F445448

General Info

Members Datasets Scaffolds Average Seq Length
445 268 445 105

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100242578|Ga0070698_1002425782
Length 123
Sequence VRGVDIPAVYLEHLGMSADFKRGHLDLLILSVLARGPLHGYAAIAALRDRSGGLFDLAEGTVYPALHRLERVGLIASEWERASGRKRCRYALTKTGHAALARQTTQWRRWSGGLNMVLGWSGK

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
145 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
146 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
147 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
148 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
149 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
165 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
166 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
167 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
168 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
169 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
170 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
171 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
172 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
175 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
176 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
185 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
186 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
189 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
190 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
191 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
192 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
193 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
194 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
198 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
199 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
200 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
201 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
202 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
207 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
210 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
213 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
214 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
215 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
220 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
221 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
224 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
225 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
263 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
264 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
265 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
266 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.89
Rhizosphere 88.09
Stem 0
Stem Tuber 0
Unclassified 2.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_11618391 3300005327 Bacteria 561
2 Ga0070683_100014804 3300005329 Bacteria 6835
3 Ga0070683_100206107 3300005329 Bacteria 1868
4 Ga0070690_100371982 3300005330 Bacteria 1043
5 Ga0070670_101142706 3300005331 Bacteria 711
6 Ga0068869_100017791 3300005334 Bacteria 4828
7 Ga0070680_100214667 3300005336 Bacteria 1623
8 Ga0070682_100024463 3300005337 Bacteria 3594
9 Ga0068868_100274730 3300005338 Bacteria 1424
10 Ga0070660_100011443 3300005339 Bacteria 6305
11 Ga0070689_100056537 3300005340 Bacteria 3043
12 Ga0070689_100506438 3300005340 Bacteria 1035
13 Ga0070691_10035274 3300005341 Bacteria 2355
14 Ga0070661_100122232 3300005344 Bacteria 1951
15 Ga0070661_101247046 3300005344 Bacteria 623
16 Ga0070669_101656173 3300005353 Unclassified 557
17 Ga0070675_100043550 3300005354 Bacteria 3669
18 Ga0070671_100730911 3300005355 Bacteria 860
19 Ga0070673_100182674 3300005364 Bacteria 1796
20 Ga0070673_100634849 3300005364 Unclassified 976
21 Ga0070688_100136236 3300005365 Unclassified 1663
22 Ga0070688_100209485 3300005365 Bacteria 1368
23 Ga0070659_100612005 3300005366 Bacteria 937
24 Ga0070667_100243879 3300005367 Bacteria 1605
25 Ga0070667_100851485 3300005367 Bacteria 848
26 Ga0070703_10038477 3300005406 Bacteria 1479
27 Ga0070714_100340017 3300005435 Bacteria 1407
28 Ga0070714_100827429 3300005435 Bacteria 897
29 Ga0070713_101849476 3300005436 Unclassified 586
30 Ga0070710_10454778 3300005437 Bacteria 869
31 Ga0070701_10857964 3300005438 Bacteria 624
32 Ga0070701_10976890 3300005438 Unclassified 589
33 Ga0070711_100383130 3300005439 Bacteria 1137
34 Ga0070711_100887359 3300005439 Bacteria 760
35 Ga0070711_100955256 3300005439 Bacteria 734
36 Ga0070711_101805243 3300005439 Bacteria 537
37 Ga0070700_100525076 3300005441 Unclassified 915
38 Ga0070708_101145629 3300005445 Bacteria 728
39 Ga0070678_100243661 3300005456 Bacteria 1504
40 Ga0070678_100714825 3300005456 Bacteria 904
41 Ga0070662_100691972 3300005457 Bacteria 862
42 Ga0070681_11697287 3300005458 Bacteria 558
43 Ga0068867_100847455 3300005459 Bacteria 819
44 Ga0070685_10435427 3300005466 Bacteria 915
45 Ga0070685_10623299 3300005466 Bacteria 779
46 Ga0070698_100242578 3300005471 Bacteria 1735
47 Ga0070684_100090621 3300005535 Bacteria 2719
48 Ga0070684_101637243 3300005535 Bacteria 607
49 Ga0068853_100177259 3300005539 Bacteria 1932
50 Ga0068853_100787043 3300005539 Unclassified 910
51 Ga0068853_101810248 3300005539 Bacteria 592
52 Ga0070672_100689148 3300005543 Bacteria 894
53 Ga0070686_100166511 3300005544 Bacteria 1556
54 Ga0070686_100203406 3300005544 Unclassified 1421
55 Ga0070695_100478992 3300005545 Bacteria 959
56 Ga0070696_100429436 3300005546 Bacteria 1039
57 Ga0070693_100036853 3300005547 Bacteria 2722
58 Ga0070665_101076159 3300005548 Bacteria 816
59 Ga0070704_101135194 3300005549 Bacteria 711
60 Ga0068855_101015824 3300005563 Bacteria 871
61 Ga0070664_100715305 3300005564 Bacteria 934
62 Ga0070664_100897600 3300005564 Bacteria 831
63 Ga0070664_102261519 3300005564 Bacteria 516
64 Ga0068857_100038584 3300005577 Bacteria 4230
65 Ga0068854_100317823 3300005578 Bacteria 1264
66 Ga0068856_100004824 3300005614 Bacteria 13366
67 Ga0070702_100024021 3300005615 Bacteria 3246
68 Ga0068852_100616180 3300005616 Bacteria 1091
69 Ga0068852_100892105 3300005616 Unclassified 906
70 Ga0068859_100537601 3300005617 Bacteria 1263
71 Ga0068864_100291430 3300005618 Bacteria 1526
72 Ga0068866_10018861 3300005718 Bacteria 3129
73 Ga0068866_10528390 3300005718 Unclassified 785
74 Ga0068861_100136491 3300005719 Bacteria 1997
75 Ga0068861_100269446 3300005719 Bacteria 1461
76 Ga0068861_100321208 3300005719 Bacteria 1348
77 Ga0068863_100282055 3300005841 Bacteria 1610
78 Ga0068858_100346306 3300005842 Bacteria 1423
79 Ga0068860_100221012 3300005843 Bacteria 1839
80 Ga0068860_101084117 3300005843 Unclassified 820
81 Ga0081455_10001958 3300005937 Bacteria 24724
82 Ga0081455_10038490 3300005937 Bacteria 4235
83 Ga0081539_10001335 3300005985 Bacteria 42960
84 Ga0070717_10402681 3300006028 Bacteria 1229
85 Ga0070717_10777684 3300006028 Bacteria 870
86 Ga0070716_100083892 3300006173 Bacteria 1909
87 Ga0070712_100193602 3300006175 Bacteria 1593
88 Ga0070712_100798879 3300006175 Bacteria 809
89 Ga0070712_101569907 3300006175 Bacteria 575
90 Ga0068871_100169120 3300006358 Bacteria 1872
91 Ga0075430_100261305 3300006846 Bacteria 1434
92 Ga0075434_100001098 3300006871 Bacteria 22182
93 Ga0075429_100242477 3300006880 Bacteria 1579
94 Ga0068865_100311032 3300006881 Bacteria 1264
95 Ga0075436_100014593 3300006914 Bacteria 5384
96 Ga0097620_100537574 3300006931 Bacteria 1263
97 Ga0075435_100013491 3300007076 Bacteria 6080
98 Ga0075435_100517416 3300007076 Bacteria 1032
99 Ga0105245_10148865 3300009098 Bacteria 2212
100 Ga0105245_10213779 3300009098 Bacteria 1857
101 Ga0105245_10263414 3300009098 Bacteria 1678
102 Ga0105245_10723872 3300009098 Bacteria 1029
103 Ga0105247_10029724 3300009101 Bacteria 3312
104 Ga0114129_10333810 3300009147 Bacteria 2012
105 Ga0105243_10007737 3300009148 Bacteria 8262
106 Ga0105243_10157943 3300009148 Bacteria 1952
107 Ga0105243_10929672 3300009148 Bacteria 867
108 Ga0105241_10615228 3300009174 Bacteria 983
109 Ga0105242_10004600 3300009176 Bacteria 10695
110 Ga0105242_10064040 3300009176 Bacteria 3029
111 Ga0105248_10092363 3300009177 Bacteria 3409
112 Ga0105248_10754413 3300009177 Bacteria 1098
113 Ga0105237_11567022 3300009545 Bacteria 666
114 Ga0105238_10106683 3300009551 Bacteria 2783
115 Ga0105249_10243764 3300009553 Bacteria 1778
116 Ga0105249_13586917 3300009553 Unclassified 500
117 Ga0105239_10242882 3300010375 Bacteria 2021
118 Ga0105246_10005561 3300011119 Bacteria 7683
119 Ga0105246_11628393 3300011119 Unclassified 611
120 Ga0157374_10011853 3300013296 Bacteria 7563
121 Ga0157378_10324102 3300013297 Unclassified 1497
122 Ga0157378_10498292 3300013297 Bacteria 1216
123 Ga0163162_10109619 3300013306 Bacteria 2858
124 Ga0157372_10804468 3300013307 Bacteria 1092
125 Ga0157375_10169707 3300013308 Bacteria 2329
126 Ga0157375_13626900 3300013308 Bacteria 513
127 Ga0163163_10067164 3300014325 Bacteria 3564
128 Ga0163163_12405881 3300014325 Unclassified 585
129 Ga0157380_11525643 3300014326 Bacteria 722
130 Ga0182008_10205076 3300014497 Bacteria 1004
131 Ga0157377_10244954 3300014745 Bacteria 1159
132 Ga0157377_10527650 3300014745 Unclassified 830
133 Ga0157377_10972888 3300014745 Bacteria 640
134 Ga0157379_10065585 3300014968 Bacteria 3246
135 Ga0157376_10272270 3300014969 Bacteria 1591
136 Ga0157376_10426079 3300014969 Bacteria 1289
137 Ga0163161_11123798 3300017792 Bacteria 676
138 Ga0207653_10256158 3300025885 Bacteria 672
139 Ga0207692_10591589 3300025898 Bacteria 712
140 Ga0207642_10336242 3300025899 Unclassified 886
141 Ga0207642_10848028 3300025899 Unclassified 583
142 Ga0207710_10017031 3300025900 Bacteria 3079
143 Ga0207688_10019661 3300025901 Bacteria 3681
144 Ga0207688_10226757 3300025901 Unclassified 1127
145 Ga0207680_10367776 3300025903 Bacteria 1012
146 Ga0207699_10112024 3300025906 Bacteria 1750
147 Ga0207705_11100701 3300025909 Bacteria 612
148 Ga0207654_10061197 3300025911 Bacteria 2202
149 Ga0207707_11295194 3300025912 Bacteria 586
150 Ga0207671_10485940 3300025914 Bacteria 984
151 Ga0207671_10990002 3300025914 Bacteria 663
152 Ga0207693_10383723 3300025915 Bacteria 1099
153 Ga0207693_10429113 3300025915 Bacteria 1033
154 Ga0207663_10731261 3300025916 Unclassified 785
155 Ga0207663_10779156 3300025916 Bacteria 761
156 Ga0207663_11151256 3300025916 Bacteria 624
157 Ga0207662_10035000 3300025918 Bacteria 2932
158 Ga0207657_10006452 3300025919 Bacteria 12155
159 Ga0207657_11507247 3300025919 Unclassified 502
160 Ga0207649_11179829 3300025920 Bacteria 605
161 Ga0207694_10558344 3300025924 Bacteria 961
162 Ga0207650_10919927 3300025925 Bacteria 743
163 Ga0207659_10015553 3300025926 Bacteria 4934
164 Ga0207687_10062195 3300025927 Bacteria 2639
165 Ga0207687_10077354 3300025927 Bacteria 2393
166 Ga0207700_10382285 3300025928 Bacteria 1231
167 Ga0207700_10633722 3300025928 Bacteria 953
168 Ga0207664_10720456 3300025929 Bacteria 897
169 Ga0207644_10490449 3300025931 Unclassified 1013
170 Ga0207690_10194406 3300025932 Bacteria 1536
171 Ga0207690_10569824 3300025932 Bacteria 922
172 Ga0207706_10098192 3300025933 Bacteria 2576
173 Ga0207686_10090337 3300025934 Archaea 2020
174 Ga0207709_10336429 3300025935 Bacteria 1135
175 Ga0207709_11541110 3300025935 Unclassified 552
176 Ga0207709_11712778 3300025935 Unclassified 523
177 Ga0207670_10035361 3300025936 Bacteria 3238
178 Ga0207670_11815351 3300025936 Bacteria 518
179 Ga0207704_10234867 3300025938 Bacteria 1366
180 Ga0207704_10504738 3300025938 Unclassified 975
181 Ga0207704_10640435 3300025938 Unclassified 874
182 Ga0207665_10017247 3300025939 Bacteria 4743
183 Ga0207711_10505558 3300025941 Bacteria 1126
184 Ga0207711_10679595 3300025941 Bacteria 960
185 Ga0207689_10023840 3300025942 Bacteria 5134
186 Ga0207661_10042763 3300025944 Bacteria 3573
187 Ga0207679_10132354 3300025945 Unclassified 2003
188 Ga0207679_11437767 3300025945 Bacteria 633
189 Ga0207667_10617259 3300025949 Bacteria 1092
190 Ga0207712_10189257 3300025961 Bacteria 1623
191 Ga0207712_11266136 3300025961 Bacteria 659
192 Ga0207668_10247586 3300025972 Bacteria 1446
193 Ga0207668_10807734 3300025972 Bacteria 831
194 Ga0207640_10196694 3300025981 Bacteria 1524
195 Ga0207658_11077013 3300025986 Bacteria 734
196 Ga0207677_10280796 3300026023 Unclassified 1367
197 Ga0207677_10456192 3300026023 Bacteria 1096
198 Ga0207703_10314567 3300026035 Bacteria 1432
199 Ga0207703_10720672 3300026035 Bacteria 949
200 Ga0207702_10023825 3300026078 Bacteria 5078
201 Ga0207641_10148052 3300026088 Bacteria 2125
202 Ga0207641_11261548 3300026088 Unclassified 739
203 Ga0207648_10004177 3300026089 Bacteria 14926
204 Ga0207676_10132867 3300026095 Bacteria 2119
205 Ga0207674_10008088 3300026116 Bacteria 12192
206 Ga0207675_102477269 3300026118 Unclassified 530
207 Ga0207683_10071762 3300026121 Bacteria 3061
208 Ga0207683_10750112 3300026121 Bacteria 906
209 Ga0207698_10303385 3300026142 Bacteria 1487
210 Ga0207698_10684321 3300026142 Unclassified 1019
211 Ga0268264_10182984 3300028381 Bacteria 1905
212 Ga0307515_10307154 3300028794 Unclassified 1265
213 Ga0373948_0062174 3300034817 Bacteria 822
214 Ga0373926_0115387 3300035083 Bacteria 1010
215 Ga0373944_0012174 3300035089 Bacteria 2367
216 Ga0373953_0049682 3300035117 Bacteria 1693
217 Ga0373954_0664371 3300035118 Bacteria 517
218 Ga0373943_0026839 3300035170 Unclassified 2701
219 Ga0373946_0009647 3300035171 Bacteria 3562
220 Ga0373955_0087215 3300035172 Unclassified 1773
221 Ga0373924_0021839 3300035410 Bacteria 2498
222 Ga0373931_0508732 3300035691 Bacteria 778
223 Ga0373935_0105294 3300035692 Bacteria 1865
224 Ga0373935_0121531 3300035692 Bacteria 1745
225 Ga0373947_0019909 3300035725 Bacteria 3873
226 Ga0373947_0024465 3300035725 Bacteria 3519
227 Ga0373937_0678344 3300036401 Unclassified 976
228 Ga0373925_0032754 3300037068 Bacteria 3826
229 Ga0373925_0732004 3300037068 Bacteria 815
230 Ga0395900_0136623 3300037418 Bacteria 2512
231 Ga0395898_0584689 3300037466 Bacteria 1059
232 Ga0395898_0722331 3300037466 Bacteria 938
233 Ga0436364_0538701 3300037853 Bacteria 2562
234 Ga0436364_1548415 3300037853 Bacteria 798
235 Ga0395901_0085431 3300038443 Bacteria 3299
236 Ga0395901_0404118 3300038443 Bacteria 1403
237 Ga0395901_0538963 3300038443 Unclassified 1184
238 Ga0436365_0540670 3300039437 Bacteria 1020
239 Ga0436365_1927478 3300039437 Bacteria 542
240 Ga0436360_0367638 3300039438 Bacteria 696
241 Ga0436360_1042244 3300039438 Bacteria 2396
242 Ga0451791_0028386 3300041451 Unclassified 649
243 Ga0451793_0598440 3300041452 Bacteria 1480
244 Ga0451800_0554801 3300041459 Bacteria 716
245 Ga0451800_0902753 3300041459 Unclassified 652
246 Ga0451800_1660513 3300041459 Bacteria 597
247 Ga0451853_0491700 3300041512 Bacteria 626
248 Ga0451853_1406054 3300041512 Unclassified 1476
249 Ga0451853_1512758 3300041512 Bacteria 612
250 Ga0451853_3020805 3300041512 Bacteria 2087
251 Ga0466972_0388994 3300044658 Unclassified 653
252 Ga0466972_0423892 3300044658 Unclassified 624
253 Ga0466965_0376457 3300044683 Bacteria 781
254 Ga0466966_0075630 3300044684 Bacteria 2104
255 Ga0466966_0121772 3300044684 Unclassified 1602
256 Ga0466966_0178409 3300044684 Bacteria 1289
257 Ga0466961_0021290 3300044693 Bacteria 4174
258 Ga0466961_0106937 3300044693 Bacteria 1761
259 Ga0466961_0159882 3300044693 Bacteria 1404
260 Ga0466961_0453765 3300044693 Bacteria 776
261 Ga0466961_0784201 3300044693 Bacteria 569
262 Ga0466963_0006485 3300044694 Bacteria 6925
263 Ga0466963_0009386 3300044694 Bacteria 5893
264 Ga0466963_0125653 3300044694 Bacteria 1768
265 Ga0466963_0130678 3300044694 Bacteria 1734
266 Ga0466963_0342260 3300044694 Bacteria 1053
267 Ga0466963_0553779 3300044694 Unclassified 812
268 Ga0466964_0769208 3300044706 Unclassified 542
269 Ga0466971_0013210 3300044719 Bacteria 3625
270 Ga0466971_0051030 3300044719 Bacteria 1862
271 Ga0466971_0312911 3300044719 Bacteria 756
272 Ga0466970_0691069 3300044765 Bacteria 595
273 Ga0466957_0103567 3300044842 Bacteria 1797
274 Ga0466957_0143242 3300044842 Bacteria 1541
275 Ga0466957_0214394 3300044842 Bacteria 1269
276 Ga0466959_0067681 3300045049 Bacteria 2589
277 Ga0466959_0082068 3300045049 Bacteria 2323
278 Ga0466959_0124131 3300045049 Bacteria 1833
279 Ga0466959_0882090 3300045049 Bacteria 597
280 Ga0466958_0036634 3300045836 Bacteria 2937
281 Ga0466958_0047921 3300045836 Bacteria 2580
282 Ga0466958_0107658 3300045836 Bacteria 1739
283 Ga0466958_0424349 3300045836 Unclassified 860
284 Ga0466967_0032794 3300045976 Bacteria 4390
285 Ga0466967_0042536 3300045976 Bacteria 3927
286 Ga0466967_0280753 3300045976 Bacteria 1598
287 Ga0466967_0858812 3300045976 Bacteria 902
288 Ga0466967_1217106 3300045976 Bacteria 750
289 Ga0495592_0424555 3300046454 Bacteria 838
290 Ga0495603_0066235 3300046455 Bacteria 2127
291 Ga0495603_0130825 3300046455 Bacteria 1461
292 Ga0495629_0331330 3300046459 Unclassified 1040
293 Ga0495629_0530730 3300046459 Bacteria 791
294 Ga0495641_0109354 3300046461 Bacteria 1233
295 Ga0495641_0122960 3300046461 Bacteria 1158
296 Ga0495651_0171878 3300046462 Bacteria 1542
297 Ga0495653_0218364 3300046463 Bacteria 1283
298 Ga0495580_0004988 3300046472 Bacteria 11081
299 Ga0495582_0068536 3300046473 Bacteria 1960
300 Ga0495582_0216142 3300046473 Bacteria 1096
301 Ga0495639_0098029 3300046475 Bacteria 1381
302 Ga0495662_0045382 3300046476 Bacteria 2121
303 Ga0495664_0063599 3300046477 Bacteria 2199
304 Ga0495594_0116237 3300046499 Bacteria 1510
305 Ga0495608_0925049 3300046511 Unclassified 509
306 Ga0495618_0146483 3300046514 Bacteria 1509
307 Ga0495628_0365293 3300046516 Bacteria 1059
308 Ga0495630_0290852 3300046517 Bacteria 1248
309 Ga0495666_0011517 3300046526 Bacteria 4410
310 Ga0495652_0545835 3300046529 Bacteria 798
311 Ga0495665_0004476 3300046531 Bacteria 7539
312 Ga0495640_0111913 3300046533 Unclassified 1783
313 Ga0495640_0124402 3300046533 Bacteria 1673
314 Ga0495586_0053352 3300046535 Bacteria 2190
315 Ga0495587_0057944 3300046536 Bacteria 2276
316 Ga0495587_0668687 3300046536 Bacteria 570
317 Ga0495667_0003138 3300046559 Bacteria 11084
318 Ga0495634_0020996 3300046642 Bacteria 4624
319 Ga0495635_0088710 3300046663 Bacteria 2116
320 Ga0495635_0088826 3300046663 Bacteria 2114
321 Ga0495659_0212584 3300046664 Bacteria 796
322 Ga0495588_0628365 3300046674 Bacteria 562
323 Ga0495599_0458159 3300046678 Bacteria 754
324 Ga0495646_0186869 3300046680 Bacteria 1134
325 Ga0495647_0015584 3300046681 Unclassified 2665
326 Ga0495647_0179587 3300046681 Bacteria 920
327 Ga0495658_0043219 3300046683 Bacteria 2519
328 Ga0495658_0051590 3300046683 Bacteria 2330
329 Ga0495658_0434472 3300046683 Unclassified 838
330 Ga0495624_0043330 3300046690 Bacteria 2871
331 Ga0495624_0213044 3300046690 Unclassified 1171
332 Ga0495670_0344256 3300046691 Bacteria 802
333 Ga0495600_0075090 3300046809 Bacteria 2207
334 Ga0495581_0009567 3300047315 Bacteria 5604
335 Ga0495581_0167412 3300047315 Bacteria 1285
336 Ga0495674_0027372 3300047319 Bacteria 5210
337 Ga0495674_0046290 3300047319 Bacteria 3861
338 Ga0495676_0072164 3300047321 Bacteria 2652
339 Ga0495676_0122479 3300047321 Bacteria 1890
340 Ga0495680_0591146 3300047322 Bacteria 744
341 Ga0495675_0115188 3300047444 Unclassified 1676
342 Ga0495684_0001638 3300047471 Bacteria 17976
343 Ga0495593_0036864 3300047673 Unclassified 2648
344 Ga0495602_0612531 3300048088 Archaea 747
345 Ga0495602_0692291 3300048088 Bacteria 692
346 Ga0495614_0095828 3300048089 Bacteria 1293
347 Ga0496100_0216535 3300048903 Bacteria 1403
348 Ga0496100_0588116 3300048903 Bacteria 863
349 Ga0496100_0678464 3300048903 Bacteria 803
350 Ga0496101_0175034 3300048904 Archaea 1650
351 Ga0496101_0635491 3300048904 Bacteria 843
352 Ga0496101_1129063 3300048904 Unclassified 615
353 Ga0496102_0423162 3300048905 Unclassified 1251
354 Ga0496102_0514324 3300048905 Bacteria 1120
355 Ga0496102_0909000 3300048905 Bacteria 802
356 Ga0496103_0737757 3300048906 Unclassified 623
357 Ga0496104_0240270 3300048907 Bacteria 1723
358 Ga0496104_0281528 3300048907 Unclassified 1576
359 Ga0496105_0243855 3300048908 Bacteria 1457
360 Ga0496105_0463059 3300048908 Unclassified 999
361 Ga0496106_0089319 3300048909 Bacteria 2376
362 Ga0496106_0367564 3300048909 Bacteria 1156
363 Ga0496106_0723297 3300048909 Bacteria 792
364 Ga0496108_0006411 3300048911 Bacteria 9540
365 Ga0496108_0241618 3300048911 Unclassified 1571
366 Ga0496108_1383175 3300048911 Bacteria 589
367 Ga0496109_0176057 3300048912 Bacteria 2008
368 Ga0496109_0187101 3300048912 Unclassified 1946
369 Ga0496109_0198845 3300048912 Bacteria 1884
370 Ga0496110_0063637 3300048913 Bacteria 3259
371 Ga0496110_0670885 3300048913 Unclassified 937
372 Ga0496110_1604484 3300048913 Bacteria 561
373 Ga0496111_0024437 3300048914 Bacteria 4254
374 Ga0496112_0060218 3300048915 Bacteria 3741
375 Ga0496112_0121067 3300048915 Bacteria 2586
376 Ga0496112_0571480 3300048915 Bacteria 1063
377 Ga0496113_0201409 3300048916 Bacteria 1582
378 Ga0496113_0429260 3300048916 Bacteria 1062
379 Ga0496113_1383609 3300048916 Bacteria 545
380 Ga0496114_0059078 3300048917 Bacteria 3203
381 Ga0496114_0171433 3300048917 Bacteria 1891
382 Ga0496114_1319196 3300048917 Unclassified 609
383 Ga0496115_0019529 3300048918 Bacteria 5216
384 Ga0496115_0430112 3300048918 Bacteria 1068
385 Ga0496115_1004310 3300048918 Bacteria 637
386 Ga0501031_0027962 3300049568 Bacteria 3675
387 Ga0501031_0542453 3300049568 Unclassified 749
388 Ga0501031_0854400 3300049568 Unclassified 583
389 Ga0501032_0050274 3300049569 Bacteria 2811
390 Ga0501033_0004884 3300049570 Bacteria 10677
391 Ga0501033_0116775 3300049570 Bacteria 1938
392 Ga0501033_0131576 3300049570 Bacteria 1812
393 Ga0501034_0064576 3300049571 Bacteria 3674
394 Ga0501034_0101959 3300049571 Bacteria 2863
395 Ga0501034_0261213 3300049571 Bacteria 1674
396 Ga0501034_0700267 3300049571 Bacteria 911
397 Ga0501036_0133206 3300049572 Bacteria 2097
398 Ga0501036_0134134 3300049572 Bacteria 2089
399 Ga0501036_0264193 3300049572 Unclassified 1441
400 Ga0501037_0070232 3300049573 Bacteria 2548
401 Ga0501037_0099130 3300049573 Bacteria 2104
402 Ga0501038_0068104 3300049574 Bacteria 3026
403 Ga0501038_0416403 3300049574 Bacteria 1037
404 Ga0501039_0044096 3300049575 Bacteria 3444
405 Ga0501039_0257392 3300049575 Bacteria 1372
406 Ga0501042_0073236 3300049578 Bacteria 2450
407 Ga0501043_0044487 3300049579 Bacteria 3491
408 Ga0501043_0123606 3300049579 Bacteria 2029
409 Ga0501043_0126915 3300049579 Bacteria 2000
410 Ga0501046_0161736 3300049580 Unclassified 1683
411 Ga0501046_0230822 3300049580 Bacteria 1367
412 Ga0501046_0798374 3300049580 Bacteria 661
413 Ga0501047_0029477 3300049581 Bacteria 5290
414 Ga0501047_0242501 3300049581 Unclassified 1652
415 Ga0501048_0002568 3300049582 Bacteria 13908
416 Ga0501069_0242591 3300049585 Bacteria 1050
417 Ga0501070_0110346 3300049586 Bacteria 2273
418 Ga0501070_0483813 3300049586 Unclassified 995
419 Ga0501073_0010517 3300049589 Bacteria 6778
420 Ga0501073_0113394 3300049589 Bacteria 1880
421 Ga0501074_0798026 3300049590 Unclassified 665
422 Ga0501080_0106668 3300049742 Bacteria 2596
423 Ga0501080_0180264 3300049742 Bacteria 1944
424 Ga0501035_0026641 3300049822 Bacteria 5288
425 Ga0501035_0148821 3300049822 Bacteria 2032
426 Ga0501035_0162808 3300049822 Unclassified 1930
427 Ga0501035_0181441 3300049822 Bacteria 1813
428 Ga0501044_0127755 3300049823 Bacteria 2538
429 Ga0501044_0177489 3300049823 Bacteria 2098
430 Ga0501044_0199697 3300049823 Bacteria 1958
431 Ga0501045_0608348 3300049824 Unclassified 809
432 nmdc:mga0n895_1483_c1 3300050512 Bacteria 17595
433 nmdc:mga0rr50_1358521_c1 3300050513 Unclassified 602
434 nmdc:mga0rr50_16956_c1 3300050513 Bacteria 4851
435 nmdc:mga08x19_9967_c1 3300050514 Bacteria 5696
436 Ga0495601_0004605 3300053077 Bacteria 7979
437 Ga0495601_0083924 3300053077 Bacteria 2046
438 Ga0495612_0440703 3300053078 Bacteria 594
439 Ga0495595_0079109 3300053084 Bacteria 1563
440 Ga0495619_0076679 3300053085 Bacteria 2244
441 Ga0495619_0102571 3300053085 Bacteria 1948
442 Ga0495619_0764791 3300053085 Unclassified 654
443 Ga0501084_0176464 3300054114 Bacteria 1804
444 Ga0501084_1140749 3300054114 Unclassified 654
445 Ga0466962_0016550 3300061719 Bacteria 3556

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041451 Ga0451791_0028386 Ga0451791_0028386_250_570 90
2 3300041512 Ga0451853_1406054 Ga0451853_1406054_737_1036 92
3 3300005456 Ga0070678_100243661 Ga0070678_1002436611 95
4 3300011119 Ga0105246_11628393 Ga0105246_116283932 95
5 3300014325 Ga0163163_12405881 Ga0163163_124058811 95
6 3300028794 Ga0307515_10307154 Ga0307515_103071542 96
7 3300034817 Ga0373948_0062174 Ga0373948_0062174_245_559 96
8 3300005329 Ga0070683_100014804 Ga0070683_1000148042 99
9 3300005331 Ga0070670_101142706 Ga0070670_1011427062 99
10 3300005344 Ga0070661_101247046 Ga0070661_1012470461 99
11 3300005353 Ga0070669_101656173 Ga0070669_1016561731 99
12 3300005535 Ga0070684_100090621 Ga0070684_1000906213 99
13 3300005564 Ga0070664_100715305 Ga0070664_1007153052 99
14 3300005577 Ga0068857_100038584 Ga0068857_1000385844 99
15 3300005718 Ga0068866_10528390 Ga0068866_105283901 99
16 3300006846 Ga0075430_100261305 Ga0075430_1002613053 99
17 3300006880 Ga0075429_100242477 Ga0075429_1002424772 99
18 3300009098 Ga0105245_10213779 Ga0105245_102137792 99
19 3300009147 Ga0114129_10333810 Ga0114129_103338102 99
20 3300009148 Ga0105243_10929672 Ga0105243_109296721 99
21 3300009553 Ga0105249_10243764 Ga0105249_102437642 99
22 3300010375 Ga0105239_10242882 Ga0105239_102428823 99
23 3300014745 Ga0157377_10527650 Ga0157377_105276502 99
24 3300025899 Ga0207642_10336242 Ga0207642_103362422 99
25 3300025925 Ga0207650_10919927 Ga0207650_109199272 99
26 3300025935 Ga0207709_11712778 Ga0207709_117127782 99
27 3300025938 Ga0207704_10504738 Ga0207704_105047382 99
28 3300025944 Ga0207661_10042763 Ga0207661_100427633 99
29 3300025945 Ga0207679_10132354 Ga0207679_101323544 99
30 3300026116 Ga0207674_10008088 Ga0207674_100080885 99
31 3300038443 Ga0395901_0538963 Ga0395901_0538963_754_1053 99
32 3300041459 Ga0451800_1660513 Ga0451800_1660513_185_484 99
33 3300044693 Ga0466961_0159882 Ga0466961_0159882_1038_1337 99
34 3300048905 Ga0496102_0514324 Ga0496102_0514324_791_1090 99
35 3300048911 Ga0496108_0241618 Ga0496108_0241618_1148_1447 99
36 3300048912 Ga0496109_0176057 Ga0496109_0176057_974_1273 99
37 3300048913 Ga0496110_0670885 Ga0496110_0670885_424_723 99
38 3300050513 nmdc:mga0rr50_1358521_c1 nmdc:mga0rr50_1358521_c1_230_529 99
39 3300005985 Ga0081539_10001335 Ga0081539_1000133546 102
40 3300037418 Ga0395900_0136623 Ga0395900_0136623_390_701 103
41 3300037466 Ga0395898_0584689 Ga0395898_0584689_558_869 103
42 3300038443 Ga0395901_0404118 Ga0395901_0404118_832_1143 103
43 3300044694 Ga0466963_0125653 Ga0466963_0125653_516_827 103
44 3300044719 Ga0466971_0312911 Ga0466971_0312911_16_327 103
45 3300044842 Ga0466957_0143242 Ga0466957_0143242_1148_1459 103
46 3300005329 Ga0070683_100206107 Ga0070683_1002061072 104
47 3300005364 Ga0070673_100182674 Ga0070673_1001826742 104
48 3300005366 Ga0070659_100612005 Ga0070659_1006120052 104
49 3300005435 Ga0070714_100827429 Ga0070714_1008274291 104
50 3300005436 Ga0070713_101849476 Ga0070713_1018494761 104
51 3300005438 Ga0070701_10976890 Ga0070701_109768901 104
52 3300005439 Ga0070711_100887359 Ga0070711_1008873592 104
53 3300005439 Ga0070711_100955256 Ga0070711_1009552561 104
54 3300005441 Ga0070700_100525076 Ga0070700_1005250762 104
55 3300005539 Ga0068853_101810248 Ga0068853_1018102482 104
56 3300005544 Ga0070686_100203406 Ga0070686_1002034061 104
57 3300005564 Ga0070664_102261519 Ga0070664_1022615191 104
58 3300005719 Ga0068861_100321208 Ga0068861_1003212082 104
59 3300006175 Ga0070712_100193602 Ga0070712_1001936022 104
60 3300007076 Ga0075435_100517416 Ga0075435_1005174162 104
61 3300025901 Ga0207688_10226757 Ga0207688_102267572 104
62 3300025914 Ga0207671_10485940 Ga0207671_104859402 104
63 3300025915 Ga0207693_10429113 Ga0207693_104291132 104
64 3300025916 Ga0207663_10731261 Ga0207663_107312612 104
65 3300025916 Ga0207663_10779156 Ga0207663_107791561 104
66 3300025919 Ga0207657_11507247 Ga0207657_115072471 104
67 3300025927 Ga0207687_10077354 Ga0207687_100773542 104
68 3300025932 Ga0207690_10569824 Ga0207690_105698242 104
69 3300025945 Ga0207679_11437767 Ga0207679_114377672 104
70 3300025961 Ga0207712_10189257 Ga0207712_101892572 104
71 3300026023 Ga0207677_10280796 Ga0207677_102807962 104
72 3300037853 Ga0436364_0538701 Ga0436364_0538701_2181_2495 104
73 3300037853 Ga0436364_1548415 Ga0436364_1548415_457_771 104
74 3300039437 Ga0436365_0540670 Ga0436365_0540670_392_706 104
75 3300039437 Ga0436365_1927478 Ga0436365_1927478_136_450 104
76 3300039438 Ga0436360_1042244 Ga0436360_1042244_1302_1616 104
77 3300041452 Ga0451793_0598440 Ga0451793_0598440_480_794 104
78 3300041459 Ga0451800_0554801 Ga0451800_0554801_143_457 104
79 3300041459 Ga0451800_0902753 Ga0451800_0902753_170_484 104
80 3300041512 Ga0451853_0491700 Ga0451853_0491700_182_496 104
81 3300041512 Ga0451853_3020805 Ga0451853_3020805_1157_1471 104
82 3300044658 Ga0466972_0388994 Ga0466972_0388994_126_440 104
83 3300044658 Ga0466972_0423892 Ga0466972_0423892_293_607 104
84 3300044683 Ga0466965_0376457 Ga0466965_0376457_450_764 104
85 3300044684 Ga0466966_0075630 Ga0466966_0075630_1260_1574 104
86 3300044684 Ga0466966_0121772 Ga0466966_0121772_113_427 104
87 3300044684 Ga0466966_0178409 Ga0466966_0178409_430_744 104
88 3300044693 Ga0466961_0021290 Ga0466961_0021290_2411_2725 104
89 3300044693 Ga0466961_0106937 Ga0466961_0106937_235_549 104
90 3300044693 Ga0466961_0453765 Ga0466961_0453765_254_568 104
91 3300044693 Ga0466961_0784201 Ga0466961_0784201_167_481 104
92 3300044694 Ga0466963_0006485 Ga0466963_0006485_3140_3454 104
93 3300044694 Ga0466963_0009386 Ga0466963_0009386_607_921 104
94 3300044694 Ga0466963_0342260 Ga0466963_0342260_534_848 104
95 3300044719 Ga0466971_0051030 Ga0466971_0051030_297_611 104
96 3300044765 Ga0466970_0691069 Ga0466970_0691069_174_488 104
97 3300044842 Ga0466957_0214394 Ga0466957_0214394_216_530 104
98 3300045049 Ga0466959_0067681 Ga0466959_0067681_168_482 104
99 3300045049 Ga0466959_0082068 Ga0466959_0082068_816_1130 104
100 3300045049 Ga0466959_0124131 Ga0466959_0124131_1286_1600 104
101 3300045049 Ga0466959_0882090 Ga0466959_0882090_62_376 104
102 3300045836 Ga0466958_0047921 Ga0466958_0047921_1433_1747 104
103 3300045836 Ga0466958_0107658 Ga0466958_0107658_1099_1413 104
104 3300045836 Ga0466958_0424349 Ga0466958_0424349_94_408 104
105 3300045976 Ga0466967_0032794 Ga0466967_0032794_1571_1885 104
106 3300046459 Ga0495629_0331330 Ga0495629_0331330_698_1015 104
107 3300046461 Ga0495641_0122960 Ga0495641_0122960_417_734 104
108 3300046664 Ga0495659_0212584 Ga0495659_0212584_244_558 104
109 3300046683 Ga0495658_0434472 Ga0495658_0434472_243_560 104
110 3300047321 Ga0495676_0122479 Ga0495676_0122479_999_1316 104
111 3300047322 Ga0495680_0591146 Ga0495680_0591146_112_426 104
112 3300048904 Ga0496101_1129063 Ga0496101_1129063_35_349 104
113 3300048905 Ga0496102_0909000 Ga0496102_0909000_336_650 104
114 3300048907 Ga0496104_0281528 Ga0496104_0281528_584_898 104
115 3300048911 Ga0496108_1383175 Ga0496108_1383175_77_391 104
116 3300048912 Ga0496109_0187101 Ga0496109_0187101_1190_1504 104
117 3300048917 Ga0496114_1319196 Ga0496114_1319196_49_363 104
118 3300061719 Ga0466962_0016550 Ga0466962_0016550_1760_2074 104
119 3300005327 Ga0070658_11618391 Ga0070658_116183911 105
120 3300005330 Ga0070690_100371982 Ga0070690_1003719822 105
121 3300005334 Ga0068869_100017791 Ga0068869_1000177917 105
122 3300005336 Ga0070680_100214667 Ga0070680_1002146672 105
123 3300005337 Ga0070682_100024463 Ga0070682_1000244632 105
124 3300005338 Ga0068868_100274730 Ga0068868_1002747303 105
125 3300005339 Ga0070660_100011443 Ga0070660_1000114435 105
126 3300005340 Ga0070689_100056537 Ga0070689_1000565372 105
127 3300005340 Ga0070689_100506438 Ga0070689_1005064382 105
128 3300005341 Ga0070691_10035274 Ga0070691_100352744 105
129 3300005344 Ga0070661_100122232 Ga0070661_1001222322 105
130 3300005354 Ga0070675_100043550 Ga0070675_1000435503 105
131 3300005355 Ga0070671_100730911 Ga0070671_1007309111 105
132 3300005364 Ga0070673_100634849 Ga0070673_1006348492 105
133 3300005365 Ga0070688_100136236 Ga0070688_1001362362 105
134 3300005365 Ga0070688_100209485 Ga0070688_1002094852 105
135 3300005367 Ga0070667_100243879 Ga0070667_1002438791 105
136 3300005367 Ga0070667_100851485 Ga0070667_1008514852 105
137 3300005406 Ga0070703_10038477 Ga0070703_100384771 105
138 3300005435 Ga0070714_100340017 Ga0070714_1003400172 105
139 3300005437 Ga0070710_10454778 Ga0070710_104547782 105
140 3300005438 Ga0070701_10857964 Ga0070701_108579642 105
141 3300005439 Ga0070711_100383130 Ga0070711_1003831302 105
142 3300005439 Ga0070711_101805243 Ga0070711_1018052431 105
143 3300005445 Ga0070708_101145629 Ga0070708_1011456292 105
144 3300005456 Ga0070678_100714825 Ga0070678_1007148252 105
145 3300005457 Ga0070662_100691972 Ga0070662_1006919721 105
146 3300005458 Ga0070681_11697287 Ga0070681_116972871 105
147 3300005459 Ga0068867_100847455 Ga0068867_1008474551 105
148 3300005466 Ga0070685_10435427 Ga0070685_104354272 105
149 3300005466 Ga0070685_10623299 Ga0070685_106232992 105
150 3300005471 Ga0070698_100242578 Ga0070698_1002425782 105
151 3300005535 Ga0070684_101637243 Ga0070684_1016372431 105
152 3300005539 Ga0068853_100177259 Ga0068853_1001772592 105
153 3300005539 Ga0068853_100787043 Ga0068853_1007870431 105
154 3300005543 Ga0070672_100689148 Ga0070672_1006891482 105
155 3300005544 Ga0070686_100166511 Ga0070686_1001665112 105
156 3300005545 Ga0070695_100478992 Ga0070695_1004789922 105
157 3300005546 Ga0070696_100429436 Ga0070696_1004294361 105
158 3300005547 Ga0070693_100036853 Ga0070693_1000368532 105
159 3300005548 Ga0070665_101076159 Ga0070665_1010761592 105
160 3300005549 Ga0070704_101135194 Ga0070704_1011351942 105
161 3300005563 Ga0068855_101015824 Ga0068855_1010158243 105
162 3300005564 Ga0070664_100897600 Ga0070664_1008976002 105
163 3300005578 Ga0068854_100317823 Ga0068854_1003178232 105
164 3300005614 Ga0068856_100004824 Ga0068856_1000048248 105
165 3300005615 Ga0070702_100024021 Ga0070702_1000240212 105
166 3300005616 Ga0068852_100616180 Ga0068852_1006161802 105
167 3300005616 Ga0068852_100892105 Ga0068852_1008921052 105
168 3300005617 Ga0068859_100537601 Ga0068859_1005376012 105
169 3300005618 Ga0068864_100291430 Ga0068864_1002914302 105
170 3300005718 Ga0068866_10018861 Ga0068866_100188612 105
171 3300005719 Ga0068861_100136491 Ga0068861_1001364912 105
172 3300005719 Ga0068861_100269446 Ga0068861_1002694463 105
173 3300005841 Ga0068863_100282055 Ga0068863_1002820552 105
174 3300005842 Ga0068858_100346306 Ga0068858_1003463062 105
175 3300005843 Ga0068860_100221012 Ga0068860_1002210123 105
176 3300005843 Ga0068860_101084117 Ga0068860_1010841172 105
177 3300005937 Ga0081455_10001958 Ga0081455_1000195824 105
178 3300005937 Ga0081455_10038490 Ga0081455_100384906 105
179 3300006028 Ga0070717_10402681 Ga0070717_104026812 105
180 3300006028 Ga0070717_10777684 Ga0070717_107776842 105
181 3300006173 Ga0070716_100083892 Ga0070716_1000838922 105
182 3300006175 Ga0070712_100798879 Ga0070712_1007988792 105
183 3300006175 Ga0070712_101569907 Ga0070712_1015699072 105
184 3300006358 Ga0068871_100169120 Ga0068871_1001691202 105
185 3300006871 Ga0075434_100001098 Ga0075434_10000109812 105
186 3300006881 Ga0068865_100311032 Ga0068865_1003110322 105
187 3300006914 Ga0075436_100014593 Ga0075436_1000145932 105
188 3300006931 Ga0097620_100537574 Ga0097620_1005375742 105
189 3300007076 Ga0075435_100013491 Ga0075435_1000134917 105
190 3300009098 Ga0105245_10148865 Ga0105245_101488653 105
191 3300009098 Ga0105245_10263414 Ga0105245_102634142 105
192 3300009098 Ga0105245_10723872 Ga0105245_107238722 105
193 3300009101 Ga0105247_10029724 Ga0105247_100297243 105
194 3300009148 Ga0105243_10007737 Ga0105243_1000773710 105
195 3300009148 Ga0105243_10157943 Ga0105243_101579433 105
196 3300009174 Ga0105241_10615228 Ga0105241_106152281 105
197 3300009176 Ga0105242_10004600 Ga0105242_100046004 105
198 3300009176 Ga0105242_10064040 Ga0105242_100640403 105
199 3300009177 Ga0105248_10092363 Ga0105248_100923633 105
200 3300009177 Ga0105248_10754413 Ga0105248_107544132 105
201 3300009545 Ga0105237_11567022 Ga0105237_115670222 105
202 3300009551 Ga0105238_10106683 Ga0105238_101066835 105
203 3300009553 Ga0105249_13586917 Ga0105249_135869171 105
204 3300011119 Ga0105246_10005561 Ga0105246_100055617 105
205 3300013296 Ga0157374_10011853 Ga0157374_100118536 105
206 3300013297 Ga0157378_10324102 Ga0157378_103241023 105
207 3300013297 Ga0157378_10498292 Ga0157378_104982922 105
208 3300013306 Ga0163162_10109619 Ga0163162_101096192 105
209 3300013307 Ga0157372_10804468 Ga0157372_108044681 105
210 3300013308 Ga0157375_10169707 Ga0157375_101697073 105
211 3300013308 Ga0157375_13626900 Ga0157375_136269001 105
212 3300014325 Ga0163163_10067164 Ga0163163_100671645 105
213 3300014326 Ga0157380_11525643 Ga0157380_115256432 105
214 3300014497 Ga0182008_10205076 Ga0182008_102050762 105
215 3300014745 Ga0157377_10244954 Ga0157377_102449542 105
216 3300014745 Ga0157377_10972888 Ga0157377_109728881 105
217 3300014968 Ga0157379_10065585 Ga0157379_100655855 105
218 3300014969 Ga0157376_10272270 Ga0157376_102722702 105
219 3300014969 Ga0157376_10426079 Ga0157376_104260792 105
220 3300017792 Ga0163161_11123798 Ga0163161_111237982 105
221 3300025885 Ga0207653_10256158 Ga0207653_102561582 105
222 3300025898 Ga0207692_10591589 Ga0207692_105915892 105
223 3300025899 Ga0207642_10848028 Ga0207642_108480281 105
224 3300025900 Ga0207710_10017031 Ga0207710_100170312 105
225 3300025901 Ga0207688_10019661 Ga0207688_100196613 105
226 3300025903 Ga0207680_10367776 Ga0207680_103677762 105
227 3300025906 Ga0207699_10112024 Ga0207699_101120242 105
228 3300025909 Ga0207705_11100701 Ga0207705_111007011 105
229 3300025911 Ga0207654_10061197 Ga0207654_100611972 105
230 3300025912 Ga0207707_11295194 Ga0207707_112951941 105
231 3300025914 Ga0207671_10990002 Ga0207671_109900021 105
232 3300025915 Ga0207693_10383723 Ga0207693_103837232 105
233 3300025916 Ga0207663_11151256 Ga0207663_111512562 105
234 3300025918 Ga0207662_10035000 Ga0207662_100350005 105
235 3300025919 Ga0207657_10006452 Ga0207657_100064526 105
236 3300025920 Ga0207649_11179829 Ga0207649_111798292 105
237 3300025924 Ga0207694_10558344 Ga0207694_105583442 105
238 3300025926 Ga0207659_10015553 Ga0207659_100155532 105
239 3300025927 Ga0207687_10062195 Ga0207687_100621952 105
240 3300025928 Ga0207700_10382285 Ga0207700_103822852 105
241 3300025928 Ga0207700_10633722 Ga0207700_106337221 105
242 3300025929 Ga0207664_10720456 Ga0207664_107204562 105
243 3300025931 Ga0207644_10490449 Ga0207644_104904492 105
244 3300025932 Ga0207690_10194406 Ga0207690_101944062 105
245 3300025933 Ga0207706_10098192 Ga0207706_100981924 105
246 3300025934 Ga0207686_10090337 Ga0207686_100903372 105
247 3300025935 Ga0207709_10336429 Ga0207709_103364292 105
248 3300025935 Ga0207709_11541110 Ga0207709_115411102 105
249 3300025936 Ga0207670_10035361 Ga0207670_100353614 105
250 3300025936 Ga0207670_11815351 Ga0207670_118153511 105
251 3300025938 Ga0207704_10234867 Ga0207704_102348672 105
252 3300025938 Ga0207704_10640435 Ga0207704_106404351 105
253 3300025939 Ga0207665_10017247 Ga0207665_100172472 105
254 3300025941 Ga0207711_10505558 Ga0207711_105055582 105
255 3300025941 Ga0207711_10679595 Ga0207711_106795952 105
256 3300025942 Ga0207689_10023840 Ga0207689_100238402 105
257 3300025949 Ga0207667_10617259 Ga0207667_106172593 105
258 3300025961 Ga0207712_11266136 Ga0207712_112661362 105
259 3300025972 Ga0207668_10247586 Ga0207668_102475862 105
260 3300025972 Ga0207668_10807734 Ga0207668_108077341 105
261 3300025981 Ga0207640_10196694 Ga0207640_101966943 105
262 3300025986 Ga0207658_11077013 Ga0207658_110770132 105
263 3300026023 Ga0207677_10456192 Ga0207677_104561922 105
264 3300026035 Ga0207703_10314567 Ga0207703_103145672 105
265 3300026035 Ga0207703_10720672 Ga0207703_107206721 105
266 3300026078 Ga0207702_10023825 Ga0207702_100238257 105
267 3300026088 Ga0207641_10148052 Ga0207641_101480522 105
268 3300026088 Ga0207641_11261548 Ga0207641_112615482 105
269 3300026089 Ga0207648_10004177 Ga0207648_1000417712 105
270 3300026095 Ga0207676_10132867 Ga0207676_101328672 105
271 3300026118 Ga0207675_102477269 Ga0207675_1024772692 105
272 3300026121 Ga0207683_10071762 Ga0207683_100717621 105
273 3300026121 Ga0207683_10750112 Ga0207683_107501123 105
274 3300026142 Ga0207698_10303385 Ga0207698_103033852 105
275 3300026142 Ga0207698_10684321 Ga0207698_106843212 105
276 3300028381 Ga0268264_10182984 Ga0268264_101829843 105
277 3300035083 Ga0373926_0115387 Ga0373926_0115387_668_985 105
278 3300035089 Ga0373944_0012174 Ga0373944_0012174_325_642 105
279 3300035117 Ga0373953_0049682 Ga0373953_0049682_1077_1394 105
280 3300035118 Ga0373954_0664371 Ga0373954_0664371_180_497 105
281 3300035170 Ga0373943_0026839 Ga0373943_0026839_2310_2627 105
282 3300035171 Ga0373946_0009647 Ga0373946_0009647_569_886 105
283 3300035172 Ga0373955_0087215 Ga0373955_0087215_71_388 105
284 3300035410 Ga0373924_0021839 Ga0373924_0021839_751_1068 105
285 3300035691 Ga0373931_0508732 Ga0373931_0508732_333_650 105
286 3300035692 Ga0373935_0105294 Ga0373935_0105294_14_331 105
287 3300035692 Ga0373935_0121531 Ga0373935_0121531_610_927 105
288 3300035725 Ga0373947_0019909 Ga0373947_0019909_2978_3295 105
289 3300035725 Ga0373947_0024465 Ga0373947_0024465_569_886 105
290 3300036401 Ga0373937_0678344 Ga0373937_0678344_516_833 105
291 3300037068 Ga0373925_0032754 Ga0373925_0032754_1047_1364 105
292 3300037068 Ga0373925_0732004 Ga0373925_0732004_273_590 105
293 3300037466 Ga0395898_0722331 Ga0395898_0722331_406_729 105
294 3300038443 Ga0395901_0085431 Ga0395901_0085431_1333_1656 105
295 3300039438 Ga0436360_0367638 Ga0436360_0367638_332_658 105
296 3300041512 Ga0451853_1512758 Ga0451853_1512758_247_564 105
297 3300044694 Ga0466963_0130678 Ga0466963_0130678_129_473 105
298 3300044694 Ga0466963_0553779 Ga0466963_0553779_402_722 105
299 3300044706 Ga0466964_0769208 Ga0466964_0769208_114_434 105
300 3300044719 Ga0466971_0013210 Ga0466971_0013210_282_626 105
301 3300044842 Ga0466957_0103567 Ga0466957_0103567_36_380 105
302 3300045836 Ga0466958_0036634 Ga0466958_0036634_2462_2806 105
303 3300045976 Ga0466967_0042536 Ga0466967_0042536_845_1189 105
304 3300045976 Ga0466967_0280753 Ga0466967_0280753_1023_1343 105
305 3300045976 Ga0466967_0858812 Ga0466967_0858812_547_867 105
306 3300045976 Ga0466967_1217106 Ga0466967_1217106_400_720 105
307 3300046454 Ga0495592_0424555 Ga0495592_0424555_439_756 105
308 3300046455 Ga0495603_0066235 Ga0495603_0066235_1149_1466 105
309 3300046455 Ga0495603_0130825 Ga0495603_0130825_610_927 105
310 3300046459 Ga0495629_0530730 Ga0495629_0530730_248_565 105
311 3300046461 Ga0495641_0109354 Ga0495641_0109354_575_892 105
312 3300046462 Ga0495651_0171878 Ga0495651_0171878_572_889 105
313 3300046463 Ga0495653_0218364 Ga0495653_0218364_538_855 105
314 3300046472 Ga0495580_0004988 Ga0495580_0004988_10244_10561 105
315 3300046473 Ga0495582_0068536 Ga0495582_0068536_1397_1714 105
316 3300046473 Ga0495582_0216142 Ga0495582_0216142_505_822 105
317 3300046475 Ga0495639_0098029 Ga0495639_0098029_86_403 105
318 3300046476 Ga0495662_0045382 Ga0495662_0045382_1297_1614 105
319 3300046477 Ga0495664_0063599 Ga0495664_0063599_1203_1520 105
320 3300046499 Ga0495594_0116237 Ga0495594_0116237_545_862 105
321 3300046511 Ga0495608_0925049 Ga0495608_0925049_82_399 105
322 3300046514 Ga0495618_0146483 Ga0495618_0146483_165_482 105
323 3300046516 Ga0495628_0365293 Ga0495628_0365293_491_808 105
324 3300046517 Ga0495630_0290852 Ga0495630_0290852_192_509 105
325 3300046526 Ga0495666_0011517 Ga0495666_0011517_1313_1630 105
326 3300046529 Ga0495652_0545835 Ga0495652_0545835_31_348 105
327 3300046531 Ga0495665_0004476 Ga0495665_0004476_2596_2913 105
328 3300046533 Ga0495640_0111913 Ga0495640_0111913_1451_1768 105
329 3300046533 Ga0495640_0124402 Ga0495640_0124402_403_720 105
330 3300046535 Ga0495586_0053352 Ga0495586_0053352_1463_1780 105
331 3300046536 Ga0495587_0057944 Ga0495587_0057944_452_769 105
332 3300046536 Ga0495587_0668687 Ga0495587_0668687_215_532 105
333 3300046559 Ga0495667_0003138 Ga0495667_0003138_147_464 105
334 3300046642 Ga0495634_0020996 Ga0495634_0020996_1829_2146 105
335 3300046663 Ga0495635_0088710 Ga0495635_0088710_421_738 105
336 3300046663 Ga0495635_0088826 Ga0495635_0088826_1387_1704 105
337 3300046674 Ga0495588_0628365 Ga0495588_0628365_177_494 105
338 3300046678 Ga0495599_0458159 Ga0495599_0458159_71_388 105
339 3300046680 Ga0495646_0186869 Ga0495646_0186869_180_497 105
340 3300046681 Ga0495647_0015584 Ga0495647_0015584_71_388 105
341 3300046681 Ga0495647_0179587 Ga0495647_0179587_119_436 105
342 3300046683 Ga0495658_0043219 Ga0495658_0043219_1592_1909 105
343 3300046683 Ga0495658_0051590 Ga0495658_0051590_1325_1642 105
344 3300046690 Ga0495624_0043330 Ga0495624_0043330_857_1174 105
345 3300046690 Ga0495624_0213044 Ga0495624_0213044_690_1007 105
346 3300046691 Ga0495670_0344256 Ga0495670_0344256_149_469 105
347 3300046809 Ga0495600_0075090 Ga0495600_0075090_642_959 105
348 3300047315 Ga0495581_0009567 Ga0495581_0009567_1331_1648 105
349 3300047315 Ga0495581_0167412 Ga0495581_0167412_66_383 105
350 3300047319 Ga0495674_0027372 Ga0495674_0027372_2417_2734 105
351 3300047319 Ga0495674_0046290 Ga0495674_0046290_706_1023 105
352 3300047321 Ga0495676_0072164 Ga0495676_0072164_1312_1629 105
353 3300047444 Ga0495675_0115188 Ga0495675_0115188_186_503 105
354 3300047471 Ga0495684_0001638 Ga0495684_0001638_16411_16728 105
355 3300047673 Ga0495593_0036864 Ga0495593_0036864_2275_2592 105
356 3300048088 Ga0495602_0612531 Ga0495602_0612531_415_732 105
357 3300048088 Ga0495602_0692291 Ga0495602_0692291_177_494 105
358 3300048089 Ga0495614_0095828 Ga0495614_0095828_610_927 105
359 3300048903 Ga0496100_0216535 Ga0496100_0216535_634_951 105
360 3300048903 Ga0496100_0588116 Ga0496100_0588116_354_671 105
361 3300048903 Ga0496100_0678464 Ga0496100_0678464_269_595 105
362 3300048904 Ga0496101_0175034 Ga0496101_0175034_781_1107 105
363 3300048904 Ga0496101_0635491 Ga0496101_0635491_419_736 105
364 3300048905 Ga0496102_0423162 Ga0496102_0423162_399_725 105
365 3300048906 Ga0496103_0737757 Ga0496103_0737757_187_513 105
366 3300048907 Ga0496104_0240270 Ga0496104_0240270_371_688 105
367 3300048908 Ga0496105_0243855 Ga0496105_0243855_632_949 105
368 3300048908 Ga0496105_0463059 Ga0496105_0463059_341_667 105
369 3300048909 Ga0496106_0089319 Ga0496106_0089319_1814_2131 105
370 3300048909 Ga0496106_0367564 Ga0496106_0367564_536_862 105
371 3300048909 Ga0496106_0723297 Ga0496106_0723297_245_562 105
372 3300048911 Ga0496108_0006411 Ga0496108_0006411_8592_8909 105
373 3300048912 Ga0496109_0198845 Ga0496109_0198845_1152_1469 105
374 3300048913 Ga0496110_0063637 Ga0496110_0063637_357_674 105
375 3300048913 Ga0496110_1604484 Ga0496110_1604484_219_536 105
376 3300048914 Ga0496111_0024437 Ga0496111_0024437_390_707 105
377 3300048915 Ga0496112_0060218 Ga0496112_0060218_802_1122 105
378 3300048915 Ga0496112_0121067 Ga0496112_0121067_167_484 105
379 3300048915 Ga0496112_0571480 Ga0496112_0571480_519_836 105
380 3300048916 Ga0496113_0201409 Ga0496113_0201409_609_926 105
381 3300048916 Ga0496113_0429260 Ga0496113_0429260_377_697 105
382 3300048916 Ga0496113_1383609 Ga0496113_1383609_158_475 105
383 3300048917 Ga0496114_0059078 Ga0496114_0059078_653_979 105
384 3300048917 Ga0496114_0171433 Ga0496114_0171433_577_894 105
385 3300048918 Ga0496115_0019529 Ga0496115_0019529_4342_4659 105
386 3300048918 Ga0496115_0430112 Ga0496115_0430112_51_368 105
387 3300048918 Ga0496115_1004310 Ga0496115_1004310_170_487 105
388 3300049568 Ga0501031_0027962 Ga0501031_0027962_1516_1839 105
389 3300049568 Ga0501031_0542453 Ga0501031_0542453_298_621 105
390 3300049568 Ga0501031_0854400 Ga0501031_0854400_82_405 105
391 3300049569 Ga0501032_0050274 Ga0501032_0050274_1214_1537 105
392 3300049570 Ga0501033_0004884 Ga0501033_0004884_3585_3908 105
393 3300049570 Ga0501033_0116775 Ga0501033_0116775_296_619 105
394 3300049570 Ga0501033_0131576 Ga0501033_0131576_286_609 105
395 3300049571 Ga0501034_0064576 Ga0501034_0064576_933_1256 105
396 3300049571 Ga0501034_0101959 Ga0501034_0101959_1258_1581 105
397 3300049571 Ga0501034_0261213 Ga0501034_0261213_40_363 105
398 3300049571 Ga0501034_0700267 Ga0501034_0700267_453_776 105
399 3300049572 Ga0501036_0133206 Ga0501036_0133206_466_789 105
400 3300049572 Ga0501036_0134134 Ga0501036_0134134_1309_1632 105
401 3300049572 Ga0501036_0264193 Ga0501036_0264193_301_624 105
402 3300049573 Ga0501037_0070232 Ga0501037_0070232_458_781 105
403 3300049573 Ga0501037_0099130 Ga0501037_0099130_1316_1639 105
404 3300049574 Ga0501038_0068104 Ga0501038_0068104_485_808 105
405 3300049574 Ga0501038_0416403 Ga0501038_0416403_277_600 105
406 3300049575 Ga0501039_0044096 Ga0501039_0044096_578_901 105
407 3300049575 Ga0501039_0257392 Ga0501039_0257392_110_433 105
408 3300049578 Ga0501042_0073236 Ga0501042_0073236_879_1202 105
409 3300049579 Ga0501043_0044487 Ga0501043_0044487_3147_3470 105
410 3300049579 Ga0501043_0123606 Ga0501043_0123606_382_705 105
411 3300049579 Ga0501043_0126915 Ga0501043_0126915_352_675 105
412 3300049580 Ga0501046_0161736 Ga0501046_0161736_310_633 105
413 3300049580 Ga0501046_0230822 Ga0501046_0230822_458_781 105
414 3300049580 Ga0501046_0798374 Ga0501046_0798374_272_595 105
415 3300049581 Ga0501047_0029477 Ga0501047_0029477_1747_2070 105
416 3300049581 Ga0501047_0242501 Ga0501047_0242501_310_633 105
417 3300049582 Ga0501048_0002568 Ga0501048_0002568_513_836 105
418 3300049585 Ga0501069_0242591 Ga0501069_0242591_713_1036 105
419 3300049586 Ga0501070_0110346 Ga0501070_0110346_1453_1776 105
420 3300049586 Ga0501070_0483813 Ga0501070_0483813_336_659 105
421 3300049589 Ga0501073_0010517 Ga0501073_0010517_4648_4971 105
422 3300049589 Ga0501073_0113394 Ga0501073_0113394_430_753 105
423 3300049590 Ga0501074_0798026 Ga0501074_0798026_73_396 105
424 3300049742 Ga0501080_0106668 Ga0501080_0106668_341_664 105
425 3300049742 Ga0501080_0180264 Ga0501080_0180264_384_707 105
426 3300049822 Ga0501035_0026641 Ga0501035_0026641_1406_1729 105
427 3300049822 Ga0501035_0148821 Ga0501035_0148821_1325_1648 105
428 3300049822 Ga0501035_0162808 Ga0501035_0162808_1281_1604 105
429 3300049822 Ga0501035_0181441 Ga0501035_0181441_165_488 105
430 3300049823 Ga0501044_0127755 Ga0501044_0127755_382_705 105
431 3300049823 Ga0501044_0177489 Ga0501044_0177489_1310_1633 105
432 3300049823 Ga0501044_0199697 Ga0501044_0199697_327_650 105
433 3300049824 Ga0501045_0608348 Ga0501045_0608348_258_581 105
434 3300050512 nmdc:mga0n895_1483_c1 nmdc:mga0n895_1483_c1_2204_2521 105
435 3300050513 nmdc:mga0rr50_16956_c1 nmdc:mga0rr50_16956_c1_4315_4632 105
436 3300050514 nmdc:mga08x19_9967_c1 nmdc:mga08x19_9967_c1_1899_2216 105
437 3300053077 Ga0495601_0004605 Ga0495601_0004605_5786_6103 105
438 3300053077 Ga0495601_0083924 Ga0495601_0083924_1582_1899 105
439 3300053078 Ga0495612_0440703 Ga0495612_0440703_195_512 105
440 3300053084 Ga0495595_0079109 Ga0495595_0079109_679_996 105
441 3300053085 Ga0495619_0076679 Ga0495619_0076679_1355_1672 105
442 3300053085 Ga0495619_0102571 Ga0495619_0102571_1267_1584 105
443 3300053085 Ga0495619_0764791 Ga0495619_0764791_202_519 105
444 3300054114 Ga0501084_0176464 Ga0501084_0176464_879_1202 105
445 3300054114 Ga0501084_1140749 Ga0501084_1140749_208_525 105

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

29

102

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dym-assembly1.cif.gz_A-2 crystal structure of a padr family transcription regulator from hypervirulent clostridium difficile r20291 - cdpadr_0991 to 1.89 angstrom resolution 0.9043 10 103
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.903 10 103
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.8957 1 100
6pcp-assembly2.cif.gz_C mechanism for regulation of dna binding of bordetella bronchiseptica bpsr by 6-hydroxynicotinic acid 0.8935 10 87
5zhv-assembly1.cif.gz_B crystal structure of the padr-family transcriptional regulator rv3488 of mycobacterium tuberculosis h37rv in complex with zinc ion 0.8876 4 96
ID Description Score Start End Superfamily
af_P64588_52_154_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9151 1 91 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9069 10 87 1.10.10.10
5dymA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9042 10 103 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8797 3 103 1.10.10.10
3l7wA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8783 10 102 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7D7A3C7-F1-model_v4 PadR family transcriptional regulator 0.9796 10 105
AF-A0A7W1QDS0-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9786 1 104
AF-A0A800C6M0-F1-model_v4 PadR family transcriptional regulator 0.9775 11 89
AF-B5CPV7-F1-model_v4 Transcriptional regulator, PadR family 0.9768 11 104
AF-A0A7V8NIE9-F1-model_v4 PadR family transcriptional regulator 0.9764 11 103

Feature Viewer

pLDDT pTM Quality
92.07 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map