F445448
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 445 | 268 | 445 | 105 |
Family's Representative Sequence
| Representative Sequence | 3300005471|Ga0070698_100242578|Ga0070698_1002425782 |
| Length | 123 |
| Sequence | VRGVDIPAVYLEHLGMSADFKRGHLDLLILSVLARGPLHGYAAIAALRDRSGGLFDLAEGTVYPALHRLERVGLIASEWERASGRKRCRYALTKTGHAALARQTTQWRRWSGGLNMVLGWSGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 64 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 65 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 90 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 145 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 146 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 147 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 148 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 149 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 150 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 151 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 152 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 153 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 154 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 155 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 156 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 157 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 160 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 161 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 162 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 163 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 164 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 165 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 166 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 167 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 168 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 169 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 170 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 171 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 172 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 173 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 174 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 175 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 176 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 177 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 178 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 179 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 180 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 181 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 227 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 228 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 229 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 230 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 231 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 234 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 235 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 236 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 237 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 238 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 239 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 9.89 |
| Rhizosphere | 88.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_11618391 | 3300005327 | Bacteria | 561 |
| 2 | Ga0070683_100014804 | 3300005329 | Bacteria | 6835 |
| 3 | Ga0070683_100206107 | 3300005329 | Bacteria | 1868 |
| 4 | Ga0070690_100371982 | 3300005330 | Bacteria | 1043 |
| 5 | Ga0070670_101142706 | 3300005331 | Bacteria | 711 |
| 6 | Ga0068869_100017791 | 3300005334 | Bacteria | 4828 |
| 7 | Ga0070680_100214667 | 3300005336 | Bacteria | 1623 |
| 8 | Ga0070682_100024463 | 3300005337 | Bacteria | 3594 |
| 9 | Ga0068868_100274730 | 3300005338 | Bacteria | 1424 |
| 10 | Ga0070660_100011443 | 3300005339 | Bacteria | 6305 |
| 11 | Ga0070689_100056537 | 3300005340 | Bacteria | 3043 |
| 12 | Ga0070689_100506438 | 3300005340 | Bacteria | 1035 |
| 13 | Ga0070691_10035274 | 3300005341 | Bacteria | 2355 |
| 14 | Ga0070661_100122232 | 3300005344 | Bacteria | 1951 |
| 15 | Ga0070661_101247046 | 3300005344 | Bacteria | 623 |
| 16 | Ga0070669_101656173 | 3300005353 | Unclassified | 557 |
| 17 | Ga0070675_100043550 | 3300005354 | Bacteria | 3669 |
| 18 | Ga0070671_100730911 | 3300005355 | Bacteria | 860 |
| 19 | Ga0070673_100182674 | 3300005364 | Bacteria | 1796 |
| 20 | Ga0070673_100634849 | 3300005364 | Unclassified | 976 |
| 21 | Ga0070688_100136236 | 3300005365 | Unclassified | 1663 |
| 22 | Ga0070688_100209485 | 3300005365 | Bacteria | 1368 |
| 23 | Ga0070659_100612005 | 3300005366 | Bacteria | 937 |
| 24 | Ga0070667_100243879 | 3300005367 | Bacteria | 1605 |
| 25 | Ga0070667_100851485 | 3300005367 | Bacteria | 848 |
| 26 | Ga0070703_10038477 | 3300005406 | Bacteria | 1479 |
| 27 | Ga0070714_100340017 | 3300005435 | Bacteria | 1407 |
| 28 | Ga0070714_100827429 | 3300005435 | Bacteria | 897 |
| 29 | Ga0070713_101849476 | 3300005436 | Unclassified | 586 |
| 30 | Ga0070710_10454778 | 3300005437 | Bacteria | 869 |
| 31 | Ga0070701_10857964 | 3300005438 | Bacteria | 624 |
| 32 | Ga0070701_10976890 | 3300005438 | Unclassified | 589 |
| 33 | Ga0070711_100383130 | 3300005439 | Bacteria | 1137 |
| 34 | Ga0070711_100887359 | 3300005439 | Bacteria | 760 |
| 35 | Ga0070711_100955256 | 3300005439 | Bacteria | 734 |
| 36 | Ga0070711_101805243 | 3300005439 | Bacteria | 537 |
| 37 | Ga0070700_100525076 | 3300005441 | Unclassified | 915 |
| 38 | Ga0070708_101145629 | 3300005445 | Bacteria | 728 |
| 39 | Ga0070678_100243661 | 3300005456 | Bacteria | 1504 |
| 40 | Ga0070678_100714825 | 3300005456 | Bacteria | 904 |
| 41 | Ga0070662_100691972 | 3300005457 | Bacteria | 862 |
| 42 | Ga0070681_11697287 | 3300005458 | Bacteria | 558 |
| 43 | Ga0068867_100847455 | 3300005459 | Bacteria | 819 |
| 44 | Ga0070685_10435427 | 3300005466 | Bacteria | 915 |
| 45 | Ga0070685_10623299 | 3300005466 | Bacteria | 779 |
| 46 | Ga0070698_100242578 | 3300005471 | Bacteria | 1735 |
| 47 | Ga0070684_100090621 | 3300005535 | Bacteria | 2719 |
| 48 | Ga0070684_101637243 | 3300005535 | Bacteria | 607 |
| 49 | Ga0068853_100177259 | 3300005539 | Bacteria | 1932 |
| 50 | Ga0068853_100787043 | 3300005539 | Unclassified | 910 |
| 51 | Ga0068853_101810248 | 3300005539 | Bacteria | 592 |
| 52 | Ga0070672_100689148 | 3300005543 | Bacteria | 894 |
| 53 | Ga0070686_100166511 | 3300005544 | Bacteria | 1556 |
| 54 | Ga0070686_100203406 | 3300005544 | Unclassified | 1421 |
| 55 | Ga0070695_100478992 | 3300005545 | Bacteria | 959 |
| 56 | Ga0070696_100429436 | 3300005546 | Bacteria | 1039 |
| 57 | Ga0070693_100036853 | 3300005547 | Bacteria | 2722 |
| 58 | Ga0070665_101076159 | 3300005548 | Bacteria | 816 |
| 59 | Ga0070704_101135194 | 3300005549 | Bacteria | 711 |
| 60 | Ga0068855_101015824 | 3300005563 | Bacteria | 871 |
| 61 | Ga0070664_100715305 | 3300005564 | Bacteria | 934 |
| 62 | Ga0070664_100897600 | 3300005564 | Bacteria | 831 |
| 63 | Ga0070664_102261519 | 3300005564 | Bacteria | 516 |
| 64 | Ga0068857_100038584 | 3300005577 | Bacteria | 4230 |
| 65 | Ga0068854_100317823 | 3300005578 | Bacteria | 1264 |
| 66 | Ga0068856_100004824 | 3300005614 | Bacteria | 13366 |
| 67 | Ga0070702_100024021 | 3300005615 | Bacteria | 3246 |
| 68 | Ga0068852_100616180 | 3300005616 | Bacteria | 1091 |
| 69 | Ga0068852_100892105 | 3300005616 | Unclassified | 906 |
| 70 | Ga0068859_100537601 | 3300005617 | Bacteria | 1263 |
| 71 | Ga0068864_100291430 | 3300005618 | Bacteria | 1526 |
| 72 | Ga0068866_10018861 | 3300005718 | Bacteria | 3129 |
| 73 | Ga0068866_10528390 | 3300005718 | Unclassified | 785 |
| 74 | Ga0068861_100136491 | 3300005719 | Bacteria | 1997 |
| 75 | Ga0068861_100269446 | 3300005719 | Bacteria | 1461 |
| 76 | Ga0068861_100321208 | 3300005719 | Bacteria | 1348 |
| 77 | Ga0068863_100282055 | 3300005841 | Bacteria | 1610 |
| 78 | Ga0068858_100346306 | 3300005842 | Bacteria | 1423 |
| 79 | Ga0068860_100221012 | 3300005843 | Bacteria | 1839 |
| 80 | Ga0068860_101084117 | 3300005843 | Unclassified | 820 |
| 81 | Ga0081455_10001958 | 3300005937 | Bacteria | 24724 |
| 82 | Ga0081455_10038490 | 3300005937 | Bacteria | 4235 |
| 83 | Ga0081539_10001335 | 3300005985 | Bacteria | 42960 |
| 84 | Ga0070717_10402681 | 3300006028 | Bacteria | 1229 |
| 85 | Ga0070717_10777684 | 3300006028 | Bacteria | 870 |
| 86 | Ga0070716_100083892 | 3300006173 | Bacteria | 1909 |
| 87 | Ga0070712_100193602 | 3300006175 | Bacteria | 1593 |
| 88 | Ga0070712_100798879 | 3300006175 | Bacteria | 809 |
| 89 | Ga0070712_101569907 | 3300006175 | Bacteria | 575 |
| 90 | Ga0068871_100169120 | 3300006358 | Bacteria | 1872 |
| 91 | Ga0075430_100261305 | 3300006846 | Bacteria | 1434 |
| 92 | Ga0075434_100001098 | 3300006871 | Bacteria | 22182 |
| 93 | Ga0075429_100242477 | 3300006880 | Bacteria | 1579 |
| 94 | Ga0068865_100311032 | 3300006881 | Bacteria | 1264 |
| 95 | Ga0075436_100014593 | 3300006914 | Bacteria | 5384 |
| 96 | Ga0097620_100537574 | 3300006931 | Bacteria | 1263 |
| 97 | Ga0075435_100013491 | 3300007076 | Bacteria | 6080 |
| 98 | Ga0075435_100517416 | 3300007076 | Bacteria | 1032 |
| 99 | Ga0105245_10148865 | 3300009098 | Bacteria | 2212 |
| 100 | Ga0105245_10213779 | 3300009098 | Bacteria | 1857 |
| 101 | Ga0105245_10263414 | 3300009098 | Bacteria | 1678 |
| 102 | Ga0105245_10723872 | 3300009098 | Bacteria | 1029 |
| 103 | Ga0105247_10029724 | 3300009101 | Bacteria | 3312 |
| 104 | Ga0114129_10333810 | 3300009147 | Bacteria | 2012 |
| 105 | Ga0105243_10007737 | 3300009148 | Bacteria | 8262 |
| 106 | Ga0105243_10157943 | 3300009148 | Bacteria | 1952 |
| 107 | Ga0105243_10929672 | 3300009148 | Bacteria | 867 |
| 108 | Ga0105241_10615228 | 3300009174 | Bacteria | 983 |
| 109 | Ga0105242_10004600 | 3300009176 | Bacteria | 10695 |
| 110 | Ga0105242_10064040 | 3300009176 | Bacteria | 3029 |
| 111 | Ga0105248_10092363 | 3300009177 | Bacteria | 3409 |
| 112 | Ga0105248_10754413 | 3300009177 | Bacteria | 1098 |
| 113 | Ga0105237_11567022 | 3300009545 | Bacteria | 666 |
| 114 | Ga0105238_10106683 | 3300009551 | Bacteria | 2783 |
| 115 | Ga0105249_10243764 | 3300009553 | Bacteria | 1778 |
| 116 | Ga0105249_13586917 | 3300009553 | Unclassified | 500 |
| 117 | Ga0105239_10242882 | 3300010375 | Bacteria | 2021 |
| 118 | Ga0105246_10005561 | 3300011119 | Bacteria | 7683 |
| 119 | Ga0105246_11628393 | 3300011119 | Unclassified | 611 |
| 120 | Ga0157374_10011853 | 3300013296 | Bacteria | 7563 |
| 121 | Ga0157378_10324102 | 3300013297 | Unclassified | 1497 |
| 122 | Ga0157378_10498292 | 3300013297 | Bacteria | 1216 |
| 123 | Ga0163162_10109619 | 3300013306 | Bacteria | 2858 |
| 124 | Ga0157372_10804468 | 3300013307 | Bacteria | 1092 |
| 125 | Ga0157375_10169707 | 3300013308 | Bacteria | 2329 |
| 126 | Ga0157375_13626900 | 3300013308 | Bacteria | 513 |
| 127 | Ga0163163_10067164 | 3300014325 | Bacteria | 3564 |
| 128 | Ga0163163_12405881 | 3300014325 | Unclassified | 585 |
| 129 | Ga0157380_11525643 | 3300014326 | Bacteria | 722 |
| 130 | Ga0182008_10205076 | 3300014497 | Bacteria | 1004 |
| 131 | Ga0157377_10244954 | 3300014745 | Bacteria | 1159 |
| 132 | Ga0157377_10527650 | 3300014745 | Unclassified | 830 |
| 133 | Ga0157377_10972888 | 3300014745 | Bacteria | 640 |
| 134 | Ga0157379_10065585 | 3300014968 | Bacteria | 3246 |
| 135 | Ga0157376_10272270 | 3300014969 | Bacteria | 1591 |
| 136 | Ga0157376_10426079 | 3300014969 | Bacteria | 1289 |
| 137 | Ga0163161_11123798 | 3300017792 | Bacteria | 676 |
| 138 | Ga0207653_10256158 | 3300025885 | Bacteria | 672 |
| 139 | Ga0207692_10591589 | 3300025898 | Bacteria | 712 |
| 140 | Ga0207642_10336242 | 3300025899 | Unclassified | 886 |
| 141 | Ga0207642_10848028 | 3300025899 | Unclassified | 583 |
| 142 | Ga0207710_10017031 | 3300025900 | Bacteria | 3079 |
| 143 | Ga0207688_10019661 | 3300025901 | Bacteria | 3681 |
| 144 | Ga0207688_10226757 | 3300025901 | Unclassified | 1127 |
| 145 | Ga0207680_10367776 | 3300025903 | Bacteria | 1012 |
| 146 | Ga0207699_10112024 | 3300025906 | Bacteria | 1750 |
| 147 | Ga0207705_11100701 | 3300025909 | Bacteria | 612 |
| 148 | Ga0207654_10061197 | 3300025911 | Bacteria | 2202 |
| 149 | Ga0207707_11295194 | 3300025912 | Bacteria | 586 |
| 150 | Ga0207671_10485940 | 3300025914 | Bacteria | 984 |
| 151 | Ga0207671_10990002 | 3300025914 | Bacteria | 663 |
| 152 | Ga0207693_10383723 | 3300025915 | Bacteria | 1099 |
| 153 | Ga0207693_10429113 | 3300025915 | Bacteria | 1033 |
| 154 | Ga0207663_10731261 | 3300025916 | Unclassified | 785 |
| 155 | Ga0207663_10779156 | 3300025916 | Bacteria | 761 |
| 156 | Ga0207663_11151256 | 3300025916 | Bacteria | 624 |
| 157 | Ga0207662_10035000 | 3300025918 | Bacteria | 2932 |
| 158 | Ga0207657_10006452 | 3300025919 | Bacteria | 12155 |
| 159 | Ga0207657_11507247 | 3300025919 | Unclassified | 502 |
| 160 | Ga0207649_11179829 | 3300025920 | Bacteria | 605 |
| 161 | Ga0207694_10558344 | 3300025924 | Bacteria | 961 |
| 162 | Ga0207650_10919927 | 3300025925 | Bacteria | 743 |
| 163 | Ga0207659_10015553 | 3300025926 | Bacteria | 4934 |
| 164 | Ga0207687_10062195 | 3300025927 | Bacteria | 2639 |
| 165 | Ga0207687_10077354 | 3300025927 | Bacteria | 2393 |
| 166 | Ga0207700_10382285 | 3300025928 | Bacteria | 1231 |
| 167 | Ga0207700_10633722 | 3300025928 | Bacteria | 953 |
| 168 | Ga0207664_10720456 | 3300025929 | Bacteria | 897 |
| 169 | Ga0207644_10490449 | 3300025931 | Unclassified | 1013 |
| 170 | Ga0207690_10194406 | 3300025932 | Bacteria | 1536 |
| 171 | Ga0207690_10569824 | 3300025932 | Bacteria | 922 |
| 172 | Ga0207706_10098192 | 3300025933 | Bacteria | 2576 |
| 173 | Ga0207686_10090337 | 3300025934 | Archaea | 2020 |
| 174 | Ga0207709_10336429 | 3300025935 | Bacteria | 1135 |
| 175 | Ga0207709_11541110 | 3300025935 | Unclassified | 552 |
| 176 | Ga0207709_11712778 | 3300025935 | Unclassified | 523 |
| 177 | Ga0207670_10035361 | 3300025936 | Bacteria | 3238 |
| 178 | Ga0207670_11815351 | 3300025936 | Bacteria | 518 |
| 179 | Ga0207704_10234867 | 3300025938 | Bacteria | 1366 |
| 180 | Ga0207704_10504738 | 3300025938 | Unclassified | 975 |
| 181 | Ga0207704_10640435 | 3300025938 | Unclassified | 874 |
| 182 | Ga0207665_10017247 | 3300025939 | Bacteria | 4743 |
| 183 | Ga0207711_10505558 | 3300025941 | Bacteria | 1126 |
| 184 | Ga0207711_10679595 | 3300025941 | Bacteria | 960 |
| 185 | Ga0207689_10023840 | 3300025942 | Bacteria | 5134 |
| 186 | Ga0207661_10042763 | 3300025944 | Bacteria | 3573 |
| 187 | Ga0207679_10132354 | 3300025945 | Unclassified | 2003 |
| 188 | Ga0207679_11437767 | 3300025945 | Bacteria | 633 |
| 189 | Ga0207667_10617259 | 3300025949 | Bacteria | 1092 |
| 190 | Ga0207712_10189257 | 3300025961 | Bacteria | 1623 |
| 191 | Ga0207712_11266136 | 3300025961 | Bacteria | 659 |
| 192 | Ga0207668_10247586 | 3300025972 | Bacteria | 1446 |
| 193 | Ga0207668_10807734 | 3300025972 | Bacteria | 831 |
| 194 | Ga0207640_10196694 | 3300025981 | Bacteria | 1524 |
| 195 | Ga0207658_11077013 | 3300025986 | Bacteria | 734 |
| 196 | Ga0207677_10280796 | 3300026023 | Unclassified | 1367 |
| 197 | Ga0207677_10456192 | 3300026023 | Bacteria | 1096 |
| 198 | Ga0207703_10314567 | 3300026035 | Bacteria | 1432 |
| 199 | Ga0207703_10720672 | 3300026035 | Bacteria | 949 |
| 200 | Ga0207702_10023825 | 3300026078 | Bacteria | 5078 |
| 201 | Ga0207641_10148052 | 3300026088 | Bacteria | 2125 |
| 202 | Ga0207641_11261548 | 3300026088 | Unclassified | 739 |
| 203 | Ga0207648_10004177 | 3300026089 | Bacteria | 14926 |
| 204 | Ga0207676_10132867 | 3300026095 | Bacteria | 2119 |
| 205 | Ga0207674_10008088 | 3300026116 | Bacteria | 12192 |
| 206 | Ga0207675_102477269 | 3300026118 | Unclassified | 530 |
| 207 | Ga0207683_10071762 | 3300026121 | Bacteria | 3061 |
| 208 | Ga0207683_10750112 | 3300026121 | Bacteria | 906 |
| 209 | Ga0207698_10303385 | 3300026142 | Bacteria | 1487 |
| 210 | Ga0207698_10684321 | 3300026142 | Unclassified | 1019 |
| 211 | Ga0268264_10182984 | 3300028381 | Bacteria | 1905 |
| 212 | Ga0307515_10307154 | 3300028794 | Unclassified | 1265 |
| 213 | Ga0373948_0062174 | 3300034817 | Bacteria | 822 |
| 214 | Ga0373926_0115387 | 3300035083 | Bacteria | 1010 |
| 215 | Ga0373944_0012174 | 3300035089 | Bacteria | 2367 |
| 216 | Ga0373953_0049682 | 3300035117 | Bacteria | 1693 |
| 217 | Ga0373954_0664371 | 3300035118 | Bacteria | 517 |
| 218 | Ga0373943_0026839 | 3300035170 | Unclassified | 2701 |
| 219 | Ga0373946_0009647 | 3300035171 | Bacteria | 3562 |
| 220 | Ga0373955_0087215 | 3300035172 | Unclassified | 1773 |
| 221 | Ga0373924_0021839 | 3300035410 | Bacteria | 2498 |
| 222 | Ga0373931_0508732 | 3300035691 | Bacteria | 778 |
| 223 | Ga0373935_0105294 | 3300035692 | Bacteria | 1865 |
| 224 | Ga0373935_0121531 | 3300035692 | Bacteria | 1745 |
| 225 | Ga0373947_0019909 | 3300035725 | Bacteria | 3873 |
| 226 | Ga0373947_0024465 | 3300035725 | Bacteria | 3519 |
| 227 | Ga0373937_0678344 | 3300036401 | Unclassified | 976 |
| 228 | Ga0373925_0032754 | 3300037068 | Bacteria | 3826 |
| 229 | Ga0373925_0732004 | 3300037068 | Bacteria | 815 |
| 230 | Ga0395900_0136623 | 3300037418 | Bacteria | 2512 |
| 231 | Ga0395898_0584689 | 3300037466 | Bacteria | 1059 |
| 232 | Ga0395898_0722331 | 3300037466 | Bacteria | 938 |
| 233 | Ga0436364_0538701 | 3300037853 | Bacteria | 2562 |
| 234 | Ga0436364_1548415 | 3300037853 | Bacteria | 798 |
| 235 | Ga0395901_0085431 | 3300038443 | Bacteria | 3299 |
| 236 | Ga0395901_0404118 | 3300038443 | Bacteria | 1403 |
| 237 | Ga0395901_0538963 | 3300038443 | Unclassified | 1184 |
| 238 | Ga0436365_0540670 | 3300039437 | Bacteria | 1020 |
| 239 | Ga0436365_1927478 | 3300039437 | Bacteria | 542 |
| 240 | Ga0436360_0367638 | 3300039438 | Bacteria | 696 |
| 241 | Ga0436360_1042244 | 3300039438 | Bacteria | 2396 |
| 242 | Ga0451791_0028386 | 3300041451 | Unclassified | 649 |
| 243 | Ga0451793_0598440 | 3300041452 | Bacteria | 1480 |
| 244 | Ga0451800_0554801 | 3300041459 | Bacteria | 716 |
| 245 | Ga0451800_0902753 | 3300041459 | Unclassified | 652 |
| 246 | Ga0451800_1660513 | 3300041459 | Bacteria | 597 |
| 247 | Ga0451853_0491700 | 3300041512 | Bacteria | 626 |
| 248 | Ga0451853_1406054 | 3300041512 | Unclassified | 1476 |
| 249 | Ga0451853_1512758 | 3300041512 | Bacteria | 612 |
| 250 | Ga0451853_3020805 | 3300041512 | Bacteria | 2087 |
| 251 | Ga0466972_0388994 | 3300044658 | Unclassified | 653 |
| 252 | Ga0466972_0423892 | 3300044658 | Unclassified | 624 |
| 253 | Ga0466965_0376457 | 3300044683 | Bacteria | 781 |
| 254 | Ga0466966_0075630 | 3300044684 | Bacteria | 2104 |
| 255 | Ga0466966_0121772 | 3300044684 | Unclassified | 1602 |
| 256 | Ga0466966_0178409 | 3300044684 | Bacteria | 1289 |
| 257 | Ga0466961_0021290 | 3300044693 | Bacteria | 4174 |
| 258 | Ga0466961_0106937 | 3300044693 | Bacteria | 1761 |
| 259 | Ga0466961_0159882 | 3300044693 | Bacteria | 1404 |
| 260 | Ga0466961_0453765 | 3300044693 | Bacteria | 776 |
| 261 | Ga0466961_0784201 | 3300044693 | Bacteria | 569 |
| 262 | Ga0466963_0006485 | 3300044694 | Bacteria | 6925 |
| 263 | Ga0466963_0009386 | 3300044694 | Bacteria | 5893 |
| 264 | Ga0466963_0125653 | 3300044694 | Bacteria | 1768 |
| 265 | Ga0466963_0130678 | 3300044694 | Bacteria | 1734 |
| 266 | Ga0466963_0342260 | 3300044694 | Bacteria | 1053 |
| 267 | Ga0466963_0553779 | 3300044694 | Unclassified | 812 |
| 268 | Ga0466964_0769208 | 3300044706 | Unclassified | 542 |
| 269 | Ga0466971_0013210 | 3300044719 | Bacteria | 3625 |
| 270 | Ga0466971_0051030 | 3300044719 | Bacteria | 1862 |
| 271 | Ga0466971_0312911 | 3300044719 | Bacteria | 756 |
| 272 | Ga0466970_0691069 | 3300044765 | Bacteria | 595 |
| 273 | Ga0466957_0103567 | 3300044842 | Bacteria | 1797 |
| 274 | Ga0466957_0143242 | 3300044842 | Bacteria | 1541 |
| 275 | Ga0466957_0214394 | 3300044842 | Bacteria | 1269 |
| 276 | Ga0466959_0067681 | 3300045049 | Bacteria | 2589 |
| 277 | Ga0466959_0082068 | 3300045049 | Bacteria | 2323 |
| 278 | Ga0466959_0124131 | 3300045049 | Bacteria | 1833 |
| 279 | Ga0466959_0882090 | 3300045049 | Bacteria | 597 |
| 280 | Ga0466958_0036634 | 3300045836 | Bacteria | 2937 |
| 281 | Ga0466958_0047921 | 3300045836 | Bacteria | 2580 |
| 282 | Ga0466958_0107658 | 3300045836 | Bacteria | 1739 |
| 283 | Ga0466958_0424349 | 3300045836 | Unclassified | 860 |
| 284 | Ga0466967_0032794 | 3300045976 | Bacteria | 4390 |
| 285 | Ga0466967_0042536 | 3300045976 | Bacteria | 3927 |
| 286 | Ga0466967_0280753 | 3300045976 | Bacteria | 1598 |
| 287 | Ga0466967_0858812 | 3300045976 | Bacteria | 902 |
| 288 | Ga0466967_1217106 | 3300045976 | Bacteria | 750 |
| 289 | Ga0495592_0424555 | 3300046454 | Bacteria | 838 |
| 290 | Ga0495603_0066235 | 3300046455 | Bacteria | 2127 |
| 291 | Ga0495603_0130825 | 3300046455 | Bacteria | 1461 |
| 292 | Ga0495629_0331330 | 3300046459 | Unclassified | 1040 |
| 293 | Ga0495629_0530730 | 3300046459 | Bacteria | 791 |
| 294 | Ga0495641_0109354 | 3300046461 | Bacteria | 1233 |
| 295 | Ga0495641_0122960 | 3300046461 | Bacteria | 1158 |
| 296 | Ga0495651_0171878 | 3300046462 | Bacteria | 1542 |
| 297 | Ga0495653_0218364 | 3300046463 | Bacteria | 1283 |
| 298 | Ga0495580_0004988 | 3300046472 | Bacteria | 11081 |
| 299 | Ga0495582_0068536 | 3300046473 | Bacteria | 1960 |
| 300 | Ga0495582_0216142 | 3300046473 | Bacteria | 1096 |
| 301 | Ga0495639_0098029 | 3300046475 | Bacteria | 1381 |
| 302 | Ga0495662_0045382 | 3300046476 | Bacteria | 2121 |
| 303 | Ga0495664_0063599 | 3300046477 | Bacteria | 2199 |
| 304 | Ga0495594_0116237 | 3300046499 | Bacteria | 1510 |
| 305 | Ga0495608_0925049 | 3300046511 | Unclassified | 509 |
| 306 | Ga0495618_0146483 | 3300046514 | Bacteria | 1509 |
| 307 | Ga0495628_0365293 | 3300046516 | Bacteria | 1059 |
| 308 | Ga0495630_0290852 | 3300046517 | Bacteria | 1248 |
| 309 | Ga0495666_0011517 | 3300046526 | Bacteria | 4410 |
| 310 | Ga0495652_0545835 | 3300046529 | Bacteria | 798 |
| 311 | Ga0495665_0004476 | 3300046531 | Bacteria | 7539 |
| 312 | Ga0495640_0111913 | 3300046533 | Unclassified | 1783 |
| 313 | Ga0495640_0124402 | 3300046533 | Bacteria | 1673 |
| 314 | Ga0495586_0053352 | 3300046535 | Bacteria | 2190 |
| 315 | Ga0495587_0057944 | 3300046536 | Bacteria | 2276 |
| 316 | Ga0495587_0668687 | 3300046536 | Bacteria | 570 |
| 317 | Ga0495667_0003138 | 3300046559 | Bacteria | 11084 |
| 318 | Ga0495634_0020996 | 3300046642 | Bacteria | 4624 |
| 319 | Ga0495635_0088710 | 3300046663 | Bacteria | 2116 |
| 320 | Ga0495635_0088826 | 3300046663 | Bacteria | 2114 |
| 321 | Ga0495659_0212584 | 3300046664 | Bacteria | 796 |
| 322 | Ga0495588_0628365 | 3300046674 | Bacteria | 562 |
| 323 | Ga0495599_0458159 | 3300046678 | Bacteria | 754 |
| 324 | Ga0495646_0186869 | 3300046680 | Bacteria | 1134 |
| 325 | Ga0495647_0015584 | 3300046681 | Unclassified | 2665 |
| 326 | Ga0495647_0179587 | 3300046681 | Bacteria | 920 |
| 327 | Ga0495658_0043219 | 3300046683 | Bacteria | 2519 |
| 328 | Ga0495658_0051590 | 3300046683 | Bacteria | 2330 |
| 329 | Ga0495658_0434472 | 3300046683 | Unclassified | 838 |
| 330 | Ga0495624_0043330 | 3300046690 | Bacteria | 2871 |
| 331 | Ga0495624_0213044 | 3300046690 | Unclassified | 1171 |
| 332 | Ga0495670_0344256 | 3300046691 | Bacteria | 802 |
| 333 | Ga0495600_0075090 | 3300046809 | Bacteria | 2207 |
| 334 | Ga0495581_0009567 | 3300047315 | Bacteria | 5604 |
| 335 | Ga0495581_0167412 | 3300047315 | Bacteria | 1285 |
| 336 | Ga0495674_0027372 | 3300047319 | Bacteria | 5210 |
| 337 | Ga0495674_0046290 | 3300047319 | Bacteria | 3861 |
| 338 | Ga0495676_0072164 | 3300047321 | Bacteria | 2652 |
| 339 | Ga0495676_0122479 | 3300047321 | Bacteria | 1890 |
| 340 | Ga0495680_0591146 | 3300047322 | Bacteria | 744 |
| 341 | Ga0495675_0115188 | 3300047444 | Unclassified | 1676 |
| 342 | Ga0495684_0001638 | 3300047471 | Bacteria | 17976 |
| 343 | Ga0495593_0036864 | 3300047673 | Unclassified | 2648 |
| 344 | Ga0495602_0612531 | 3300048088 | Archaea | 747 |
| 345 | Ga0495602_0692291 | 3300048088 | Bacteria | 692 |
| 346 | Ga0495614_0095828 | 3300048089 | Bacteria | 1293 |
| 347 | Ga0496100_0216535 | 3300048903 | Bacteria | 1403 |
| 348 | Ga0496100_0588116 | 3300048903 | Bacteria | 863 |
| 349 | Ga0496100_0678464 | 3300048903 | Bacteria | 803 |
| 350 | Ga0496101_0175034 | 3300048904 | Archaea | 1650 |
| 351 | Ga0496101_0635491 | 3300048904 | Bacteria | 843 |
| 352 | Ga0496101_1129063 | 3300048904 | Unclassified | 615 |
| 353 | Ga0496102_0423162 | 3300048905 | Unclassified | 1251 |
| 354 | Ga0496102_0514324 | 3300048905 | Bacteria | 1120 |
| 355 | Ga0496102_0909000 | 3300048905 | Bacteria | 802 |
| 356 | Ga0496103_0737757 | 3300048906 | Unclassified | 623 |
| 357 | Ga0496104_0240270 | 3300048907 | Bacteria | 1723 |
| 358 | Ga0496104_0281528 | 3300048907 | Unclassified | 1576 |
| 359 | Ga0496105_0243855 | 3300048908 | Bacteria | 1457 |
| 360 | Ga0496105_0463059 | 3300048908 | Unclassified | 999 |
| 361 | Ga0496106_0089319 | 3300048909 | Bacteria | 2376 |
| 362 | Ga0496106_0367564 | 3300048909 | Bacteria | 1156 |
| 363 | Ga0496106_0723297 | 3300048909 | Bacteria | 792 |
| 364 | Ga0496108_0006411 | 3300048911 | Bacteria | 9540 |
| 365 | Ga0496108_0241618 | 3300048911 | Unclassified | 1571 |
| 366 | Ga0496108_1383175 | 3300048911 | Bacteria | 589 |
| 367 | Ga0496109_0176057 | 3300048912 | Bacteria | 2008 |
| 368 | Ga0496109_0187101 | 3300048912 | Unclassified | 1946 |
| 369 | Ga0496109_0198845 | 3300048912 | Bacteria | 1884 |
| 370 | Ga0496110_0063637 | 3300048913 | Bacteria | 3259 |
| 371 | Ga0496110_0670885 | 3300048913 | Unclassified | 937 |
| 372 | Ga0496110_1604484 | 3300048913 | Bacteria | 561 |
| 373 | Ga0496111_0024437 | 3300048914 | Bacteria | 4254 |
| 374 | Ga0496112_0060218 | 3300048915 | Bacteria | 3741 |
| 375 | Ga0496112_0121067 | 3300048915 | Bacteria | 2586 |
| 376 | Ga0496112_0571480 | 3300048915 | Bacteria | 1063 |
| 377 | Ga0496113_0201409 | 3300048916 | Bacteria | 1582 |
| 378 | Ga0496113_0429260 | 3300048916 | Bacteria | 1062 |
| 379 | Ga0496113_1383609 | 3300048916 | Bacteria | 545 |
| 380 | Ga0496114_0059078 | 3300048917 | Bacteria | 3203 |
| 381 | Ga0496114_0171433 | 3300048917 | Bacteria | 1891 |
| 382 | Ga0496114_1319196 | 3300048917 | Unclassified | 609 |
| 383 | Ga0496115_0019529 | 3300048918 | Bacteria | 5216 |
| 384 | Ga0496115_0430112 | 3300048918 | Bacteria | 1068 |
| 385 | Ga0496115_1004310 | 3300048918 | Bacteria | 637 |
| 386 | Ga0501031_0027962 | 3300049568 | Bacteria | 3675 |
| 387 | Ga0501031_0542453 | 3300049568 | Unclassified | 749 |
| 388 | Ga0501031_0854400 | 3300049568 | Unclassified | 583 |
| 389 | Ga0501032_0050274 | 3300049569 | Bacteria | 2811 |
| 390 | Ga0501033_0004884 | 3300049570 | Bacteria | 10677 |
| 391 | Ga0501033_0116775 | 3300049570 | Bacteria | 1938 |
| 392 | Ga0501033_0131576 | 3300049570 | Bacteria | 1812 |
| 393 | Ga0501034_0064576 | 3300049571 | Bacteria | 3674 |
| 394 | Ga0501034_0101959 | 3300049571 | Bacteria | 2863 |
| 395 | Ga0501034_0261213 | 3300049571 | Bacteria | 1674 |
| 396 | Ga0501034_0700267 | 3300049571 | Bacteria | 911 |
| 397 | Ga0501036_0133206 | 3300049572 | Bacteria | 2097 |
| 398 | Ga0501036_0134134 | 3300049572 | Bacteria | 2089 |
| 399 | Ga0501036_0264193 | 3300049572 | Unclassified | 1441 |
| 400 | Ga0501037_0070232 | 3300049573 | Bacteria | 2548 |
| 401 | Ga0501037_0099130 | 3300049573 | Bacteria | 2104 |
| 402 | Ga0501038_0068104 | 3300049574 | Bacteria | 3026 |
| 403 | Ga0501038_0416403 | 3300049574 | Bacteria | 1037 |
| 404 | Ga0501039_0044096 | 3300049575 | Bacteria | 3444 |
| 405 | Ga0501039_0257392 | 3300049575 | Bacteria | 1372 |
| 406 | Ga0501042_0073236 | 3300049578 | Bacteria | 2450 |
| 407 | Ga0501043_0044487 | 3300049579 | Bacteria | 3491 |
| 408 | Ga0501043_0123606 | 3300049579 | Bacteria | 2029 |
| 409 | Ga0501043_0126915 | 3300049579 | Bacteria | 2000 |
| 410 | Ga0501046_0161736 | 3300049580 | Unclassified | 1683 |
| 411 | Ga0501046_0230822 | 3300049580 | Bacteria | 1367 |
| 412 | Ga0501046_0798374 | 3300049580 | Bacteria | 661 |
| 413 | Ga0501047_0029477 | 3300049581 | Bacteria | 5290 |
| 414 | Ga0501047_0242501 | 3300049581 | Unclassified | 1652 |
| 415 | Ga0501048_0002568 | 3300049582 | Bacteria | 13908 |
| 416 | Ga0501069_0242591 | 3300049585 | Bacteria | 1050 |
| 417 | Ga0501070_0110346 | 3300049586 | Bacteria | 2273 |
| 418 | Ga0501070_0483813 | 3300049586 | Unclassified | 995 |
| 419 | Ga0501073_0010517 | 3300049589 | Bacteria | 6778 |
| 420 | Ga0501073_0113394 | 3300049589 | Bacteria | 1880 |
| 421 | Ga0501074_0798026 | 3300049590 | Unclassified | 665 |
| 422 | Ga0501080_0106668 | 3300049742 | Bacteria | 2596 |
| 423 | Ga0501080_0180264 | 3300049742 | Bacteria | 1944 |
| 424 | Ga0501035_0026641 | 3300049822 | Bacteria | 5288 |
| 425 | Ga0501035_0148821 | 3300049822 | Bacteria | 2032 |
| 426 | Ga0501035_0162808 | 3300049822 | Unclassified | 1930 |
| 427 | Ga0501035_0181441 | 3300049822 | Bacteria | 1813 |
| 428 | Ga0501044_0127755 | 3300049823 | Bacteria | 2538 |
| 429 | Ga0501044_0177489 | 3300049823 | Bacteria | 2098 |
| 430 | Ga0501044_0199697 | 3300049823 | Bacteria | 1958 |
| 431 | Ga0501045_0608348 | 3300049824 | Unclassified | 809 |
| 432 | nmdc:mga0n895_1483_c1 | 3300050512 | Bacteria | 17595 |
| 433 | nmdc:mga0rr50_1358521_c1 | 3300050513 | Unclassified | 602 |
| 434 | nmdc:mga0rr50_16956_c1 | 3300050513 | Bacteria | 4851 |
| 435 | nmdc:mga08x19_9967_c1 | 3300050514 | Bacteria | 5696 |
| 436 | Ga0495601_0004605 | 3300053077 | Bacteria | 7979 |
| 437 | Ga0495601_0083924 | 3300053077 | Bacteria | 2046 |
| 438 | Ga0495612_0440703 | 3300053078 | Bacteria | 594 |
| 439 | Ga0495595_0079109 | 3300053084 | Bacteria | 1563 |
| 440 | Ga0495619_0076679 | 3300053085 | Bacteria | 2244 |
| 441 | Ga0495619_0102571 | 3300053085 | Bacteria | 1948 |
| 442 | Ga0495619_0764791 | 3300053085 | Unclassified | 654 |
| 443 | Ga0501084_0176464 | 3300054114 | Bacteria | 1804 |
| 444 | Ga0501084_1140749 | 3300054114 | Unclassified | 654 |
| 445 | Ga0466962_0016550 | 3300061719 | Bacteria | 3556 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041451 | Ga0451791_0028386 | Ga0451791_0028386_250_570 | 90 |
| 2 | 3300041512 | Ga0451853_1406054 | Ga0451853_1406054_737_1036 | 92 |
| 3 | 3300005456 | Ga0070678_100243661 | Ga0070678_1002436611 | 95 |
| 4 | 3300011119 | Ga0105246_11628393 | Ga0105246_116283932 | 95 |
| 5 | 3300014325 | Ga0163163_12405881 | Ga0163163_124058811 | 95 |
| 6 | 3300028794 | Ga0307515_10307154 | Ga0307515_103071542 | 96 |
| 7 | 3300034817 | Ga0373948_0062174 | Ga0373948_0062174_245_559 | 96 |
| 8 | 3300005329 | Ga0070683_100014804 | Ga0070683_1000148042 | 99 |
| 9 | 3300005331 | Ga0070670_101142706 | Ga0070670_1011427062 | 99 |
| 10 | 3300005344 | Ga0070661_101247046 | Ga0070661_1012470461 | 99 |
| 11 | 3300005353 | Ga0070669_101656173 | Ga0070669_1016561731 | 99 |
| 12 | 3300005535 | Ga0070684_100090621 | Ga0070684_1000906213 | 99 |
| 13 | 3300005564 | Ga0070664_100715305 | Ga0070664_1007153052 | 99 |
| 14 | 3300005577 | Ga0068857_100038584 | Ga0068857_1000385844 | 99 |
| 15 | 3300005718 | Ga0068866_10528390 | Ga0068866_105283901 | 99 |
| 16 | 3300006846 | Ga0075430_100261305 | Ga0075430_1002613053 | 99 |
| 17 | 3300006880 | Ga0075429_100242477 | Ga0075429_1002424772 | 99 |
| 18 | 3300009098 | Ga0105245_10213779 | Ga0105245_102137792 | 99 |
| 19 | 3300009147 | Ga0114129_10333810 | Ga0114129_103338102 | 99 |
| 20 | 3300009148 | Ga0105243_10929672 | Ga0105243_109296721 | 99 |
| 21 | 3300009553 | Ga0105249_10243764 | Ga0105249_102437642 | 99 |
| 22 | 3300010375 | Ga0105239_10242882 | Ga0105239_102428823 | 99 |
| 23 | 3300014745 | Ga0157377_10527650 | Ga0157377_105276502 | 99 |
| 24 | 3300025899 | Ga0207642_10336242 | Ga0207642_103362422 | 99 |
| 25 | 3300025925 | Ga0207650_10919927 | Ga0207650_109199272 | 99 |
| 26 | 3300025935 | Ga0207709_11712778 | Ga0207709_117127782 | 99 |
| 27 | 3300025938 | Ga0207704_10504738 | Ga0207704_105047382 | 99 |
| 28 | 3300025944 | Ga0207661_10042763 | Ga0207661_100427633 | 99 |
| 29 | 3300025945 | Ga0207679_10132354 | Ga0207679_101323544 | 99 |
| 30 | 3300026116 | Ga0207674_10008088 | Ga0207674_100080885 | 99 |
| 31 | 3300038443 | Ga0395901_0538963 | Ga0395901_0538963_754_1053 | 99 |
| 32 | 3300041459 | Ga0451800_1660513 | Ga0451800_1660513_185_484 | 99 |
| 33 | 3300044693 | Ga0466961_0159882 | Ga0466961_0159882_1038_1337 | 99 |
| 34 | 3300048905 | Ga0496102_0514324 | Ga0496102_0514324_791_1090 | 99 |
| 35 | 3300048911 | Ga0496108_0241618 | Ga0496108_0241618_1148_1447 | 99 |
| 36 | 3300048912 | Ga0496109_0176057 | Ga0496109_0176057_974_1273 | 99 |
| 37 | 3300048913 | Ga0496110_0670885 | Ga0496110_0670885_424_723 | 99 |
| 38 | 3300050513 | nmdc:mga0rr50_1358521_c1 | nmdc:mga0rr50_1358521_c1_230_529 | 99 |
| 39 | 3300005985 | Ga0081539_10001335 | Ga0081539_1000133546 | 102 |
| 40 | 3300037418 | Ga0395900_0136623 | Ga0395900_0136623_390_701 | 103 |
| 41 | 3300037466 | Ga0395898_0584689 | Ga0395898_0584689_558_869 | 103 |
| 42 | 3300038443 | Ga0395901_0404118 | Ga0395901_0404118_832_1143 | 103 |
| 43 | 3300044694 | Ga0466963_0125653 | Ga0466963_0125653_516_827 | 103 |
| 44 | 3300044719 | Ga0466971_0312911 | Ga0466971_0312911_16_327 | 103 |
| 45 | 3300044842 | Ga0466957_0143242 | Ga0466957_0143242_1148_1459 | 103 |
| 46 | 3300005329 | Ga0070683_100206107 | Ga0070683_1002061072 | 104 |
| 47 | 3300005364 | Ga0070673_100182674 | Ga0070673_1001826742 | 104 |
| 48 | 3300005366 | Ga0070659_100612005 | Ga0070659_1006120052 | 104 |
| 49 | 3300005435 | Ga0070714_100827429 | Ga0070714_1008274291 | 104 |
| 50 | 3300005436 | Ga0070713_101849476 | Ga0070713_1018494761 | 104 |
| 51 | 3300005438 | Ga0070701_10976890 | Ga0070701_109768901 | 104 |
| 52 | 3300005439 | Ga0070711_100887359 | Ga0070711_1008873592 | 104 |
| 53 | 3300005439 | Ga0070711_100955256 | Ga0070711_1009552561 | 104 |
| 54 | 3300005441 | Ga0070700_100525076 | Ga0070700_1005250762 | 104 |
| 55 | 3300005539 | Ga0068853_101810248 | Ga0068853_1018102482 | 104 |
| 56 | 3300005544 | Ga0070686_100203406 | Ga0070686_1002034061 | 104 |
| 57 | 3300005564 | Ga0070664_102261519 | Ga0070664_1022615191 | 104 |
| 58 | 3300005719 | Ga0068861_100321208 | Ga0068861_1003212082 | 104 |
| 59 | 3300006175 | Ga0070712_100193602 | Ga0070712_1001936022 | 104 |
| 60 | 3300007076 | Ga0075435_100517416 | Ga0075435_1005174162 | 104 |
| 61 | 3300025901 | Ga0207688_10226757 | Ga0207688_102267572 | 104 |
| 62 | 3300025914 | Ga0207671_10485940 | Ga0207671_104859402 | 104 |
| 63 | 3300025915 | Ga0207693_10429113 | Ga0207693_104291132 | 104 |
| 64 | 3300025916 | Ga0207663_10731261 | Ga0207663_107312612 | 104 |
| 65 | 3300025916 | Ga0207663_10779156 | Ga0207663_107791561 | 104 |
| 66 | 3300025919 | Ga0207657_11507247 | Ga0207657_115072471 | 104 |
| 67 | 3300025927 | Ga0207687_10077354 | Ga0207687_100773542 | 104 |
| 68 | 3300025932 | Ga0207690_10569824 | Ga0207690_105698242 | 104 |
| 69 | 3300025945 | Ga0207679_11437767 | Ga0207679_114377672 | 104 |
| 70 | 3300025961 | Ga0207712_10189257 | Ga0207712_101892572 | 104 |
| 71 | 3300026023 | Ga0207677_10280796 | Ga0207677_102807962 | 104 |
| 72 | 3300037853 | Ga0436364_0538701 | Ga0436364_0538701_2181_2495 | 104 |
| 73 | 3300037853 | Ga0436364_1548415 | Ga0436364_1548415_457_771 | 104 |
| 74 | 3300039437 | Ga0436365_0540670 | Ga0436365_0540670_392_706 | 104 |
| 75 | 3300039437 | Ga0436365_1927478 | Ga0436365_1927478_136_450 | 104 |
| 76 | 3300039438 | Ga0436360_1042244 | Ga0436360_1042244_1302_1616 | 104 |
| 77 | 3300041452 | Ga0451793_0598440 | Ga0451793_0598440_480_794 | 104 |
| 78 | 3300041459 | Ga0451800_0554801 | Ga0451800_0554801_143_457 | 104 |
| 79 | 3300041459 | Ga0451800_0902753 | Ga0451800_0902753_170_484 | 104 |
| 80 | 3300041512 | Ga0451853_0491700 | Ga0451853_0491700_182_496 | 104 |
| 81 | 3300041512 | Ga0451853_3020805 | Ga0451853_3020805_1157_1471 | 104 |
| 82 | 3300044658 | Ga0466972_0388994 | Ga0466972_0388994_126_440 | 104 |
| 83 | 3300044658 | Ga0466972_0423892 | Ga0466972_0423892_293_607 | 104 |
| 84 | 3300044683 | Ga0466965_0376457 | Ga0466965_0376457_450_764 | 104 |
| 85 | 3300044684 | Ga0466966_0075630 | Ga0466966_0075630_1260_1574 | 104 |
| 86 | 3300044684 | Ga0466966_0121772 | Ga0466966_0121772_113_427 | 104 |
| 87 | 3300044684 | Ga0466966_0178409 | Ga0466966_0178409_430_744 | 104 |
| 88 | 3300044693 | Ga0466961_0021290 | Ga0466961_0021290_2411_2725 | 104 |
| 89 | 3300044693 | Ga0466961_0106937 | Ga0466961_0106937_235_549 | 104 |
| 90 | 3300044693 | Ga0466961_0453765 | Ga0466961_0453765_254_568 | 104 |
| 91 | 3300044693 | Ga0466961_0784201 | Ga0466961_0784201_167_481 | 104 |
| 92 | 3300044694 | Ga0466963_0006485 | Ga0466963_0006485_3140_3454 | 104 |
| 93 | 3300044694 | Ga0466963_0009386 | Ga0466963_0009386_607_921 | 104 |
| 94 | 3300044694 | Ga0466963_0342260 | Ga0466963_0342260_534_848 | 104 |
| 95 | 3300044719 | Ga0466971_0051030 | Ga0466971_0051030_297_611 | 104 |
| 96 | 3300044765 | Ga0466970_0691069 | Ga0466970_0691069_174_488 | 104 |
| 97 | 3300044842 | Ga0466957_0214394 | Ga0466957_0214394_216_530 | 104 |
| 98 | 3300045049 | Ga0466959_0067681 | Ga0466959_0067681_168_482 | 104 |
| 99 | 3300045049 | Ga0466959_0082068 | Ga0466959_0082068_816_1130 | 104 |
| 100 | 3300045049 | Ga0466959_0124131 | Ga0466959_0124131_1286_1600 | 104 |
| 101 | 3300045049 | Ga0466959_0882090 | Ga0466959_0882090_62_376 | 104 |
| 102 | 3300045836 | Ga0466958_0047921 | Ga0466958_0047921_1433_1747 | 104 |
| 103 | 3300045836 | Ga0466958_0107658 | Ga0466958_0107658_1099_1413 | 104 |
| 104 | 3300045836 | Ga0466958_0424349 | Ga0466958_0424349_94_408 | 104 |
| 105 | 3300045976 | Ga0466967_0032794 | Ga0466967_0032794_1571_1885 | 104 |
| 106 | 3300046459 | Ga0495629_0331330 | Ga0495629_0331330_698_1015 | 104 |
| 107 | 3300046461 | Ga0495641_0122960 | Ga0495641_0122960_417_734 | 104 |
| 108 | 3300046664 | Ga0495659_0212584 | Ga0495659_0212584_244_558 | 104 |
| 109 | 3300046683 | Ga0495658_0434472 | Ga0495658_0434472_243_560 | 104 |
| 110 | 3300047321 | Ga0495676_0122479 | Ga0495676_0122479_999_1316 | 104 |
| 111 | 3300047322 | Ga0495680_0591146 | Ga0495680_0591146_112_426 | 104 |
| 112 | 3300048904 | Ga0496101_1129063 | Ga0496101_1129063_35_349 | 104 |
| 113 | 3300048905 | Ga0496102_0909000 | Ga0496102_0909000_336_650 | 104 |
| 114 | 3300048907 | Ga0496104_0281528 | Ga0496104_0281528_584_898 | 104 |
| 115 | 3300048911 | Ga0496108_1383175 | Ga0496108_1383175_77_391 | 104 |
| 116 | 3300048912 | Ga0496109_0187101 | Ga0496109_0187101_1190_1504 | 104 |
| 117 | 3300048917 | Ga0496114_1319196 | Ga0496114_1319196_49_363 | 104 |
| 118 | 3300061719 | Ga0466962_0016550 | Ga0466962_0016550_1760_2074 | 104 |
| 119 | 3300005327 | Ga0070658_11618391 | Ga0070658_116183911 | 105 |
| 120 | 3300005330 | Ga0070690_100371982 | Ga0070690_1003719822 | 105 |
| 121 | 3300005334 | Ga0068869_100017791 | Ga0068869_1000177917 | 105 |
| 122 | 3300005336 | Ga0070680_100214667 | Ga0070680_1002146672 | 105 |
| 123 | 3300005337 | Ga0070682_100024463 | Ga0070682_1000244632 | 105 |
| 124 | 3300005338 | Ga0068868_100274730 | Ga0068868_1002747303 | 105 |
| 125 | 3300005339 | Ga0070660_100011443 | Ga0070660_1000114435 | 105 |
| 126 | 3300005340 | Ga0070689_100056537 | Ga0070689_1000565372 | 105 |
| 127 | 3300005340 | Ga0070689_100506438 | Ga0070689_1005064382 | 105 |
| 128 | 3300005341 | Ga0070691_10035274 | Ga0070691_100352744 | 105 |
| 129 | 3300005344 | Ga0070661_100122232 | Ga0070661_1001222322 | 105 |
| 130 | 3300005354 | Ga0070675_100043550 | Ga0070675_1000435503 | 105 |
| 131 | 3300005355 | Ga0070671_100730911 | Ga0070671_1007309111 | 105 |
| 132 | 3300005364 | Ga0070673_100634849 | Ga0070673_1006348492 | 105 |
| 133 | 3300005365 | Ga0070688_100136236 | Ga0070688_1001362362 | 105 |
| 134 | 3300005365 | Ga0070688_100209485 | Ga0070688_1002094852 | 105 |
| 135 | 3300005367 | Ga0070667_100243879 | Ga0070667_1002438791 | 105 |
| 136 | 3300005367 | Ga0070667_100851485 | Ga0070667_1008514852 | 105 |
| 137 | 3300005406 | Ga0070703_10038477 | Ga0070703_100384771 | 105 |
| 138 | 3300005435 | Ga0070714_100340017 | Ga0070714_1003400172 | 105 |
| 139 | 3300005437 | Ga0070710_10454778 | Ga0070710_104547782 | 105 |
| 140 | 3300005438 | Ga0070701_10857964 | Ga0070701_108579642 | 105 |
| 141 | 3300005439 | Ga0070711_100383130 | Ga0070711_1003831302 | 105 |
| 142 | 3300005439 | Ga0070711_101805243 | Ga0070711_1018052431 | 105 |
| 143 | 3300005445 | Ga0070708_101145629 | Ga0070708_1011456292 | 105 |
| 144 | 3300005456 | Ga0070678_100714825 | Ga0070678_1007148252 | 105 |
| 145 | 3300005457 | Ga0070662_100691972 | Ga0070662_1006919721 | 105 |
| 146 | 3300005458 | Ga0070681_11697287 | Ga0070681_116972871 | 105 |
| 147 | 3300005459 | Ga0068867_100847455 | Ga0068867_1008474551 | 105 |
| 148 | 3300005466 | Ga0070685_10435427 | Ga0070685_104354272 | 105 |
| 149 | 3300005466 | Ga0070685_10623299 | Ga0070685_106232992 | 105 |
| 150 | 3300005471 | Ga0070698_100242578 | Ga0070698_1002425782 | 105 |
| 151 | 3300005535 | Ga0070684_101637243 | Ga0070684_1016372431 | 105 |
| 152 | 3300005539 | Ga0068853_100177259 | Ga0068853_1001772592 | 105 |
| 153 | 3300005539 | Ga0068853_100787043 | Ga0068853_1007870431 | 105 |
| 154 | 3300005543 | Ga0070672_100689148 | Ga0070672_1006891482 | 105 |
| 155 | 3300005544 | Ga0070686_100166511 | Ga0070686_1001665112 | 105 |
| 156 | 3300005545 | Ga0070695_100478992 | Ga0070695_1004789922 | 105 |
| 157 | 3300005546 | Ga0070696_100429436 | Ga0070696_1004294361 | 105 |
| 158 | 3300005547 | Ga0070693_100036853 | Ga0070693_1000368532 | 105 |
| 159 | 3300005548 | Ga0070665_101076159 | Ga0070665_1010761592 | 105 |
| 160 | 3300005549 | Ga0070704_101135194 | Ga0070704_1011351942 | 105 |
| 161 | 3300005563 | Ga0068855_101015824 | Ga0068855_1010158243 | 105 |
| 162 | 3300005564 | Ga0070664_100897600 | Ga0070664_1008976002 | 105 |
| 163 | 3300005578 | Ga0068854_100317823 | Ga0068854_1003178232 | 105 |
| 164 | 3300005614 | Ga0068856_100004824 | Ga0068856_1000048248 | 105 |
| 165 | 3300005615 | Ga0070702_100024021 | Ga0070702_1000240212 | 105 |
| 166 | 3300005616 | Ga0068852_100616180 | Ga0068852_1006161802 | 105 |
| 167 | 3300005616 | Ga0068852_100892105 | Ga0068852_1008921052 | 105 |
| 168 | 3300005617 | Ga0068859_100537601 | Ga0068859_1005376012 | 105 |
| 169 | 3300005618 | Ga0068864_100291430 | Ga0068864_1002914302 | 105 |
| 170 | 3300005718 | Ga0068866_10018861 | Ga0068866_100188612 | 105 |
| 171 | 3300005719 | Ga0068861_100136491 | Ga0068861_1001364912 | 105 |
| 172 | 3300005719 | Ga0068861_100269446 | Ga0068861_1002694463 | 105 |
| 173 | 3300005841 | Ga0068863_100282055 | Ga0068863_1002820552 | 105 |
| 174 | 3300005842 | Ga0068858_100346306 | Ga0068858_1003463062 | 105 |
| 175 | 3300005843 | Ga0068860_100221012 | Ga0068860_1002210123 | 105 |
| 176 | 3300005843 | Ga0068860_101084117 | Ga0068860_1010841172 | 105 |
| 177 | 3300005937 | Ga0081455_10001958 | Ga0081455_1000195824 | 105 |
| 178 | 3300005937 | Ga0081455_10038490 | Ga0081455_100384906 | 105 |
| 179 | 3300006028 | Ga0070717_10402681 | Ga0070717_104026812 | 105 |
| 180 | 3300006028 | Ga0070717_10777684 | Ga0070717_107776842 | 105 |
| 181 | 3300006173 | Ga0070716_100083892 | Ga0070716_1000838922 | 105 |
| 182 | 3300006175 | Ga0070712_100798879 | Ga0070712_1007988792 | 105 |
| 183 | 3300006175 | Ga0070712_101569907 | Ga0070712_1015699072 | 105 |
| 184 | 3300006358 | Ga0068871_100169120 | Ga0068871_1001691202 | 105 |
| 185 | 3300006871 | Ga0075434_100001098 | Ga0075434_10000109812 | 105 |
| 186 | 3300006881 | Ga0068865_100311032 | Ga0068865_1003110322 | 105 |
| 187 | 3300006914 | Ga0075436_100014593 | Ga0075436_1000145932 | 105 |
| 188 | 3300006931 | Ga0097620_100537574 | Ga0097620_1005375742 | 105 |
| 189 | 3300007076 | Ga0075435_100013491 | Ga0075435_1000134917 | 105 |
| 190 | 3300009098 | Ga0105245_10148865 | Ga0105245_101488653 | 105 |
| 191 | 3300009098 | Ga0105245_10263414 | Ga0105245_102634142 | 105 |
| 192 | 3300009098 | Ga0105245_10723872 | Ga0105245_107238722 | 105 |
| 193 | 3300009101 | Ga0105247_10029724 | Ga0105247_100297243 | 105 |
| 194 | 3300009148 | Ga0105243_10007737 | Ga0105243_1000773710 | 105 |
| 195 | 3300009148 | Ga0105243_10157943 | Ga0105243_101579433 | 105 |
| 196 | 3300009174 | Ga0105241_10615228 | Ga0105241_106152281 | 105 |
| 197 | 3300009176 | Ga0105242_10004600 | Ga0105242_100046004 | 105 |
| 198 | 3300009176 | Ga0105242_10064040 | Ga0105242_100640403 | 105 |
| 199 | 3300009177 | Ga0105248_10092363 | Ga0105248_100923633 | 105 |
| 200 | 3300009177 | Ga0105248_10754413 | Ga0105248_107544132 | 105 |
| 201 | 3300009545 | Ga0105237_11567022 | Ga0105237_115670222 | 105 |
| 202 | 3300009551 | Ga0105238_10106683 | Ga0105238_101066835 | 105 |
| 203 | 3300009553 | Ga0105249_13586917 | Ga0105249_135869171 | 105 |
| 204 | 3300011119 | Ga0105246_10005561 | Ga0105246_100055617 | 105 |
| 205 | 3300013296 | Ga0157374_10011853 | Ga0157374_100118536 | 105 |
| 206 | 3300013297 | Ga0157378_10324102 | Ga0157378_103241023 | 105 |
| 207 | 3300013297 | Ga0157378_10498292 | Ga0157378_104982922 | 105 |
| 208 | 3300013306 | Ga0163162_10109619 | Ga0163162_101096192 | 105 |
| 209 | 3300013307 | Ga0157372_10804468 | Ga0157372_108044681 | 105 |
| 210 | 3300013308 | Ga0157375_10169707 | Ga0157375_101697073 | 105 |
| 211 | 3300013308 | Ga0157375_13626900 | Ga0157375_136269001 | 105 |
| 212 | 3300014325 | Ga0163163_10067164 | Ga0163163_100671645 | 105 |
| 213 | 3300014326 | Ga0157380_11525643 | Ga0157380_115256432 | 105 |
| 214 | 3300014497 | Ga0182008_10205076 | Ga0182008_102050762 | 105 |
| 215 | 3300014745 | Ga0157377_10244954 | Ga0157377_102449542 | 105 |
| 216 | 3300014745 | Ga0157377_10972888 | Ga0157377_109728881 | 105 |
| 217 | 3300014968 | Ga0157379_10065585 | Ga0157379_100655855 | 105 |
| 218 | 3300014969 | Ga0157376_10272270 | Ga0157376_102722702 | 105 |
| 219 | 3300014969 | Ga0157376_10426079 | Ga0157376_104260792 | 105 |
| 220 | 3300017792 | Ga0163161_11123798 | Ga0163161_111237982 | 105 |
| 221 | 3300025885 | Ga0207653_10256158 | Ga0207653_102561582 | 105 |
| 222 | 3300025898 | Ga0207692_10591589 | Ga0207692_105915892 | 105 |
| 223 | 3300025899 | Ga0207642_10848028 | Ga0207642_108480281 | 105 |
| 224 | 3300025900 | Ga0207710_10017031 | Ga0207710_100170312 | 105 |
| 225 | 3300025901 | Ga0207688_10019661 | Ga0207688_100196613 | 105 |
| 226 | 3300025903 | Ga0207680_10367776 | Ga0207680_103677762 | 105 |
| 227 | 3300025906 | Ga0207699_10112024 | Ga0207699_101120242 | 105 |
| 228 | 3300025909 | Ga0207705_11100701 | Ga0207705_111007011 | 105 |
| 229 | 3300025911 | Ga0207654_10061197 | Ga0207654_100611972 | 105 |
| 230 | 3300025912 | Ga0207707_11295194 | Ga0207707_112951941 | 105 |
| 231 | 3300025914 | Ga0207671_10990002 | Ga0207671_109900021 | 105 |
| 232 | 3300025915 | Ga0207693_10383723 | Ga0207693_103837232 | 105 |
| 233 | 3300025916 | Ga0207663_11151256 | Ga0207663_111512562 | 105 |
| 234 | 3300025918 | Ga0207662_10035000 | Ga0207662_100350005 | 105 |
| 235 | 3300025919 | Ga0207657_10006452 | Ga0207657_100064526 | 105 |
| 236 | 3300025920 | Ga0207649_11179829 | Ga0207649_111798292 | 105 |
| 237 | 3300025924 | Ga0207694_10558344 | Ga0207694_105583442 | 105 |
| 238 | 3300025926 | Ga0207659_10015553 | Ga0207659_100155532 | 105 |
| 239 | 3300025927 | Ga0207687_10062195 | Ga0207687_100621952 | 105 |
| 240 | 3300025928 | Ga0207700_10382285 | Ga0207700_103822852 | 105 |
| 241 | 3300025928 | Ga0207700_10633722 | Ga0207700_106337221 | 105 |
| 242 | 3300025929 | Ga0207664_10720456 | Ga0207664_107204562 | 105 |
| 243 | 3300025931 | Ga0207644_10490449 | Ga0207644_104904492 | 105 |
| 244 | 3300025932 | Ga0207690_10194406 | Ga0207690_101944062 | 105 |
| 245 | 3300025933 | Ga0207706_10098192 | Ga0207706_100981924 | 105 |
| 246 | 3300025934 | Ga0207686_10090337 | Ga0207686_100903372 | 105 |
| 247 | 3300025935 | Ga0207709_10336429 | Ga0207709_103364292 | 105 |
| 248 | 3300025935 | Ga0207709_11541110 | Ga0207709_115411102 | 105 |
| 249 | 3300025936 | Ga0207670_10035361 | Ga0207670_100353614 | 105 |
| 250 | 3300025936 | Ga0207670_11815351 | Ga0207670_118153511 | 105 |
| 251 | 3300025938 | Ga0207704_10234867 | Ga0207704_102348672 | 105 |
| 252 | 3300025938 | Ga0207704_10640435 | Ga0207704_106404351 | 105 |
| 253 | 3300025939 | Ga0207665_10017247 | Ga0207665_100172472 | 105 |
| 254 | 3300025941 | Ga0207711_10505558 | Ga0207711_105055582 | 105 |
| 255 | 3300025941 | Ga0207711_10679595 | Ga0207711_106795952 | 105 |
| 256 | 3300025942 | Ga0207689_10023840 | Ga0207689_100238402 | 105 |
| 257 | 3300025949 | Ga0207667_10617259 | Ga0207667_106172593 | 105 |
| 258 | 3300025961 | Ga0207712_11266136 | Ga0207712_112661362 | 105 |
| 259 | 3300025972 | Ga0207668_10247586 | Ga0207668_102475862 | 105 |
| 260 | 3300025972 | Ga0207668_10807734 | Ga0207668_108077341 | 105 |
| 261 | 3300025981 | Ga0207640_10196694 | Ga0207640_101966943 | 105 |
| 262 | 3300025986 | Ga0207658_11077013 | Ga0207658_110770132 | 105 |
| 263 | 3300026023 | Ga0207677_10456192 | Ga0207677_104561922 | 105 |
| 264 | 3300026035 | Ga0207703_10314567 | Ga0207703_103145672 | 105 |
| 265 | 3300026035 | Ga0207703_10720672 | Ga0207703_107206721 | 105 |
| 266 | 3300026078 | Ga0207702_10023825 | Ga0207702_100238257 | 105 |
| 267 | 3300026088 | Ga0207641_10148052 | Ga0207641_101480522 | 105 |
| 268 | 3300026088 | Ga0207641_11261548 | Ga0207641_112615482 | 105 |
| 269 | 3300026089 | Ga0207648_10004177 | Ga0207648_1000417712 | 105 |
| 270 | 3300026095 | Ga0207676_10132867 | Ga0207676_101328672 | 105 |
| 271 | 3300026118 | Ga0207675_102477269 | Ga0207675_1024772692 | 105 |
| 272 | 3300026121 | Ga0207683_10071762 | Ga0207683_100717621 | 105 |
| 273 | 3300026121 | Ga0207683_10750112 | Ga0207683_107501123 | 105 |
| 274 | 3300026142 | Ga0207698_10303385 | Ga0207698_103033852 | 105 |
| 275 | 3300026142 | Ga0207698_10684321 | Ga0207698_106843212 | 105 |
| 276 | 3300028381 | Ga0268264_10182984 | Ga0268264_101829843 | 105 |
| 277 | 3300035083 | Ga0373926_0115387 | Ga0373926_0115387_668_985 | 105 |
| 278 | 3300035089 | Ga0373944_0012174 | Ga0373944_0012174_325_642 | 105 |
| 279 | 3300035117 | Ga0373953_0049682 | Ga0373953_0049682_1077_1394 | 105 |
| 280 | 3300035118 | Ga0373954_0664371 | Ga0373954_0664371_180_497 | 105 |
| 281 | 3300035170 | Ga0373943_0026839 | Ga0373943_0026839_2310_2627 | 105 |
| 282 | 3300035171 | Ga0373946_0009647 | Ga0373946_0009647_569_886 | 105 |
| 283 | 3300035172 | Ga0373955_0087215 | Ga0373955_0087215_71_388 | 105 |
| 284 | 3300035410 | Ga0373924_0021839 | Ga0373924_0021839_751_1068 | 105 |
| 285 | 3300035691 | Ga0373931_0508732 | Ga0373931_0508732_333_650 | 105 |
| 286 | 3300035692 | Ga0373935_0105294 | Ga0373935_0105294_14_331 | 105 |
| 287 | 3300035692 | Ga0373935_0121531 | Ga0373935_0121531_610_927 | 105 |
| 288 | 3300035725 | Ga0373947_0019909 | Ga0373947_0019909_2978_3295 | 105 |
| 289 | 3300035725 | Ga0373947_0024465 | Ga0373947_0024465_569_886 | 105 |
| 290 | 3300036401 | Ga0373937_0678344 | Ga0373937_0678344_516_833 | 105 |
| 291 | 3300037068 | Ga0373925_0032754 | Ga0373925_0032754_1047_1364 | 105 |
| 292 | 3300037068 | Ga0373925_0732004 | Ga0373925_0732004_273_590 | 105 |
| 293 | 3300037466 | Ga0395898_0722331 | Ga0395898_0722331_406_729 | 105 |
| 294 | 3300038443 | Ga0395901_0085431 | Ga0395901_0085431_1333_1656 | 105 |
| 295 | 3300039438 | Ga0436360_0367638 | Ga0436360_0367638_332_658 | 105 |
| 296 | 3300041512 | Ga0451853_1512758 | Ga0451853_1512758_247_564 | 105 |
| 297 | 3300044694 | Ga0466963_0130678 | Ga0466963_0130678_129_473 | 105 |
| 298 | 3300044694 | Ga0466963_0553779 | Ga0466963_0553779_402_722 | 105 |
| 299 | 3300044706 | Ga0466964_0769208 | Ga0466964_0769208_114_434 | 105 |
| 300 | 3300044719 | Ga0466971_0013210 | Ga0466971_0013210_282_626 | 105 |
| 301 | 3300044842 | Ga0466957_0103567 | Ga0466957_0103567_36_380 | 105 |
| 302 | 3300045836 | Ga0466958_0036634 | Ga0466958_0036634_2462_2806 | 105 |
| 303 | 3300045976 | Ga0466967_0042536 | Ga0466967_0042536_845_1189 | 105 |
| 304 | 3300045976 | Ga0466967_0280753 | Ga0466967_0280753_1023_1343 | 105 |
| 305 | 3300045976 | Ga0466967_0858812 | Ga0466967_0858812_547_867 | 105 |
| 306 | 3300045976 | Ga0466967_1217106 | Ga0466967_1217106_400_720 | 105 |
| 307 | 3300046454 | Ga0495592_0424555 | Ga0495592_0424555_439_756 | 105 |
| 308 | 3300046455 | Ga0495603_0066235 | Ga0495603_0066235_1149_1466 | 105 |
| 309 | 3300046455 | Ga0495603_0130825 | Ga0495603_0130825_610_927 | 105 |
| 310 | 3300046459 | Ga0495629_0530730 | Ga0495629_0530730_248_565 | 105 |
| 311 | 3300046461 | Ga0495641_0109354 | Ga0495641_0109354_575_892 | 105 |
| 312 | 3300046462 | Ga0495651_0171878 | Ga0495651_0171878_572_889 | 105 |
| 313 | 3300046463 | Ga0495653_0218364 | Ga0495653_0218364_538_855 | 105 |
| 314 | 3300046472 | Ga0495580_0004988 | Ga0495580_0004988_10244_10561 | 105 |
| 315 | 3300046473 | Ga0495582_0068536 | Ga0495582_0068536_1397_1714 | 105 |
| 316 | 3300046473 | Ga0495582_0216142 | Ga0495582_0216142_505_822 | 105 |
| 317 | 3300046475 | Ga0495639_0098029 | Ga0495639_0098029_86_403 | 105 |
| 318 | 3300046476 | Ga0495662_0045382 | Ga0495662_0045382_1297_1614 | 105 |
| 319 | 3300046477 | Ga0495664_0063599 | Ga0495664_0063599_1203_1520 | 105 |
| 320 | 3300046499 | Ga0495594_0116237 | Ga0495594_0116237_545_862 | 105 |
| 321 | 3300046511 | Ga0495608_0925049 | Ga0495608_0925049_82_399 | 105 |
| 322 | 3300046514 | Ga0495618_0146483 | Ga0495618_0146483_165_482 | 105 |
| 323 | 3300046516 | Ga0495628_0365293 | Ga0495628_0365293_491_808 | 105 |
| 324 | 3300046517 | Ga0495630_0290852 | Ga0495630_0290852_192_509 | 105 |
| 325 | 3300046526 | Ga0495666_0011517 | Ga0495666_0011517_1313_1630 | 105 |
| 326 | 3300046529 | Ga0495652_0545835 | Ga0495652_0545835_31_348 | 105 |
| 327 | 3300046531 | Ga0495665_0004476 | Ga0495665_0004476_2596_2913 | 105 |
| 328 | 3300046533 | Ga0495640_0111913 | Ga0495640_0111913_1451_1768 | 105 |
| 329 | 3300046533 | Ga0495640_0124402 | Ga0495640_0124402_403_720 | 105 |
| 330 | 3300046535 | Ga0495586_0053352 | Ga0495586_0053352_1463_1780 | 105 |
| 331 | 3300046536 | Ga0495587_0057944 | Ga0495587_0057944_452_769 | 105 |
| 332 | 3300046536 | Ga0495587_0668687 | Ga0495587_0668687_215_532 | 105 |
| 333 | 3300046559 | Ga0495667_0003138 | Ga0495667_0003138_147_464 | 105 |
| 334 | 3300046642 | Ga0495634_0020996 | Ga0495634_0020996_1829_2146 | 105 |
| 335 | 3300046663 | Ga0495635_0088710 | Ga0495635_0088710_421_738 | 105 |
| 336 | 3300046663 | Ga0495635_0088826 | Ga0495635_0088826_1387_1704 | 105 |
| 337 | 3300046674 | Ga0495588_0628365 | Ga0495588_0628365_177_494 | 105 |
| 338 | 3300046678 | Ga0495599_0458159 | Ga0495599_0458159_71_388 | 105 |
| 339 | 3300046680 | Ga0495646_0186869 | Ga0495646_0186869_180_497 | 105 |
| 340 | 3300046681 | Ga0495647_0015584 | Ga0495647_0015584_71_388 | 105 |
| 341 | 3300046681 | Ga0495647_0179587 | Ga0495647_0179587_119_436 | 105 |
| 342 | 3300046683 | Ga0495658_0043219 | Ga0495658_0043219_1592_1909 | 105 |
| 343 | 3300046683 | Ga0495658_0051590 | Ga0495658_0051590_1325_1642 | 105 |
| 344 | 3300046690 | Ga0495624_0043330 | Ga0495624_0043330_857_1174 | 105 |
| 345 | 3300046690 | Ga0495624_0213044 | Ga0495624_0213044_690_1007 | 105 |
| 346 | 3300046691 | Ga0495670_0344256 | Ga0495670_0344256_149_469 | 105 |
| 347 | 3300046809 | Ga0495600_0075090 | Ga0495600_0075090_642_959 | 105 |
| 348 | 3300047315 | Ga0495581_0009567 | Ga0495581_0009567_1331_1648 | 105 |
| 349 | 3300047315 | Ga0495581_0167412 | Ga0495581_0167412_66_383 | 105 |
| 350 | 3300047319 | Ga0495674_0027372 | Ga0495674_0027372_2417_2734 | 105 |
| 351 | 3300047319 | Ga0495674_0046290 | Ga0495674_0046290_706_1023 | 105 |
| 352 | 3300047321 | Ga0495676_0072164 | Ga0495676_0072164_1312_1629 | 105 |
| 353 | 3300047444 | Ga0495675_0115188 | Ga0495675_0115188_186_503 | 105 |
| 354 | 3300047471 | Ga0495684_0001638 | Ga0495684_0001638_16411_16728 | 105 |
| 355 | 3300047673 | Ga0495593_0036864 | Ga0495593_0036864_2275_2592 | 105 |
| 356 | 3300048088 | Ga0495602_0612531 | Ga0495602_0612531_415_732 | 105 |
| 357 | 3300048088 | Ga0495602_0692291 | Ga0495602_0692291_177_494 | 105 |
| 358 | 3300048089 | Ga0495614_0095828 | Ga0495614_0095828_610_927 | 105 |
| 359 | 3300048903 | Ga0496100_0216535 | Ga0496100_0216535_634_951 | 105 |
| 360 | 3300048903 | Ga0496100_0588116 | Ga0496100_0588116_354_671 | 105 |
| 361 | 3300048903 | Ga0496100_0678464 | Ga0496100_0678464_269_595 | 105 |
| 362 | 3300048904 | Ga0496101_0175034 | Ga0496101_0175034_781_1107 | 105 |
| 363 | 3300048904 | Ga0496101_0635491 | Ga0496101_0635491_419_736 | 105 |
| 364 | 3300048905 | Ga0496102_0423162 | Ga0496102_0423162_399_725 | 105 |
| 365 | 3300048906 | Ga0496103_0737757 | Ga0496103_0737757_187_513 | 105 |
| 366 | 3300048907 | Ga0496104_0240270 | Ga0496104_0240270_371_688 | 105 |
| 367 | 3300048908 | Ga0496105_0243855 | Ga0496105_0243855_632_949 | 105 |
| 368 | 3300048908 | Ga0496105_0463059 | Ga0496105_0463059_341_667 | 105 |
| 369 | 3300048909 | Ga0496106_0089319 | Ga0496106_0089319_1814_2131 | 105 |
| 370 | 3300048909 | Ga0496106_0367564 | Ga0496106_0367564_536_862 | 105 |
| 371 | 3300048909 | Ga0496106_0723297 | Ga0496106_0723297_245_562 | 105 |
| 372 | 3300048911 | Ga0496108_0006411 | Ga0496108_0006411_8592_8909 | 105 |
| 373 | 3300048912 | Ga0496109_0198845 | Ga0496109_0198845_1152_1469 | 105 |
| 374 | 3300048913 | Ga0496110_0063637 | Ga0496110_0063637_357_674 | 105 |
| 375 | 3300048913 | Ga0496110_1604484 | Ga0496110_1604484_219_536 | 105 |
| 376 | 3300048914 | Ga0496111_0024437 | Ga0496111_0024437_390_707 | 105 |
| 377 | 3300048915 | Ga0496112_0060218 | Ga0496112_0060218_802_1122 | 105 |
| 378 | 3300048915 | Ga0496112_0121067 | Ga0496112_0121067_167_484 | 105 |
| 379 | 3300048915 | Ga0496112_0571480 | Ga0496112_0571480_519_836 | 105 |
| 380 | 3300048916 | Ga0496113_0201409 | Ga0496113_0201409_609_926 | 105 |
| 381 | 3300048916 | Ga0496113_0429260 | Ga0496113_0429260_377_697 | 105 |
| 382 | 3300048916 | Ga0496113_1383609 | Ga0496113_1383609_158_475 | 105 |
| 383 | 3300048917 | Ga0496114_0059078 | Ga0496114_0059078_653_979 | 105 |
| 384 | 3300048917 | Ga0496114_0171433 | Ga0496114_0171433_577_894 | 105 |
| 385 | 3300048918 | Ga0496115_0019529 | Ga0496115_0019529_4342_4659 | 105 |
| 386 | 3300048918 | Ga0496115_0430112 | Ga0496115_0430112_51_368 | 105 |
| 387 | 3300048918 | Ga0496115_1004310 | Ga0496115_1004310_170_487 | 105 |
| 388 | 3300049568 | Ga0501031_0027962 | Ga0501031_0027962_1516_1839 | 105 |
| 389 | 3300049568 | Ga0501031_0542453 | Ga0501031_0542453_298_621 | 105 |
| 390 | 3300049568 | Ga0501031_0854400 | Ga0501031_0854400_82_405 | 105 |
| 391 | 3300049569 | Ga0501032_0050274 | Ga0501032_0050274_1214_1537 | 105 |
| 392 | 3300049570 | Ga0501033_0004884 | Ga0501033_0004884_3585_3908 | 105 |
| 393 | 3300049570 | Ga0501033_0116775 | Ga0501033_0116775_296_619 | 105 |
| 394 | 3300049570 | Ga0501033_0131576 | Ga0501033_0131576_286_609 | 105 |
| 395 | 3300049571 | Ga0501034_0064576 | Ga0501034_0064576_933_1256 | 105 |
| 396 | 3300049571 | Ga0501034_0101959 | Ga0501034_0101959_1258_1581 | 105 |
| 397 | 3300049571 | Ga0501034_0261213 | Ga0501034_0261213_40_363 | 105 |
| 398 | 3300049571 | Ga0501034_0700267 | Ga0501034_0700267_453_776 | 105 |
| 399 | 3300049572 | Ga0501036_0133206 | Ga0501036_0133206_466_789 | 105 |
| 400 | 3300049572 | Ga0501036_0134134 | Ga0501036_0134134_1309_1632 | 105 |
| 401 | 3300049572 | Ga0501036_0264193 | Ga0501036_0264193_301_624 | 105 |
| 402 | 3300049573 | Ga0501037_0070232 | Ga0501037_0070232_458_781 | 105 |
| 403 | 3300049573 | Ga0501037_0099130 | Ga0501037_0099130_1316_1639 | 105 |
| 404 | 3300049574 | Ga0501038_0068104 | Ga0501038_0068104_485_808 | 105 |
| 405 | 3300049574 | Ga0501038_0416403 | Ga0501038_0416403_277_600 | 105 |
| 406 | 3300049575 | Ga0501039_0044096 | Ga0501039_0044096_578_901 | 105 |
| 407 | 3300049575 | Ga0501039_0257392 | Ga0501039_0257392_110_433 | 105 |
| 408 | 3300049578 | Ga0501042_0073236 | Ga0501042_0073236_879_1202 | 105 |
| 409 | 3300049579 | Ga0501043_0044487 | Ga0501043_0044487_3147_3470 | 105 |
| 410 | 3300049579 | Ga0501043_0123606 | Ga0501043_0123606_382_705 | 105 |
| 411 | 3300049579 | Ga0501043_0126915 | Ga0501043_0126915_352_675 | 105 |
| 412 | 3300049580 | Ga0501046_0161736 | Ga0501046_0161736_310_633 | 105 |
| 413 | 3300049580 | Ga0501046_0230822 | Ga0501046_0230822_458_781 | 105 |
| 414 | 3300049580 | Ga0501046_0798374 | Ga0501046_0798374_272_595 | 105 |
| 415 | 3300049581 | Ga0501047_0029477 | Ga0501047_0029477_1747_2070 | 105 |
| 416 | 3300049581 | Ga0501047_0242501 | Ga0501047_0242501_310_633 | 105 |
| 417 | 3300049582 | Ga0501048_0002568 | Ga0501048_0002568_513_836 | 105 |
| 418 | 3300049585 | Ga0501069_0242591 | Ga0501069_0242591_713_1036 | 105 |
| 419 | 3300049586 | Ga0501070_0110346 | Ga0501070_0110346_1453_1776 | 105 |
| 420 | 3300049586 | Ga0501070_0483813 | Ga0501070_0483813_336_659 | 105 |
| 421 | 3300049589 | Ga0501073_0010517 | Ga0501073_0010517_4648_4971 | 105 |
| 422 | 3300049589 | Ga0501073_0113394 | Ga0501073_0113394_430_753 | 105 |
| 423 | 3300049590 | Ga0501074_0798026 | Ga0501074_0798026_73_396 | 105 |
| 424 | 3300049742 | Ga0501080_0106668 | Ga0501080_0106668_341_664 | 105 |
| 425 | 3300049742 | Ga0501080_0180264 | Ga0501080_0180264_384_707 | 105 |
| 426 | 3300049822 | Ga0501035_0026641 | Ga0501035_0026641_1406_1729 | 105 |
| 427 | 3300049822 | Ga0501035_0148821 | Ga0501035_0148821_1325_1648 | 105 |
| 428 | 3300049822 | Ga0501035_0162808 | Ga0501035_0162808_1281_1604 | 105 |
| 429 | 3300049822 | Ga0501035_0181441 | Ga0501035_0181441_165_488 | 105 |
| 430 | 3300049823 | Ga0501044_0127755 | Ga0501044_0127755_382_705 | 105 |
| 431 | 3300049823 | Ga0501044_0177489 | Ga0501044_0177489_1310_1633 | 105 |
| 432 | 3300049823 | Ga0501044_0199697 | Ga0501044_0199697_327_650 | 105 |
| 433 | 3300049824 | Ga0501045_0608348 | Ga0501045_0608348_258_581 | 105 |
| 434 | 3300050512 | nmdc:mga0n895_1483_c1 | nmdc:mga0n895_1483_c1_2204_2521 | 105 |
| 435 | 3300050513 | nmdc:mga0rr50_16956_c1 | nmdc:mga0rr50_16956_c1_4315_4632 | 105 |
| 436 | 3300050514 | nmdc:mga08x19_9967_c1 | nmdc:mga08x19_9967_c1_1899_2216 | 105 |
| 437 | 3300053077 | Ga0495601_0004605 | Ga0495601_0004605_5786_6103 | 105 |
| 438 | 3300053077 | Ga0495601_0083924 | Ga0495601_0083924_1582_1899 | 105 |
| 439 | 3300053078 | Ga0495612_0440703 | Ga0495612_0440703_195_512 | 105 |
| 440 | 3300053084 | Ga0495595_0079109 | Ga0495595_0079109_679_996 | 105 |
| 441 | 3300053085 | Ga0495619_0076679 | Ga0495619_0076679_1355_1672 | 105 |
| 442 | 3300053085 | Ga0495619_0102571 | Ga0495619_0102571_1267_1584 | 105 |
| 443 | 3300053085 | Ga0495619_0764791 | Ga0495619_0764791_202_519 | 105 |
| 444 | 3300054114 | Ga0501084_0176464 | Ga0501084_0176464_879_1202 | 105 |
| 445 | 3300054114 | Ga0501084_1140749 | Ga0501084_1140749_208_525 | 105 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5dym-assembly1.cif.gz_A-2 | crystal structure of a padr family transcription regulator from hypervirulent clostridium difficile r20291 - cdpadr_0991 to 1.89 angstrom resolution | 0.9043 | 10 | 103 |
| 3l7w-assembly1.cif.gz_A-2 | the crystal structure of smu.1704 from streptococcus mutans ua159 | 0.903 | 10 | 103 |
| 1xma-assembly1.cif.gz_B-2 | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.8957 | 1 | 100 |
| 6pcp-assembly2.cif.gz_C | mechanism for regulation of dna binding of bordetella bronchiseptica bpsr by 6-hydroxynicotinic acid | 0.8935 | 10 | 87 |
| 5zhv-assembly1.cif.gz_B | crystal structure of the padr-family transcriptional regulator rv3488 of mycobacterium tuberculosis h37rv in complex with zinc ion | 0.8876 | 4 | 96 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P64588_52_154_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9151 | 1 | 91 | 1.10.10.10 |
| af_P71704_1_89_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9069 | 10 | 87 | 1.10.10.10 |
| 5dymA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9042 | 10 | 103 | 1.10.10.10 |
| 1xmaA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8797 | 3 | 103 | 1.10.10.10 |
| 3l7wA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8783 | 10 | 102 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7D7A3C7-F1-model_v4 | PadR family transcriptional regulator | 0.9796 | 10 | 105 |
|
| AF-A0A7W1QDS0-F1-model_v4 | Helix-turn-helix transcriptional regulator | 0.9786 | 1 | 104 |
|
| AF-A0A800C6M0-F1-model_v4 | PadR family transcriptional regulator | 0.9775 | 11 | 89 |
|
| AF-B5CPV7-F1-model_v4 | Transcriptional regulator, PadR family | 0.9768 | 11 | 104 |
|
| AF-A0A7V8NIE9-F1-model_v4 | PadR family transcriptional regulator | 0.9764 | 11 | 103 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar