 Ga0105238_10102813 3300009551 Bacteria 2839
80 Ga0105249_10061484 3300009553 Bacteria 3447
81 Ga0105249_10127612 3300009553 Bacteria 2424
82 Ga0105239_10007047 3300010375 Bacteria 12935
83 Ga0105239_10020846 3300010375 Bacteria 7231
84 Ga0105239_10028570 3300010375 Bacteria 6132
85 Ga0105239_10176674 3300010375 Bacteria 2388
86 Ga0157371_10004820 3300013102 Bacteria 11605
87 Ga0157370_10024112 3300013104 Bacteria 6031
88 Ga0157370_10038753 3300013104 Bacteria 4609
89 Ga0157370_10088014 3300013104 Bacteria 2917
90 Ga0157370_10313747 3300013104 Bacteria 1447
91 Ga0157369_10000001 3300013105 Bacteria 554908
92 Ga0157372_10032871 3300013307 Bacteria 5692
93 Ga0157372_10044530 3300013307 Bacteria 4918
94 Ga0157372_10187043 3300013307 Bacteria 2398
95 Ga0157375_10258727 3300013308 Bacteria 1902
96 Ga0163163_10000112 3300014325 Bacteria 86324
97 Ga0182008_10009917 3300014497 Bacteria 5122
98 Ga0182008_10023673 3300014497 Bacteria 3133
99 Ga0182006_1000061 3300015261 Bacteria 156823
100 Ga0182006_1001728 3300015261 Bacteria 12678
101 Ga0182006_1015276 3300015261 Bacteria 3292
102 Ga0182007_10000060 3300015262 Bacteria 88258
103 Ga0182007_10013323 3300015262 Bacteria 3138
104 Ga0182005_1000036 3300015265 Bacteria 166586
105 Ga0182005_1003873 3300015265 Bacteria 4964
106 Ga0182005_1006090 3300015265 Bacteria 3718
107 Ga0183369_1018 3300015685 Bacteria 117953
108 Ga0183360_10001 3300015689 Bacteria 3943671
109 Ga0163161_10034000 3300017792 Bacteria 3645
110 Ga0209784_100104 3300025224 Bacteria 98272
111 Ga0209674_100012 3300025226 Bacteria 950162
112 Ga0209674_101068 3300025226 Bacteria 8241
113 Ga0209672_100765 3300025228 Bacteria 15441
114 Ga0207427_100070 3300025231 Bacteria 160908
115 Ga0209437_100059 3300025233 Bacteria 355048
116 Ga0209258_100027 3300025242 Bacteria 518449
117 Ga0209258_100383 3300025242 Bacteria 56544
118 Ga0207425_1002601 3300025245 Bacteria 6257
119 Ga0209026_1000176 3300025250 Bacteria 97745
120 Ga0209026_1000319 3300025250 Bacteria 51342
121 Ga0209148_1000001 3300025254 Bacteria 2545271
122 Ga0209148_1001818 3300025254 Bacteria 8986
123 Ga0209759_1000333 3300025256 Bacteria 62095
124 Ga0209759_1004858 3300025256 Bacteria 4883
125 Ga0209129_1001030 3300025258 Bacteria 16563
126 Ga0209233_1000002 3300025261 Bacteria 2501366
127 Ga0209565_1000001 3300025263 Bacteria 2950419
128 Ga0209565_1000472 3300025263 Bacteria 29961
129 Ga0209455_1000019 3300025272 Bacteria 705658
130 Ga0209455_1000297 3300025272 Bacteria 51750
131 Ga0209455_1004208 3300025272 Bacteria 4799
132 Ga0209673_1000001 3300025273 Bacteria 3176258
133 Ga0209673_1000032 3300025273 Bacteria 339956
134 Ga0209675_1000001 3300025291 Bacteria 2950293
135 Ga0209675_1000020 3300025291 Bacteria 335854
136 Ga0209676_1000027 3300025292 Bacteria 560222
137 Ga0209676_1000131 3300025292 Bacteria 185298
138 Ga0209676_1000504 3300025292 Bacteria 61740
139 Ga0209676_1005322 3300025292 Bacteria 6780
140 Ga0209025_1000006 3300025294 Bacteria 1153444
141 Ga0209564_1000001 3300025295 Bacteria 3176258
142 Ga0209564_1000210 3300025295 Bacteria 133323
143 Ga0209758_1007779 3300025297 Bacteria 7171
144 Ga0209050_1001000 3300025298 Bacteria 35489
145 Ga0209050_1002093 3300025298 Bacteria 18293
146 Ga0209050_1027340 3300025298 Bacteria 1882
147 Ga0209256_1000006 3300025299 Bacteria 1250310
148 Ga0209256_1002997 3300025299 Bacteria 12541
149 Ga0207426_1009164 3300025302 Bacteria 3935
150 Ga0209051_1001179 3300025303 Bacteria 23669
151 Ga0209051_1006843 3300025303 Bacteria 6344
152 Ga0209257_1000067 3300025304 Bacteria 342468
153 Ga0209257_1000086 3300025304 Bacteria 287437
154 Ga0209257_1010724 3300025304 Bacteria 4566
155 Ga0207713_1022864 3300025735 Bacteria 2956
156 Ga0207680_10000079 3300025903 Bacteria 43755
157 Ga0207680_10094148 3300025903 Bacteria 1912
158 Ga0207647_10031291 3300025904 Bacteria 3425
159 Ga0207645_10020993 3300025907 Bacteria 4265
160 Ga0207645_10075980 3300025907 Bacteria 2151
161 Ga0207705_10136557 3300025909 Bacteria 1829
162 Ga0207705_10214424 3300025909 Bacteria 1461
163 Ga0207707_10003984 3300025912 Bacteria 13111
164 Ga0207695_10011712 3300025913 Bacteria 10596
165 Ga0207695_10012900 3300025913 Bacteria 10000
166 Ga0207671_10000359 3300025914 Bacteria 64927
167 Ga0207671_10086850 3300025914 Bacteria 2352
168 Ga0207649_10065937 3300025920 Bacteria 2293
169 Ga0207652_10053967 3300025921 Bacteria 3454
170 Ga0207681_10016143 3300025923 Bacteria 4665
171 Ga0207694_10037137 3300025924 Bacteria 3739
172 Ga0207709_10000792 3300025935 Bacteria 24662
173 Ga0207691_10174061 3300025940 Bacteria 1883
174 Ga0207667_10012250 3300025949 Bacteria 9901
175 Ga0207667_10033866 3300025949 Bacteria 5488
176 Ga0207667_10142195 3300025949 Bacteria 2471
177 Ga0207712_10065451 3300025961 Bacteria 2594
178 Ga0207668_10010152 3300025972 Bacteria 5678
179 Ga0207658_10035340 3300025986 Bacteria 3578
180 Ga0207639_10000176 3300026041 Bacteria 49992
181 Ga0207639_10111385 3300026041 Bacteria 2231
182 Ga0207678_10012594 3300026067 Bacteria 7430
183 Ga0207678_10013058 3300026067 Bacteria 7287
184 Ga0207678_10042472 3300026067 Bacteria 3938
185 Ga0207678_10124808 3300026067 Bacteria 2196
186 Ga0207702_10000107 3300026078 Bacteria 96024
187 Ga0207674_10182183 3300026116 Bacteria 2052
188 Ga0209371_1000028 3300027312 Bacteria 429688
189 Ga0209969_1002097 3300027360 Bacteria 2749
190 Ga0209970_1002461 3300027614 Bacteria 3148
191 Ga0209983_1000734 3300027665 Bacteria 7112
192 Ga0209971_1001937 3300027682 Bacteria 5057
193 Ga0209974_10042334 3300027876 Bacteria 1516
194 Ga0268266_10000001 3300028379 Bacteria 4040580
195 Ga0268266_10005932 3300028379 Bacteria 11295
196 Ga0268266_10078558 3300028379 Bacteria 2872
197 Ga0268264_10030396 3300028381 Bacteria 4427
198 Ga0268256_1000030 3300030500 Bacteria 429688
199 Ga0316177_1040214 3300030731 Bacteria 12983
200 Ga0314311_1098321 3300030733 Bacteria 10159
201 Ga0316183_1105932 3300030742 Bacteria 3008
202 Ga0316181_1094610 3300030744 Bacteria 7507
203 Ga0307405_10033582 3300031731 Bacteria 3045
204 Ga0307413_10028043 3300031824 Bacteria 3129
205 Ga0307406_10018163 3300031901 Bacteria 4104
206 Ga0307406_10061589 3300031901 Bacteria 2424
207 Ga0307412_10000319 3300031911 Bacteria 30279
208 Ga0307416_100089283 3300032002 Bacteria 2638
209 Ga0373937_0052459 3300036401 Bacteria 3739
210 Ga0373937_0237512 3300036401 Bacteria 1717
211 Ga0395901_0227674 3300038443 Bacteria 1947
212 Ga0436363_0729791 3300039450 Bacteria 2009
213 Ga0439436_0000021 3300041404 Bacteria 62628
214 Ga0439436_0015208 3300041404 Bacteria 2315
215 Ga0439465_0003513 3300041413 Bacteria 5107
216 Ga0451791_1003617 3300041451 Bacteria 1653
217 Ga0451791_1193227 3300041451 Bacteria 1822
218 Ga0451793_1023124 3300041452 Bacteria 2568
219 Ga0439449_0000227 3300042007 Bacteria 20167
220 Ga0439449_0042348 3300042007 Bacteria 1692
221 Ga0450908_000016 3300042184 Bacteria 40435
222 Ga0451577_0008930 3300042876 Bacteria 9698
223 Ga0451577_0020886 3300042876 Bacteria 6002
224 Ga0466982_0000145 3300044672 Bacteria 17781
225 Ga0466957_0029495 3300044842 Bacteria 3272
226 Ga0466959_0046838 3300045049 Bacteria 3182
227 Ga0495617_000095 3300046452 Bacteria 62657
228 Ga0495617_000180 3300046452 Bacteria 39999
229 Ga0495591_031729 3300046458 Bacteria 1582
230 Ga0495638_0000148 3300046460 Bacteria 110710
231 Ga0495638_0034170 3300046460 Bacteria 3247
232 Ga0495650_0006734 3300046471 Bacteria 7110
233 Ga0495580_0122879 3300046472 Bacteria 1802
234 Ga0495584_0002653 3300046491 Bacteria 10067
235 Ga0495585_0000007 3300046492 Bacteria 288113
236 Ga0495585_0000594 3300046492 Bacteria 33909
237 Ga0495607_0000174 3300046501 Bacteria 68588
238 Ga0495607_0001907 3300046501 Bacteria 17674
239 Ga0495583_0025712 3300046506 Bacteria 2935
240 Ga0495606_0002541 3300046507 Bacteria 20989
241 Ga0495606_0005153 3300046507 Bacteria 12662
242 Ga0495606_0005167 3300046507 Bacteria 12623
243 Ga0495606_0081820 3300046507 Bacteria 2006
244 Ga0495610_0000671 3300046512 Bacteria 33278
245 Ga0495610_0011559 3300046512 Bacteria 5387
246 Ga0495616_0000138 3300046513 Bacteria 63336
247 Ga0495620_0001688 3300046515 Bacteria 13020
248 Ga0495630_0097997 3300046517 Bacteria 2218
249 Ga0495631_0000155 3300046518 Bacteria 46741
250 Ga0495631_0001090 3300046518 Bacteria 16858
251 Ga0495631_0009002 3300046518 Bacteria 5003
252 Ga0495632_0000010 3300046519 Bacteria 272360
253 Ga0495632_0024181 3300046519 Bacteria 3232
254 Ga0495632_0037782 3300046519 Bacteria 2447
255 Ga0495643_0015993 3300046522 Bacteria 4416
256 Ga0495648_0002270 3300046524 Bacteria 17952
257 Ga0495648_0004357 3300046524 Bacteria 12121
258 Ga0495665_0019636 3300046531 Bacteria 3635
259 Ga0495609_0052893 3300046538 Bacteria 1806
260 Ga0495668_0000926 3300046616 Bacteria 32744
261 Ga0495668_0004215 3300046616 Bacteria 10353
262 Ga0495611_0000003 3300046648 Bacteria 395679
263 Ga0495611_0000018 3300046648 Bacteria 126654
264 Ga0495625_0000019 3300046660 Bacteria 298330
265 Ga0495625_0060532 3300046660 Bacteria 2682
266 Ga0495661_0003388 3300046665 Bacteria 11794
267 Ga0495661_0086097 3300046665 Bacteria 1799
268 Ga0495670_0000442 3300046691 Bacteria 19863
269 Ga0495670_0081329 3300046691 Bacteria 1650
270 Ga0495671_0000302 3300046692 Bacteria 41650
271 Ga0495649_0010211 3300046694 Bacteria 5546
272 Ga0495589_0000018 3300046794 Bacteria 204851
273 Ga0495660_0001184 3300046810 Bacteria 18377
274 Ga0495660_0001856 3300046810 Bacteria 13868
275 Ga0495604_0116411 3300047317 Bacteria 1941
276 Ga0495636_0023319 3300047318 Bacteria 2504
277 Ga0495672_0009144 3300047320 Bacteria 7220
278 Ga0495683_0000553 3300047323 Bacteria 28262
279 Ga0495679_000017 3300047446 Bacteria 263230
280 Ga0495673_0000004 3300047469 Bacteria 1354526
281 Ga0495673_0000133 3300047469 Bacteria 137275
282 Ga0495673_0003057 3300047469 Bacteria 11246
283 Ga0495684_0257305 3300047471 Bacteria 1268
284 Ga0495686_0002099 3300047472 Bacteria 19541
285 Ga0495686_0015913 3300047472 Bacteria 5114
286 Ga0495686_0028587 3300047472 Bacteria 3630
287 Ga0495686_0030439 3300047472 Bacteria 3504
288 Ga0495686_0079274 3300047472 Bacteria 2008
289 Ga0496100_0002729 3300048903 Bacteria 9025
290 Ga0496101_0000877 3300048904 Bacteria 17755
291 Ga0496104_0000012 3300048907 Bacteria 438011
292 Ga0496105_0000032 3300048908 Bacteria 135801
293 Ga0496106_0027176 3300048909 Bacteria 4262
294 Ga0496114_0025843 3300048917 Bacteria 4803
295 Ga0496115_0000238 3300048918 Bacteria 50050
296 Ga0496117_0005782 3300048920 Bacteria 12843
297 Ga0496117_0060375 3300048920 Bacteria 2613
298 Ga0496117_0071272 3300048920 Bacteria 2330
299 Ga0496118_0001472 3300048921 Bacteria 35272
300 Ga0496118_0002643 3300048921 Bacteria 23743
301 Ga0496118_0032705 3300048921 Bacteria 4278
302 Ga0496118_0079819 3300048921 Bacteria 2306
303 Ga0496119_0001231 3300048922 Bacteria 31897
304 Ga0496119_0006095 3300048922 Bacteria 11296
305 Ga0496120_0001157 3300048923 Bacteria 33802
306 Ga0496121_0001734 3300048924 Bacteria 35607
307 Ga0496121_0007865 3300048924 Bacteria 12751
308 Ga0496121_0008057 3300048924 Bacteria 12553
309 Ga0496121_0042398 3300048924 Bacteria 3959
310 Ga0496122_0001411 3300048925 Bacteria 38913
311 Ga0496122_0004502 3300048925 Bacteria 17220
312 Ga0496122_0048046 3300048925 Bacteria 3287
313 Ga0496123_0016332 3300048926 Bacteria 6038
314 Ga0496123_0042234 3300048926 Bacteria 3150
315 Ga0496124_0000034 3300048927 Bacteria 325332
316 Ga0496124_0005234 3300048927 Bacteria 14713
317 Ga0496124_0041038 3300048927 Bacteria 3997
318 Ga0496124_0183748 3300048927 Bacteria 1606
319 Ga0496125_0056132 3300048928 Bacteria 3201
320 Ga0496126_0017717 3300048929 Bacteria 7094
321 Ga0496126_0019989 3300048929 Bacteria 6579
322 Ga0496126_0128836 3300048929 Bacteria 2188
323 Ga0495678_000152 3300049459 Bacteria 83891
324 Ga0495682_0016115 3300049460 Bacteria 2827
325 Ga0501031_0003742 3300049568 Bacteria 9787
326 Ga0501032_0017448 3300049569 Bacteria 5042
327 Ga0501032_0018854 3300049569 Bacteria 4827
328 Ga0501032_0075720 3300049569 Bacteria 2241
329 Ga0501032_0076900 3300049569 Bacteria 2222
330 Ga0501032_0109522 3300049569 Bacteria 1828
331 Ga0501033_0002131 3300049570 Bacteria 17126
332 Ga0501033_0021783 3300049570 Bacteria 4836
333 Ga0501033_0044052 3300049570 Bacteria 3322
334 Ga0501033_0109409 3300049570 Bacteria 2012
335 Ga0501034_0002718 3300049571 Bacteria 20823
336 Ga0501034_0002883 3300049571 Bacteria 19992
337 Ga0501034_0004129 3300049571 Bacteria 16267
338 Ga0501034_0010416 3300049571 Bacteria 9689
339 Ga0501034_0011035 3300049571 Bacteria 9379
340 Ga0501034_0015965 3300049571 Bacteria 7708
341 Ga0501034_0024779 3300049571 Bacteria 6104
342 Ga0501034_0085046 3300049571 Bacteria 3165
343 Ga0501034_0385137 3300049571 Bacteria 1327
344 Ga0501036_0058954 3300049572 Bacteria 3253
345 Ga0501036_0267270 3300049572 Bacteria 1432
346 Ga0501037_0000579 3300049573 Bacteria 28821
347 Ga0501037_0021687 3300049573 Bacteria 4750
348 Ga0501038_0001595 3300049574 Bacteria 21052
349 Ga0501038_0020608 3300049574 Bacteria 5926
350 Ga0501043_0041076 3300049579 Bacteria 3634
351 Ga0501043_0045954 3300049579 Bacteria 3433
352 Ga0501043_0067393 3300049579 Bacteria 2810
353 Ga0501043_0078821 3300049579 Bacteria 2588
354 Ga0501046_0094718 3300049580 Bacteria 2294
355 Ga0501046_0143190 3300049580 Bacteria 1807
356 Ga0501047_0003228 3300049581 Bacteria 15454
357 Ga0501047_0003250 3300049581 Bacteria 15415
358 Ga0501047_0003474 3300049581 Bacteria 14889
359 Ga0501047_0078126 3300049581 Bacteria 3183
360 Ga0501048_0004712 3300049582 Bacteria 10385
361 Ga0501048_0014302 3300049582 Bacteria 5877
362 Ga0501067_0002904 3300049583 Bacteria 9439
363 Ga0501068_0019531 3300049584 Bacteria 3938
364 Ga0501069_0005784 3300049585 Bacteria 6442
365 Ga0501069_0089354 3300049585 Bacteria 1742
366 Ga0501070_0026146 3300049586 Bacteria 4898
367 Ga0501070_0027451 3300049586 Bacteria 4775
368 Ga0501070_0196536 3300049586 Bacteria 1656
369 Ga0501072_0001407 3300049588 Bacteria 18110
370 Ga0501073_0000954 3300049589 Bacteria 20809
371 Ga0501073_0002283 3300049589 Bacteria 14338
372 Ga0501073_0024233 3300049589 Bacteria 4357
373 Ga0501074_0034952 3300049590 Bacteria 3642
374 Ga0501079_0136429 3300049741 Bacteria 1910
375 Ga0501080_0000256 3300049742 Bacteria 40148
376 Ga0501080_0008223 3300049742 Bacteria 9445
377 Ga0501080_0011116 3300049742 Bacteria 8238
378 Ga0501080_0132816 3300049742 Bacteria 2304
379 Ga0501083_0000332 3300049744 Bacteria 29936
380 Ga0501083_0085144 3300049744 Bacteria 2092
381 Ga0501035_0000961 3300049822 Bacteria 30452
382 Ga0501035_0096055 3300049822 Bacteria 2604
383 Ga0501044_0004979 3300049823 Bacteria 14859
384 Ga0501044_0011093 3300049823 Bacteria 9773
385 Ga0500643_000029 3300053087 Bacteria 211149
386 Ga0500651_0000068 3300053093 Bacteria 67573
387 Ga0500651_0005207 3300053093 Bacteria 7403
388 Ga0500555_001154 3300053103 Bacteria 8695
389 Ga0500568_0000810 3300053139 Bacteria 21989
390 Ga0500633_0060481 3300053160 Bacteria 1331
391 Ga0500634_0000078 3300053161 Bacteria 37746
392 Ga0500645_000316 3300053730 Bacteria 34428
393 Ga0501084_0037085 3300054114 Bacteria 4073
394 Ga0500661_016272 3300055283 Bacteria 1330
395 Ga0501082_0001492 3300060353 Bacteria 20590
396 Ga0501082_0024404 3300060353 Bacteria 5213
397 2572254803 2571042365 Bacteria 3289345
398 2578459668 2576861471 Bacteria 4648976
399 2595447434 2593339238 Bacteria 4182970
400 2595450202 2593339239 Bacteria 4124669
401 2643905332 2643221579 Bacteria 4443405
402 2643915012 2643221581 Bacteria 3893603
403 2643973032 2643221593 Bacteria 6296053
404 2644530536 2643221695 Bacteria 3441323
405 2721025936 2718218334 Bacteria 4765486
406 2735834100 2734482264 Unclassified 5014763
407 2739225510 2738543009 Bacteria 4944499
408 2747950874 2747842428 Bacteria 4689383
409 2765577638 2765235840 Bacteria 4663337
410 2816519415 2816332141 Bacteria 4436036
411 2842392641 2842391507 Bacteria 4486072
412 2842759595 2842757796 Bacteria 3981385
413 2842781946 2842780639 Bacteria 4337790
414 2842917833 2842914999 Bacteria 4419378
415 2842920512 2842918807 Bacteria 4289178
416 2852652963 2852649853 Bacteria 4036942
417 2857444455 2857442823 Bacteria 4562550
418 2874224495 2874220319 Bacteria 4594709
419 2884412610 2884411467 Bacteria 5246714
420 2895499481 2895498888 Bacteria 5283788
421 2895512503 2895511927 Bacteria 6802080
422 2895522514 2895522137 Bacteria 3284416
423 2895525720 2895525241 Bacteria 3388457
424 2919086039 2919085039 Bacteria 4532964
425 2919091509 2919089067 Bacteria 4560942
426 2919135080 2919134579 Bacteria 4480386
427 2919406751 2919404418 Bacteria 4232372
428 2923517444 2923516293 Bacteria 3716336
429 2928498840 2928496128 Bacteria 4631123
430 2931382099 2931380184 Bacteria 4455911
431 2937611140 2937610967 Bacteria 4618818
432 2939592535 2939589442 Bacteria 4214238
433 2939624870 2939622612 Bacteria 4698046
434 2939628785 2939626828 Bacteria 4695272
435 2941477417 2941475908 Bacteria 4145589
436 2941492281 2941489479 Bacteria 6313767
437 2953995796 2953994433 Bacteria 4303959
438 2961051259 2961047084 Bacteria 4594415
439 2961065546 2961064222 Bacteria 4749990
440 2974310109 2974307012 Bacteria 4172388
441 2977250843 2977247770 Bacteria 4160543
442 2984514670 2984514374 Bacteria 4172479
443 2987608082 2987605356 Bacteria 4187822
444 2995949949 2995948881 Bacteria 6358104
445 8002871205 8002869464 Bacteria 3588529
446 Ga0070669_100021348
447 SwRhRL2b_contig_2863456
448 JGI24744J21845_10007693
449 JGI25156J39149_1009976
450 JGI25162J39368_1001140
451 JGI25157J39369_1000133
452 JGI25157J39369_1000314
453 JGI25163J39215_1000210
454 JGI25164J39214_1000075
455 JGI25151J46595_10000048
456 JGI25165J46597_1000178
457 rootH2_10015921
458 rootH1_10218632
459 Ga0006562J51391_1000525
460 Ga0055538_1000590
461 Ga0055535_1000350
462 Ga0055542_1001122
463 Ga0055529_1000153
464 Ga0055526_1000005
465 Ga0055526_1002585
466 Ga0055537_1000270
467 Ga0055537_1000884
468 Ga0055524_1000005
469 Ga0055536_1002013
470 Ga0055536_1012163
471 Ga0055534_1000002
472 Ga0055534_1000187
473 Ga0055528_1000002
474 Ga0055528_1001833
475 Ga0055530_10005809
476 Ga0055530_10005825
477 Ga0055531_10005465
478 Ga0058692_1000037
479 Ga0065704_10073655
480 Ga0065715_10158516
481 Ga0070658_10289344
482 Ga0070676_10083494
483 Ga0070670_100162986
484 Ga0068869_100122561
485 Ga0070666_10000888
486 Ga0070682_100159267
487 Ga0070661_100096982
488 Ga0070668_100002651
489 Ga0070674_100117884
490 Ga0070667_100007577
491 Ga0070667_100153889
492 Ga0070667_100240922
493 Ga0070663_100222727
494 Ga0070678_100120830
495 Ga0070681_10143216
496 Ga0068853_100001171
497 Ga0068853_100001415
498 Ga0070696_100001750
499 Ga0070665_100000092
500 Ga0070665_100054405
501 Ga0070665_100236214
502 Ga0070665_100271902
503 Ga0068855_100001101
504 Ga0068855_100025589
505 Ga0068855_100059306
506 Ga0068857_100021270
507 Ga0068857_100074018
508 Ga0068856_100000495
509 Ga0068856_100260708
510 Ga0068870_10032132
511 Ga0068863_100029737
512 Ga0068860_100004984
513 Ga0075364_10047426
514 Ga0075369_10045434
515 Ga0097621_100051897
516 Ga0068865_100001698
517 Ga0105251_10007819
518 Ga0105244_10060732
519 Ga0105240_10019583
520 Ga0105247_10031840
521 Ga0105243_10008935
522 Ga0105242_10006944
523 Ga0105237_10000815
524 Ga0105238_10102813
525 Ga0105249_10061484
526 Ga0105249_10127612
527 Ga0105239_10007047
528 Ga0105239_10020846
529 Ga0105239_10028570
530 Ga0105239_10176674
531 Ga0157371_10004820
532 Ga0157370_10024112
533 Ga0157370_10038753
534 Ga0157370_10088014
535 Ga0157370_10313747
536 Ga0157369_10000001
537 Ga0157372_10032871
538 Ga0157372_10044530
539 Ga0157372_10187043
540 Ga0157375_10258727
541 Ga0163163_10000112
542 Ga0182008_10009917
543 Ga0182008_10023673
544 Ga0182006_1000061
545 Ga0182006_1001728
546 Ga0182006_1015276
547 Ga0182007_10000060
548 Ga0182007_10013323
549 Ga0182005_1000036
550 Ga0182005_1003873
551 Ga0182005_1006090
552 Ga0183369_1018
553 Ga0183360_10001
554 Ga0163161_10034000
555 Ga0209784_100104
556 Ga0209674_100012
557 Ga0209674_101068
558 Ga0209672_100765
559 Ga0207427_100070
560 Ga0209437_100059
561 Ga0209258_100027
562 Ga0209258_100383
563 Ga0207425_1002601
564 Ga0209026_1000176
565 Ga0209026_1000319
566 Ga0209148_1000001
567 Ga0209148_1001818
568 Ga0209759_1000333
569 Ga0209759_1004858
570 Ga0209129_1001030
571 Ga0209233_1000002
572 Ga0209565_1000001
573 Ga0209565_1000472
574 Ga0209455_1000019
575 Ga0209455_1000297
576 Ga0209455_1004208
577 Ga0209673_1000001
578 Ga0209673_1000032
579 Ga0209675_1000001
580 Ga0209675_1000020
581 Ga0209676_1000027
582 Ga0209676_1000131
583 Ga0209676_1000504
584 Ga0209676_1005322
585 Ga0209025_1000006
586 Ga0209564_1000001
587 Ga0209564_1000210
588 Ga0209758_1007779
589 Ga0209050_1001000
590 Ga0209050_1002093
591 Ga0209050_1027340
592 Ga0209256_1000006
593 Ga0209256_1002997
594 Ga0207426_1009164
595 Ga0209051_1001179
596 Ga0209051_1006843
597 Ga0209257_1000067
598 Ga0209257_1000086
599 Ga0209257_1010724
600 Ga0207713_1022864
601 Ga0207680_10000079
602 Ga0207680_10094148
603 Ga0207647_10031291
604 Ga0207645_10020993
605 Ga0207645_10075980
606 Ga0207705_10136557
607 Ga0207705_10214424
608 Ga0207707_10003984
609 Ga0207695_10011712
610 Ga0207695_10012900
611 Ga0207671_10000359
612 Ga0207671_10086850
613 Ga0207649_10065937
614 Ga0207652_10053967
615 Ga0207681_10016143
616 Ga0207694_10037137
617 Ga0207709_10000792
618 Ga0207691_10174061
619 Ga0207667_10012250
620 Ga0207667_10033866
621 Ga0207667_10142195
622 Ga0207712_10065451
623 Ga0207668_10010152
624 Ga0207658_10035340
625 Ga0207639_10000176
626 Ga0207639_10111385
627 Ga0207678_10012594
628 Ga0207678_10013058
629 Ga0207678_10042472
630 Ga0207678_10124808
631 Ga0207702_10000107
632 Ga0207674_10182183
633 Ga0209371_1000028
634 Ga0209969_1002097
635 Ga0209970_1002461
636 Ga0209983_1000734
637 Ga0209971_1001937
638 Ga0209974_10042334
639 Ga0268266_10000001
640 Ga0268266_10005932
641 Ga0268266_10078558
642 Ga0268264_10030396
643 Ga0268256_1000030
644 Ga0316177_1040214
645 Ga0314311_1098321
646 Ga0316183_1105932
647 Ga0316181_1094610
648 Ga0307405_10033582
649 Ga0307413_10028043
650 Ga0307406_10018163
651 Ga0307406_10061589
652 Ga0307412_10000319
653 Ga0307416_100089283
654 Ga0373937_0052459
655 Ga0373937_0237512
656 Ga0395901_0227674
657 Ga0436363_0729791
658 Ga0439436_0000021
659 Ga0439436_0015208
660 Ga0439465_0003513
661 Ga0451791_1003617
662 Ga0451791_1193227
663 Ga0451793_1023124
664 Ga0439449_0000227
665 Ga0439449_0042348
666 Ga0450908_000016
667 Ga0451577_0008930
668 Ga0451577_0020886
669 Ga0466982_0000145
670 Ga0466957_0029495
671 Ga0466959_0046838
672 Ga0495617_000095
673 Ga0495617_000180
674 Ga0495591_031729
675 Ga0495638_0000148
676 Ga0495638_0034170
677 Ga0495650_0006734
678 Ga0495580_0122879
679 Ga0495584_0002653
680 Ga0495585_0000007
681 Ga0495585_0000594
682 Ga0495607_0000174
683 Ga0495607_0001907
684 Ga0495583_0025712
685 Ga0495606_0002541
686 Ga0495606_0005153
687 Ga0495606_0005167
688 Ga0495606_0081820
689 Ga0495610_0000671
690 Ga0495610_0011559
691 Ga0495616_0000138
692 Ga0495620_0001688
693 Ga0495630_0097997
694 Ga0495631_0000155
695 Ga0495631_0001090
696 Ga0495631_0009002
697 Ga0495632_0000010
698 Ga0495632_0024181
699 Ga0495632_0037782
700 Ga0495643_0015993
701 Ga0495648_0002270
702 Ga0495648_0004357
703 Ga0495665_0019636
704 Ga0495609_0052893
705 Ga0495668_0000926
706 Ga0495668_0004215
707 Ga0495611_0000003
708 Ga0495611_0000018
709 Ga0495625_0000019
710 Ga0495625_0060532
711 Ga0495661_0003388
712 Ga0495661_0086097
713 Ga0495670_0000442
714 Ga0495670_0081329
715 Ga0495671_0000302
716 Ga0495649_0010211
717 Ga0495589_0000018
718 Ga0495660_0001184
719 Ga0495660_0001856
720 Ga0495604_0116411
721 Ga0495636_0023319
722 Ga0495672_0009144
723 Ga0495683_0000553
724 Ga0495679_000017
725 Ga0495673_0000004
726 Ga0495673_0000133
727 Ga0495673_0003057
728 Ga0495684_0257305
729 Ga0495686_0002099
730 Ga0495686_0015913
731 Ga0495686_0028587
732 Ga0495686_0030439
733 Ga0495686_0079274
734 Ga0496100_0002729
735 Ga0496101_0000877
736 Ga0496104_0000012
737 Ga0496105_0000032
738 Ga0496106_0027176
739 Ga0496114_0025843
740 Ga0496115_0000238
741 Ga0496117_0005782
742 Ga0496117_0060375
743 Ga0496117_0071272
744 Ga0496118_0001472
745 Ga0496118_0002643
746 Ga0496118_0032705
747 Ga0496118_0079819
748 Ga0496119_0001231
749 Ga0496119_0006095
750 Ga0496120_0001157
751 Ga0496121_0001734
752 Ga0496121_0007865
753 Ga0496121_0008057
754 Ga0496121_0042398
755 Ga0496122_0001411
756 Ga0496122_0004502
757 Ga0496122_0048046
758 Ga0496123_0016332
759 Ga0496123_0042234
760 Ga0496124_0000034
761 Ga0496124_0005234
762 Ga0496124_0041038
763 Ga0496124_0183748
764 Ga0496125_0056132
765 Ga0496126_0017717
766 Ga0496126_0019989
767 Ga0496126_0128836
768 Ga0495678_000152
769 Ga0495682_0016115
770 Ga0501031_0003742
771 Ga0501032_0017448
772 Ga0501032_0018854
773 Ga0501032_0075720
774 Ga0501032_0076900
775 Ga0501032_0109522
776 Ga0501033_0002131
777 Ga0501033_0021783
778 Ga0501033_0044052
779 Ga0501033_0109409
780 Ga0501034_0002718
781 Ga0501034_0002883
782 Ga0501034_0004129
783 Ga0501034_0010416
784 Ga0501034_0011035
785 Ga0501034_0015965
786 Ga0501034_0024779
787 Ga0501034_0085046
788 Ga0501034_0385137
789 Ga0501036_0058954
790 Ga0501036_0267270
791 Ga0501037_0000579
792 Ga0501037_0021687
793 Ga0501038_0001595
794 Ga0501038_0020608
795 Ga0501043_0041076
796 Ga0501043_0045954
797 Ga0501043_0067393
798 Ga0501043_0078821
799 Ga0501046_0094718
800 Ga0501046_0143190
801 Ga0501047_0003228
802 Ga0501047_0003250
803 Ga0501047_0003474
804 Ga0501047_0078126
805 Ga0501048_0004712
806 Ga0501048_0014302
807 Ga0501067_0002904
808 Ga0501068_0019531
809 Ga0501069_0005784
810 Ga0501069_0089354
811 Ga0501070_0026146
812 Ga0501070_0027451
813 Ga0501070_0196536
814 Ga0501072_0001407
815 Ga0501073_0000954
816 Ga0501073_0002283
817 Ga0501073_0024233
818 Ga0501074_0034952
819 Ga0501079_0136429
820 Ga0501080_0000256
821 Ga0501080_0008223
822 Ga0501080_0011116
823 Ga0501080_0132816
824 Ga0501083_0000332
825 Ga0501083_0085144
826 Ga0501035_0000961
827 Ga0501035_0096055
828 Ga0501044_0004979
829 Ga0501044_0011093
830 Ga0500643_000029
831 Ga0500651_0000068
832 Ga0500651_0005207
833 Ga0500555_001154
834 Ga0500568_0000810
835 Ga0500633_0060481
836 Ga0500634_0000078
837 Ga0500645_000316
838 Ga0501084_0037085
839 Ga0500661_016272
840 Ga0501082_0001492
841 Ga0501082_0024404
842 2572254803
843 2578459668
844 2595447434
845 2595450202
846 2643905332
847 2643915012
848 2643973032
849 2644530536
850 2721025936
851 2735834100
852 2739225510
853 2747950874
854 2765577638
855 2816519415
856 2842392641
857 2842759595
858 2842781946
859 2842917833
860 2842920512
861 2852652963
862 2857444455
863 2874224495
864 2884412610
865 2895499481
866 2895512503
867 2895522514
868 2895525720
869 2919086039
870 2919091509
871 2919135080
872 2919406751
873 2923517444
874 2928498840
875 2931382099
876 2937611140
877 2939592535
878 2939624870
879 2939628785
880 2941477417
881 2941492281
882 2953995796
883 2961051259
884 2961065546
885 2974310109
886 2977250843
887 2984514670
888 2987608082
889 2995949949
890 8002871205

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01098

FTSW_RODA_SPOVE

Cell cycle protein

36

394

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bh1-assembly1.cif.gz_A core divisome complex ftswiqbl from pseudomonas aeruginosa 0.86 22 355
8bh1-assembly1.cif.gz_A core divisome complex ftswiqbl from pseudomonas aeruginosa 0.8251 22 355
6bas-assembly1.cif.gz_A crystal structure of thermus thermophilus rod shape determining protein roda d255a mutant (q5six3_thet8) 0.7872 18 352
6bar-assembly1.cif.gz_A crystal structure of thermus thermophilus rod shape determining protein roda (q5six3_thet8) 0.7755 18 352
6bas-assembly1.cif.gz_A crystal structure of thermus thermophilus rod shape determining protein roda d255a mutant (q5six3_thet8) 0.7629 18 352
ID Description Score Start End Superfamily
af_A0A1D6G0W5_39_200_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.3383 259 383 3.90.1010.10
af_A0A2R8RK24_6_216_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.2856 51 360 1.20.1070.10
af_A0A2R8RK24_6_216_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.2801 51 360 1.20.1070.10
4iggA06 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.2764 189 387 1.20.120.230
4iggA06 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.2699 189 387 1.20.120.230
ID Description Score Start End GO Terms
AF-A0A0Q0FDG7-F1-model_v4 Probable peptidoglycan glycosyltransferase FtsW (PGT) (EC 2.4.99.28) (Cell division protein FtsW) (Cell wall polymerase) (Peptidoglycan polymerase) (PG polymerase) 0.9253 14 358 GO:0005886
GO:0008360
GO:0008955
GO:0009252
GO:0015648
GO:0032153
GO:0043093
GO:0071555
AF-A0A3B0YAK4-F1-model_v4 peptidoglycan glycosyltransferase (EC 2.4.99.28) (Peptidoglycan polymerase) 0.9193 17 360 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0016757
GO:0032153
GO:0051301
GO:0071555
AF-A0A534CIX8-F1-model_v4 Probable peptidoglycan glycosyltransferase FtsW (PGT) (EC 2.4.99.28) (Cell division protein FtsW) (Cell wall polymerase) (Peptidoglycan polymerase) (PG polymerase) 0.9155 35 368 GO:0005886
GO:0008360
GO:0008955
GO:0009252
GO:0015648
GO:0032153
GO:0043093
GO:0071555
AF-A0A556W949-F1-model_v4 Probable peptidoglycan glycosyltransferase FtsW (PGT) (EC 2.4.99.28) (Cell division protein FtsW) (Cell wall polymerase) (Peptidoglycan polymerase) (PG polymerase) 0.9152 18 357 GO:0005886
GO:0008360
GO:0008955
GO:0009252
GO:0015648
GO:0032153
GO:0043093
GO:0071555
AF-A0A1W1CQC5-F1-model_v4 peptidoglycan glycosyltransferase (EC 2.4.99.28) (Peptidoglycan polymerase) 0.9144 37 356 GO:0005886
GO:0008360
GO:0009252
GO:0015648
GO:0016757
GO:0032153
GO:0051301
GO:0071555

Map