F445455

General Info

Members Datasets Scaffolds Average Seq Length
445 222 444 323

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100020515|Ga0070696_1000205153
Length 337
Sequence VSLLEVRDLHVWFDLPGGKELHAVQGVSFDLDPSARMGLVGESGCGKTTTVLALMGLLPPSATVAGDVLLDGSSMLAGGEETAQPHRWKDVAMVFQGAMNALNPVKTVETQIIEPMAYHQVAEGSAAKKRAGELLEMVGISASAGARYPHEFSGGMRQRAAIAMSLACQPKVLLADEPTTALDVMVQAQILELLVGLAKDLGLALVLVTHDLPVIAQVCQRAAVMYAGEIVESGPIDDLFHEPRHPYTRLLFAATPDLYGEEAVVSIPGAPPRLDREIVGCPFRPRCDKAFDRCVTEHPALIPLGPGRAAACHLNDDDRAFAGEASGADSASGEPTP

Samples

Sample ID Description Type Environment
1 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
103 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
104 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
105 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
106 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
109 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
132 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
133 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
134 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
135 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
136 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
139 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
140 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
141 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
145 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
146 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
147 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
148 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
192 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
193 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
200 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
201 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
218 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
219 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 14.16
Rhizosphere 85.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_10080723 3300005335 Bacteria 2223
2 Ga0070680_100384899 3300005336 Bacteria 1195
3 Ga0068868_100060311 3300005338 Bacteria 3003
4 Ga0070660_100017332 3300005339 Bacteria 5248
5 Ga0070660_100087801 3300005339 Bacteria 2448
6 Ga0070689_100053265 3300005340 Bacteria 3131
7 Ga0070692_10035112 3300005345 Bacteria 2537
8 Ga0070675_100298535 3300005354 Bacteria 1419
9 Ga0070674_100036888 3300005356 Bacteria 3285
10 Ga0070674_100040802 3300005356 Bacteria 3142
11 Ga0070673_100077716 3300005364 Bacteria 2683
12 Ga0070688_100013890 3300005365 Bacteria 4554
13 Ga0070659_100037229 3300005366 Bacteria 3792
14 Ga0070659_100062717 3300005366 Bacteria 2939
15 Ga0070659_100076160 3300005366 Bacteria 2675
16 Ga0070659_100114624 3300005366 Bacteria 2178
17 Ga0070714_100013456 3300005435 Bacteria 6557
18 Ga0070714_100047591 3300005435 Bacteria 3644
19 Ga0070714_100094956 3300005435 Bacteria 2618
20 Ga0070714_100109324 3300005435 Bacteria 2446
21 Ga0070710_10044889 3300005437 Bacteria 2454
22 Ga0070711_100020040 3300005439 Bacteria 4302
23 Ga0070700_100026777 3300005441 Bacteria 3410
24 Ga0070700_100050424 3300005441 Bacteria 2587
25 Ga0070700_100119224 3300005441 Bacteria 1765
26 Ga0070663_100133771 3300005455 Bacteria 1886
27 Ga0070678_100109566 3300005456 Bacteria 2158
28 Ga0068867_100089361 3300005459 Bacteria 2336
29 Ga0070685_10001622 3300005466 Bacteria 11877
30 Ga0070679_100068907 3300005530 Bacteria 3529
31 Ga0070684_100116645 3300005535 Bacteria 2398
32 Ga0070697_100086184 3300005536 Bacteria 2591
33 Ga0068853_100067166 3300005539 Bacteria 3114
34 Ga0070672_100073675 3300005543 Bacteria 2722
35 Ga0070686_100013322 3300005544 Bacteria 4704
36 Ga0070686_100086375 3300005544 Bacteria 2088
37 Ga0070695_100397468 3300005545 Bacteria 1044
38 Ga0070696_100020515 3300005546 Bacteria 4477
39 Ga0070696_100079246 3300005546 Bacteria 2324
40 Ga0070696_100169335 3300005546 Bacteria 1614
41 Ga0070665_100008946 3300005548 Bacteria 10147
42 Ga0070665_100196743 3300005548 Bacteria 2017
43 Ga0070704_100052660 3300005549 Bacteria 2873
44 Ga0068857_100096467 3300005577 Bacteria 2650
45 Ga0068857_100187586 3300005577 Bacteria 1883
46 Ga0068856_100020101 3300005614 Bacteria 6486
47 Ga0068856_100148262 3300005614 Bacteria 2354
48 Ga0070702_100172141 3300005615 Bacteria 1409
49 Ga0068858_100032468 3300005842 Bacteria 4847
50 Ga0068858_100077122 3300005842 Bacteria 3095
51 Ga0068860_100057455 3300005843 Bacteria 3698
52 Ga0068860_100126190 3300005843 Bacteria 2453
53 Ga0081455_10012097 3300005937 Bacteria 8627
54 Ga0081538_10075001 3300005981 Bacteria 1838
55 Ga0081538_10088286 3300005981 Bacteria 1614
56 Ga0081540_1011189 3300005983 Bacteria 6019
57 Ga0070717_10066896 3300006028 Bacteria 2989
58 Ga0070717_10186682 3300006028 Bacteria 1810
59 Ga0070717_10269920 3300006028 Bacteria 1507
60 Ga0070712_100017097 3300006175 Bacteria 4690
61 Ga0075428_100025933 3300006844 Bacteria 6491
62 Ga0075434_100405795 3300006871 Bacteria 1384
63 Ga0075429_100009271 3300006880 Bacteria 8545
64 Ga0068865_100009503 3300006881 Bacteria 6029
65 Ga0068865_100097807 3300006881 Bacteria 2143
66 Ga0068865_100277968 3300006881 Bacteria 1332
67 Ga0075435_100111654 3300007076 Bacteria 2274
68 Ga0105240_10146247 3300009093 Bacteria 2820
69 Ga0111539_10031521 3300009094 Bacteria 6439
70 Ga0111539_10294164 3300009094 Bacteria 1889
71 Ga0105245_10032347 3300009098 Bacteria 4631
72 Ga0105245_10033196 3300009098 Bacteria 4573
73 Ga0105245_10140215 3300009098 Bacteria 2276
74 Ga0105245_10218820 3300009098 Bacteria 1836
75 Ga0105247_10004915 3300009101 Bacteria 8500
76 Ga0105247_10011813 3300009101 Bacteria 5252
77 Ga0114129_10032629 3300009147 Bacteria 7358
78 Ga0114129_10134713 3300009147 Bacteria 3390
79 Ga0105243_10004456 3300009148 Bacteria 11070
80 Ga0105243_10014220 3300009148 Bacteria 6023
81 Ga0105243_10049326 3300009148 Bacteria 3321
82 Ga0105243_10074972 3300009148 Bacteria 2745
83 Ga0105243_10093645 3300009148 Bacteria 2480
84 Ga0105243_10177460 3300009148 Bacteria 1850
85 Ga0105241_10073690 3300009174 Bacteria 2657
86 Ga0105241_10121623 3300009174 Bacteria 2103
87 Ga0105242_10010880 3300009176 Bacteria 6988
88 Ga0105242_10021883 3300009176 Bacteria 5025
89 Ga0105242_10034112 3300009176 Bacteria 4079
90 Ga0105242_10133036 3300009176 Bacteria 2149
91 Ga0105242_10374999 3300009176 Bacteria 1321
92 Ga0105248_10019948 3300009177 Bacteria 7422
93 Ga0105248_10191995 3300009177 Bacteria 2301
94 Ga0105248_10533127 3300009177 Bacteria 1324
95 Ga0105237_10042484 3300009545 Bacteria 4584
96 Ga0105238_10020699 3300009551 Bacteria 6700
97 Ga0105238_10025415 3300009551 Bacteria 6037
98 Ga0105238_10119391 3300009551 Bacteria 2617
99 Ga0105246_10007076 3300011119 Bacteria 6867
100 Ga0105246_10041462 3300011119 Bacteria 3111
101 Ga0105246_10055650 3300011119 Bacteria 2731
102 Ga0157373_10313842 3300013100 Bacteria 1114
103 Ga0157374_10013611 3300013296 Bacteria 7105
104 Ga0163162_10223295 3300013306 Bacteria 2013
105 Ga0163162_10278060 3300013306 Bacteria 1806
106 Ga0157372_10098396 3300013307 Bacteria 3337
107 Ga0157372_10127336 3300013307 Bacteria 2928
108 Ga0157372_10335722 3300013307 Bacteria 1760
109 Ga0157375_10149355 3300013308 Bacteria 2471
110 Ga0163163_10042678 3300014325 Bacteria 4444
111 Ga0157380_10025717 3300014326 Bacteria 4466
112 Ga0157379_10017619 3300014968 Bacteria 6289
113 Ga0157379_10211401 3300014968 Bacteria 1756
114 Ga0157376_10042053 3300014969 Bacteria 3745
115 Ga0157376_10267368 3300014969 Bacteria 1605
116 Ga0207692_10131996 3300025898 Bacteria 1411
117 Ga0207710_10006640 3300025900 Bacteria 4931
118 Ga0207710_10020266 3300025900 Bacteria 2842
119 Ga0207645_10079688 3300025907 Bacteria 2099
120 Ga0207654_10067367 3300025911 Bacteria 2115
121 Ga0207671_10027641 3300025914 Bacteria 4241
122 Ga0207693_10012834 3300025915 Bacteria 6758
123 Ga0207663_10152276 3300025916 Bacteria 1623
124 Ga0207663_10321604 3300025916 Bacteria 1163
125 Ga0207657_10005485 3300025919 Bacteria 13247
126 Ga0207694_10006830 3300025924 Bacteria 8665
127 Ga0207694_10110442 3300025924 Bacteria 2187
128 Ga0207650_10012178 3300025925 Bacteria 5931
129 Ga0207650_10061316 3300025925 Bacteria 2808
130 Ga0207659_10070610 3300025926 Bacteria 2547
131 Ga0207687_10010541 3300025927 Bacteria 6040
132 Ga0207687_10023730 3300025927 Bacteria 4091
133 Ga0207687_10079964 3300025927 Bacteria 2358
134 Ga0207664_10006489 3300025929 Bacteria 8051
135 Ga0207664_10028445 3300025929 Bacteria 4248
136 Ga0207664_10035082 3300025929 Bacteria 3868
137 Ga0207664_10037960 3300025929 Bacteria 3732
138 Ga0207690_10022709 3300025932 Bacteria 3906
139 Ga0207690_10043342 3300025932 Bacteria 2961
140 Ga0207690_10109732 3300025932 Bacteria 1985
141 Ga0207686_10006237 3300025934 Bacteria 6411
142 Ga0207686_10040090 3300025934 Bacteria 2845
143 Ga0207686_10119653 3300025934 Bacteria 1790
144 Ga0207686_10123462 3300025934 Bacteria 1766
145 Ga0207709_10016792 3300025935 Bacteria 4077
146 Ga0207709_10031732 3300025935 Bacteria 3089
147 Ga0207670_10055216 3300025936 Bacteria 2683
148 Ga0207669_10027755 3300025937 Bacteria 3105
149 Ga0207669_10072250 3300025937 Bacteria 2172
150 Ga0207669_10339546 3300025937 Bacteria 1156
151 Ga0207669_10342243 3300025937 Bacteria 1152
152 Ga0207691_10221397 3300025940 Bacteria 1641
153 Ga0207711_10010549 3300025941 Bacteria 7678
154 Ga0207661_10033464 3300025944 Bacteria 3989
155 Ga0207661_10071964 3300025944 Bacteria 2828
156 Ga0207667_10060555 3300025949 Bacteria 3962
157 Ga0207677_10001529 3300026023 Bacteria 12239
158 Ga0207677_10024823 3300026023 Bacteria 3730
159 Ga0207703_10044319 3300026035 Bacteria 3575
160 Ga0207703_10093795 3300026035 Bacteria 2529
161 Ga0207639_10105381 3300026041 Bacteria 2287
162 Ga0207678_10166838 3300026067 Bacteria 1880
163 Ga0207678_10196250 3300026067 Bacteria 1725
164 Ga0207708_10022119 3300026075 Bacteria 4802
165 Ga0207708_10033891 3300026075 Bacteria 3883
166 Ga0207648_10019246 3300026089 Bacteria 6163
167 Ga0207648_10039143 3300026089 Bacteria 4169
168 Ga0207648_10045878 3300026089 Bacteria 3832
169 Ga0207648_10062462 3300026089 Bacteria 3247
170 Ga0207648_10144256 3300026089 Bacteria 2100
171 Ga0207674_10038934 3300026116 Bacteria 4931
172 Ga0207674_10154163 3300026116 Bacteria 2253
173 Ga0207675_100237251 3300026118 Bacteria 1761
174 Ga0207683_10000766 3300026121 Bacteria 29197
175 Ga0207683_10041299 3300026121 Bacteria 4027
176 Ga0207683_10060237 3300026121 Bacteria 3337
177 Ga0207683_10086695 3300026121 Bacteria 2784
178 Ga0207683_10111514 3300026121 Bacteria 2449
179 Ga0207683_10162198 3300026121 Bacteria 2021
180 Ga0207698_10321355 3300026142 Bacteria 1450
181 Ga0207428_10007430 3300027907 Bacteria 9990
182 Ga0268265_10089484 3300028380 Bacteria 2456
183 Ga0268264_10305932 3300028381 Bacteria 1498
184 Ga0265326_10000028 3300028558 Bacteria 107913
185 Ga0265319_1017058 3300028563 Bacteria 2770
186 Ga0265334_10000040 3300028573 Bacteria 100264
187 Ga0265318_10005367 3300028577 Bacteria 6023
188 Ga0265318_10038654 3300028577 Bacteria 1823
189 Ga0265336_10000639 3300028666 Bacteria 19128
190 Ga0265338_10000661 3300028800 Bacteria 59507
191 Ga0265324_10001419 3300029957 Bacteria 13762
192 Ga0265327_10013105 3300031251 Bacteria 5530
193 Ga0307408_100046640 3300031548 Bacteria 3100
194 Ga0265314_10054662 3300031711 Bacteria 2762
195 Ga0265314_10218601 3300031711 Bacteria 1114
196 Ga0307410_10074616 3300031852 Bacteria 2363
197 Ga0307406_10031102 3300031901 Bacteria 3248
198 Ga0307416_100004601 3300032002 Bacteria 8344
199 Ga0373936_0001581 3300035113 Bacteria 8313
200 Ga0373956_0004280 3300035119 Bacteria 5738
201 Ga0373935_0001570 3300035692 Bacteria 12737
202 Ga0373947_0016519 3300035725 Bacteria 4242
203 Ga0373925_0034155 3300037068 Bacteria 3749
204 Ga0373925_0068483 3300037068 Bacteria 2679
205 Ga0466966_0012887 3300044684 Bacteria 5537
206 Ga0466961_0002175 3300044693 Bacteria 12186
207 Ga0466964_0006462 3300044706 Bacteria 4369
208 Ga0466964_0010535 3300044706 Bacteria 3489
209 Ga0466957_0193490 3300044842 Bacteria 1333
210 Ga0466959_0050687 3300045049 Bacteria 3046
211 Ga0466958_0062206 3300045836 Bacteria 2275
212 Ga0466967_0139802 3300045976 Bacteria 2254
213 Ga0495629_0001783 3300046459 Bacteria 16883
214 Ga0495629_0004186 3300046459 Bacteria 10831
215 Ga0495641_0011452 3300046461 Bacteria 5052
216 Ga0495651_0051578 3300046462 Bacteria 3171
217 Ga0495580_0080397 3300046472 Bacteria 2272
218 Ga0495582_0000046 3300046473 Bacteria 62677
219 Ga0495582_0081718 3300046473 Bacteria 1795
220 Ga0495582_0202629 3300046473 Bacteria 1133
221 Ga0495639_0002418 3300046475 Bacteria 8156
222 Ga0495639_0049753 3300046475 Bacteria 1903
223 Ga0495662_0001972 3300046476 Bacteria 10291
224 Ga0495662_0123343 3300046476 Bacteria 1272
225 Ga0495664_0001002 3300046477 Bacteria 14575
226 Ga0495584_0069495 3300046491 Bacteria 1770
227 Ga0495594_0101665 3300046499 Bacteria 1617
228 Ga0495608_0019006 3300046511 Bacteria 4735
229 Ga0495628_0070948 3300046516 Bacteria 2716
230 Ga0495628_0103719 3300046516 Bacteria 2192
231 Ga0495666_0045443 3300046526 Bacteria 2119
232 Ga0495665_0011613 3300046531 Bacteria 4770
233 Ga0495665_0079487 3300046531 Bacteria 1725
234 Ga0495640_0100202 3300046533 Bacteria 1902
235 Ga0495586_0084055 3300046535 Bacteria 1752
236 Ga0495645_0065113 3300046543 Bacteria 2636
237 Ga0495588_0048678 3300046674 Bacteria 2178
238 Ga0495588_0050366 3300046674 Bacteria 2143
239 Ga0495657_0026779 3300046675 Bacteria 4079
240 Ga0495599_0088647 3300046678 Bacteria 1931
241 Ga0495623_0086538 3300046679 Bacteria 1931
242 Ga0495647_0175365 3300046681 Bacteria 930
243 Ga0495658_0000392 3300046683 Bacteria 24645
244 Ga0495658_0006318 3300046683 Bacteria 5825
245 Ga0495613_0000466 3300046689 Bacteria 34644
246 Ga0495613_0003787 3300046689 Bacteria 11338
247 Ga0495613_0048133 3300046689 Bacteria 3148
248 Ga0495624_0175658 3300046690 Bacteria 1306
249 Ga0495600_0019580 3300046809 Bacteria 4323
250 Ga0495581_0003492 3300047315 Bacteria 9025
251 Ga0495581_0004501 3300047315 Bacteria 8053
252 Ga0495674_0085443 3300047319 Bacteria 2703
253 Ga0495676_0038398 3300047321 Bacteria 3977
254 Ga0495676_0233501 3300047321 Bacteria 1262
255 Ga0495680_0092866 3300047322 Bacteria 2259
256 Ga0495680_0151010 3300047322 Bacteria 1694
257 Ga0495680_0182598 3300047322 Bacteria 1513
258 Ga0495684_0013063 3300047471 Bacteria 6411
259 Ga0495593_0003924 3300047673 Bacteria 8881
260 Ga0495593_0132812 3300047673 Bacteria 1263
261 Ga0495602_0135230 3300048088 Bacteria 1959
262 Ga0496100_0006306 3300048903 Bacteria 6461
263 Ga0496100_0018643 3300048903 Bacteria 4121
264 Ga0496100_0024556 3300048903 Bacteria 3677
265 Ga0496101_0005030 3300048904 Bacteria 8405
266 Ga0496101_0006925 3300048904 Bacteria 7320
267 Ga0496101_0015828 3300048904 Bacteria 5090
268 Ga0496102_0008857 3300048905 Bacteria 8635
269 Ga0496102_0011995 3300048905 Bacteria 7488
270 Ga0496102_0019437 3300048905 Bacteria 5983
271 Ga0496102_0042798 3300048905 Bacteria 4105
272 Ga0496102_0088616 3300048905 Bacteria 2861
273 Ga0496102_0138338 3300048905 Bacteria 2282
274 Ga0496103_0013408 3300048906 Bacteria 4859
275 Ga0496103_0014531 3300048906 Bacteria 4674
276 Ga0496104_0030071 3300048907 Bacteria 5045
277 Ga0496104_0120441 3300048907 Bacteria 2519
278 Ga0496105_0037195 3300048908 Bacteria 4009
279 Ga0496105_0057540 3300048908 Bacteria 3210
280 Ga0496105_0383613 3300048908 Bacteria 1118
281 Ga0496106_0003551 3300048909 Bacteria 11613
282 Ga0496106_0007455 3300048909 Bacteria 8085
283 Ga0496106_0024299 3300048909 Bacteria 4504
284 Ga0496106_0039973 3300048909 Bacteria 3512
285 Ga0496106_0188459 3300048909 Bacteria 1639
286 Ga0496107_0002785 3300048910 Bacteria 11530
287 Ga0496107_0005982 3300048910 Bacteria 8338
288 Ga0496107_0008762 3300048910 Bacteria 7008
289 Ga0496107_0063395 3300048910 Bacteria 2678
290 Ga0496107_0194649 3300048910 Bacteria 1507
291 Ga0496108_0002279 3300048911 Bacteria 15372
292 Ga0496108_0004687 3300048911 Bacteria 11024
293 Ga0496108_0026636 3300048911 Bacteria 4770
294 Ga0496108_0095076 3300048911 Bacteria 2537
295 Ga0496108_0106212 3300048911 Bacteria 2397
296 Ga0496108_0200911 3300048911 Bacteria 1730
297 Ga0496109_0008206 3300048912 Bacteria 8860
298 Ga0496109_0010158 3300048912 Bacteria 8033
299 Ga0496109_0025570 3300048912 Bacteria 5262
300 Ga0496109_0062931 3300048912 Bacteria 3393
301 Ga0496109_0147394 3300048912 Bacteria 2202
302 Ga0496109_0255753 3300048912 Bacteria 1649
303 Ga0496109_0323329 3300048912 Bacteria 1456
304 Ga0496110_0006322 3300048913 Bacteria 9357
305 Ga0496110_0007315 3300048913 Bacteria 8810
306 Ga0496110_0043529 3300048913 Bacteria 3920
307 Ga0496110_0065324 3300048913 Bacteria 3216
308 Ga0496111_0003268 3300048914 Bacteria 10013
309 Ga0496111_0030913 3300048914 Bacteria 3810
310 Ga0496111_0044691 3300048914 Bacteria 3184
311 Ga0496111_0094538 3300048914 Bacteria 2192
312 Ga0496112_0000818 3300048915 Bacteria 22034
313 Ga0496112_0023739 3300048915 Bacteria 5866
314 Ga0496112_0030345 3300048915 Bacteria 5231
315 Ga0496112_0546671 3300048915 Bacteria 1092
316 Ga0496113_0001377 3300048916 Bacteria 13484
317 Ga0496114_0005179 3300048917 Bacteria 10177
318 Ga0496114_0009595 3300048917 Bacteria 7688
319 Ga0496114_0028566 3300048917 Bacteria 4578
320 Ga0496114_0065657 3300048917 Bacteria 3040
321 Ga0496114_0076450 3300048917 Bacteria 2821
322 Ga0496114_0307271 3300048917 Bacteria 1400
323 Ga0496115_0020224 3300048918 Bacteria 5133
324 Ga0496115_0065823 3300048918 Bacteria 2928
325 Ga0501031_0000337 3300049568 Bacteria 27154
326 Ga0501031_0000469 3300049568 Bacteria 23403
327 Ga0501031_0083912 3300049568 Bacteria 2076
328 Ga0501032_0002411 3300049569 Bacteria 14585
329 Ga0501032_0003914 3300049569 Bacteria 11300
330 Ga0501033_0001256 3300049570 Bacteria 22691
331 Ga0501033_0021422 3300049570 Bacteria 4876
332 Ga0501034_0004420 3300049571 Bacteria 15640
333 Ga0501034_0015178 3300049571 Bacteria 7917
334 Ga0501034_0093984 3300049571 Bacteria 2995
335 Ga0501036_0000665 3300049572 Bacteria 25248
336 Ga0501036_0083912 3300049572 Bacteria 2693
337 Ga0501037_0001501 3300049573 Bacteria 17062
338 Ga0501037_0104849 3300049573 Bacteria 2038
339 Ga0501038_0000184 3300049574 Bacteria 53647
340 Ga0501038_0010857 3300049574 Bacteria 8323
341 Ga0501038_0046419 3300049574 Bacteria 3766
342 Ga0501039_0000458 3300049575 Bacteria 29682
343 Ga0501039_0080467 3300049575 Bacteria 2535
344 Ga0501040_0000219 3300049576 Bacteria 33332
345 Ga0501040_0000416 3300049576 Bacteria 25149
346 Ga0501040_0076294 3300049576 Bacteria 2317
347 Ga0501041_0000287 3300049577 Bacteria 24346
348 Ga0501041_0000353 3300049577 Bacteria 22691
349 Ga0501042_0000363 3300049578 Bacteria 22861
350 Ga0501042_0014280 3300049578 Bacteria 5419
351 Ga0501042_0378077 3300049578 Bacteria 1025
352 Ga0501043_0000119 3300049579 Bacteria 72862
353 Ga0501046_0000322 3300049580 Bacteria 48152
354 Ga0501046_0002263 3300049580 Bacteria 18169
355 Ga0501047_0002174 3300049581 Bacteria 18769
356 Ga0501047_0052786 3300049581 Bacteria 3929
357 Ga0501047_0355167 3300049581 Bacteria 1302
358 Ga0501048_0004223 3300049582 Bacteria 10948
359 Ga0501048_0047493 3300049582 Bacteria 3063
360 Ga0501048_0224079 3300049582 Bacteria 1334
361 Ga0501067_0000179 3300049583 Bacteria 35841
362 Ga0501067_0002558 3300049583 Bacteria 10043
363 Ga0501067_0076528 3300049583 Bacteria 1854
364 Ga0501067_0108566 3300049583 Bacteria 1543
365 Ga0501067_0125694 3300049583 Bacteria 1427
366 Ga0501068_0000006 3300049584 Bacteria 78334
367 Ga0501068_0000055 3300049584 Bacteria 43890
368 Ga0501068_0000646 3300049584 Bacteria 17838
369 Ga0501068_0008262 3300049584 Bacteria 5786
370 Ga0501069_0000029 3300049585 Bacteria 105687
371 Ga0501069_0003567 3300049585 Bacteria 8015
372 Ga0501069_0005130 3300049585 Bacteria 6799
373 Ga0501070_0006775 3300049586 Bacteria 9752
374 Ga0501070_0051698 3300049586 Bacteria 3410
375 Ga0501070_0068539 3300049586 Bacteria 2936
376 Ga0501071_0000083 3300049587 Bacteria 34468
377 Ga0501071_0000573 3300049587 Bacteria 19050
378 Ga0501071_0031495 3300049587 Bacteria 3760
379 Ga0501071_0083921 3300049587 Bacteria 2334
380 Ga0501072_0000273 3300049588 Bacteria 37334
381 Ga0501072_0001625 3300049588 Bacteria 16817
382 Ga0501072_0002881 3300049588 Bacteria 12934
383 Ga0501073_0002315 3300049589 Bacteria 14249
384 Ga0501073_0010605 3300049589 Bacteria 6742
385 Ga0501073_0013250 3300049589 Bacteria 6008
386 Ga0501074_0000005 3300049590 Bacteria 113618
387 Ga0501074_0006686 3300049590 Bacteria 8323
388 Ga0501074_0013784 3300049590 Bacteria 5879
389 Ga0501075_0000453 3300049591 Bacteria 24403
390 Ga0501075_0129958 3300049591 Bacteria 1919
391 Ga0501076_0000130 3300049592 Bacteria 41963
392 Ga0501076_0000257 3300049592 Bacteria 32760
393 Ga0501076_0049803 3300049592 Bacteria 3314
394 Ga0501076_0074343 3300049592 Bacteria 2722
395 Ga0501077_0001764 3300049593 Bacteria 13052
396 Ga0501077_0008866 3300049593 Bacteria 6242
397 Ga0501077_0020980 3300049593 Bacteria 4133
398 Ga0501079_0001220 3300049741 Bacteria 17993
399 Ga0501079_0016558 3300049741 Bacteria 5630
400 Ga0501079_0040019 3300049741 Bacteria 3616
401 Ga0501080_0000144 3300049742 Bacteria 50320
402 Ga0501080_0118856 3300049742 Bacteria 2450
403 Ga0501081_0000141 3300049743 Bacteria 32367
404 Ga0501081_0001829 3300049743 Bacteria 13175
405 Ga0501081_0042631 3300049743 Bacteria 3110
406 Ga0501083_0000115 3300049744 Bacteria 55075
407 Ga0501083_0051964 3300049744 Bacteria 2754
408 Ga0501035_0000908 3300049822 Bacteria 31335
409 Ga0501035_0038616 3300049822 Bacteria 4322
410 Ga0501044_0005391 3300049823 Bacteria 14203
411 Ga0501045_0000289 3300049824 Bacteria 29544
412 Ga0501045_0011289 3300049824 Bacteria 6269
413 nmdc:mga05p37_520_c1 3300050507 Bacteria 42619
414 nmdc:mga09592_13503_c1 3300050508 Bacteria 6671
415 nmdc:mga0qj67_287842_c1 3300050509 Bacteria 1332
416 nmdc:mga0qj67_50014_c1 3300050509 Bacteria 3304
417 nmdc:mga08y16_112109_c1 3300050511 Bacteria 2839
418 nmdc:mga08y16_279546_c1 3300050511 Bacteria 1722
419 nmdc:mga0n895_54692_c1 3300050512 Bacteria 3927
420 nmdc:mga0n895_88731_c1 3300050512 Bacteria 3092
421 nmdc:mga0rr50_37883_c1 3300050513 Bacteria 3484
422 nmdc:mga0a205_109808_c1 3300050515 Bacteria 2656
423 Ga0495601_0005068 3300053077 Bacteria 7647
424 Ga0495601_0061486 3300053077 Bacteria 2384
425 Ga0495601_0118832 3300053077 Bacteria 1716
426 Ga0495612_0029683 3300053078 Bacteria 2203
427 Ga0495595_0003467 3300053084 Bacteria 6261
428 Ga0495619_0008741 3300053085 Bacteria 6403
429 Ga0495619_0025413 3300053085 Bacteria 3804
430 Ga0501084_0000067 3300054114 Bacteria 79713
431 Ga0501084_0000997 3300054114 Bacteria 21992
432 Ga0501084_0039983 3300054114 Bacteria 3922
433 Ga0501084_0081818 3300054114 Bacteria 2709
434 Ga0501082_0000203 3300060353 Bacteria 51940
435 Ga0501082_0000735 3300060353 Bacteria 28808
436 Ga0501082_0008404 3300060353 Bacteria 8906
437 Ga0501082_0077556 3300060353 Bacteria 2865
438 Ga0501082_0126781 3300060353 Bacteria 2214
439 Ga0501082_0430366 3300060353 Bacteria 1152
440 Ga0530510_0000059 3300061734 Bacteria 53630
441 Ga0530510_0000413 3300061734 Bacteria 27748
442 Ga0530510_0049662 3300061734 Bacteria 3030
443 Ga0530510_0055132 3300061734 Bacteria 2872
444 Ga0530510_0091352 3300061734 Bacteria 2221

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046476 Ga0495662_0123343 Ga0495662_0123343_440_1261 265
2 3300046681 Ga0495647_0175365 Ga0495647_0175365_26_844 265
3 3300053077 Ga0495601_0061486 Ga0495601_0061486_17_835 266
4 3300048911 Ga0496108_0095076 Ga0496108_0095076_1647_2519 283
5 3300048908 Ga0496105_0383613 Ga0496105_0383613_208_1107 293
6 3300048917 Ga0496114_0009595 Ga0496114_0009595_6759_7658 293
7 3300005435 Ga0070714_100094956 Ga0070714_1000949562 298
8 3300006028 Ga0070717_10186682 Ga0070717_101866822 298
9 3300025929 Ga0207664_10037960 Ga0207664_100379604 298
10 3300048918 Ga0496115_0065823 Ga0496115_0065823_1921_2898 298
11 3300047322 Ga0495680_0151010 Ga0495680_0151010_24_1001 299
12 3300048912 Ga0496109_0147394 Ga0496109_0147394_400_1383 299
13 3300053077 Ga0495601_0118832 Ga0495601_0118832_38_1015 299
14 3300005437 Ga0070710_10044889 Ga0070710_100448892 300
15 3300025916 Ga0207663_10321604 Ga0207663_103216042 300
16 3300006871 Ga0075434_100405795 Ga0075434_1004057952 303
17 3300007076 Ga0075435_100111654 Ga0075435_1001116542 303
18 3300048903 Ga0496100_0018643 Ga0496100_0018643_383_1366 303
19 3300048909 Ga0496106_0188459 Ga0496106_0188459_63_1046 303
20 3300048912 Ga0496109_0062931 Ga0496109_0062931_1861_2844 303
21 3300048917 Ga0496114_0076450 Ga0496114_0076450_786_1769 303
22 3300050512 nmdc:mga0n895_54692_c1 nmdc:mga0n895_54692_c1_1715_2698 303
23 3300050513 nmdc:mga0rr50_37883_c1 nmdc:mga0rr50_37883_c1_936_1919 303
24 3300050515 nmdc:mga0a205_109808_c1 nmdc:mga0a205_109808_c1_1648_2631 303
25 3300005338 Ga0068868_100060311 Ga0068868_1000603112 305
26 3300005345 Ga0070692_10035112 Ga0070692_100351123 305
27 3300005366 Ga0070659_100114624 Ga0070659_1001146242 305
28 3300005441 Ga0070700_100050424 Ga0070700_1000504242 305
29 3300005535 Ga0070684_100116645 Ga0070684_1001166452 305
30 3300005539 Ga0068853_100067166 Ga0068853_1000671662 305
31 3300005577 Ga0068857_100187586 Ga0068857_1001875862 305
32 3300005615 Ga0070702_100172141 Ga0070702_1001721412 305
33 3300009098 Ga0105245_10033196 Ga0105245_100331964 305
34 3300009148 Ga0105243_10093645 Ga0105243_100936452 305
35 3300009174 Ga0105241_10073690 Ga0105241_100736903 305
36 3300009176 Ga0105242_10034112 Ga0105242_100341122 305
37 3300009177 Ga0105248_10191995 Ga0105248_101919952 305
38 3300009551 Ga0105238_10020699 Ga0105238_100206995 305
39 3300013306 Ga0163162_10278060 Ga0163162_102780602 305
40 3300025932 Ga0207690_10022709 Ga0207690_100227092 305
41 3300025934 Ga0207686_10123462 Ga0207686_101234622 305
42 3300025937 Ga0207669_10342243 Ga0207669_103422432 305
43 3300025944 Ga0207661_10033464 Ga0207661_100334643 305
44 3300026023 Ga0207677_10024823 Ga0207677_100248232 305
45 3300026041 Ga0207639_10105381 Ga0207639_101053813 305
46 3300026116 Ga0207674_10154163 Ga0207674_101541632 305
47 3300031548 Ga0307408_100046640 Ga0307408_1000466402 305
48 3300031852 Ga0307410_10074616 Ga0307410_100746162 305
49 3300031901 Ga0307406_10031102 Ga0307406_100311022 305
50 3300032002 Ga0307416_100004601 Ga0307416_1000046013 305
51 3300048911 Ga0496108_0026636 Ga0496108_0026636_2461_3444 305
52 3300048915 Ga0496112_0546671 Ga0496112_0546671_21_1004 308
53 3300046689 Ga0495613_0003787 Ga0495613_0003787_4171_5121 309
54 3300047322 Ga0495680_0182598 Ga0495680_0182598_12_953 309
55 3300006844 Ga0075428_100025933 Ga0075428_1000259334 310
56 3300006880 Ga0075429_100009271 Ga0075429_1000092717 310
57 3300009147 Ga0114129_10032629 Ga0114129_100326297 310
58 3300050507 nmdc:mga05p37_520_c1 nmdc:mga05p37_520_c1_26101_27078 310
59 3300050508 nmdc:mga09592_13503_c1 nmdc:mga09592_13503_c1_4437_5414 310
60 3300050509 nmdc:mga0qj67_287842_c1 nmdc:mga0qj67_287842_c1_29_1006 310
61 3300028558 Ga0265326_10000028 Ga0265326_1000002881 312
62 3300028573 Ga0265334_10000040 Ga0265334_1000004054 312
63 3300028666 Ga0265336_10000639 Ga0265336_1000063914 312
64 3300028800 Ga0265338_10000661 Ga0265338_1000066139 312
65 3300029957 Ga0265324_10001419 Ga0265324_1000141910 312
66 3300031711 Ga0265314_10054662 Ga0265314_100546623 312
67 iso_pu_bacteria 2831905167 2831907922 312
68 3300049571 Ga0501034_0093984 Ga0501034_0093984_1973_2974 314
69 3300049581 Ga0501047_0355167 Ga0501047_0355167_203_1204 314
70 3300049583 Ga0501067_0002558 Ga0501067_0002558_4244_5245 314
71 3300049584 Ga0501068_0008262 Ga0501068_0008262_902_1903 314
72 3300049586 Ga0501070_0051698 Ga0501070_0051698_564_1565 314
73 3300049587 Ga0501071_0083921 Ga0501071_0083921_652_1653 314
74 3300049588 Ga0501072_0002881 Ga0501072_0002881_10055_11056 314
75 3300049589 Ga0501073_0013250 Ga0501073_0013250_4244_5245 314
76 3300049590 Ga0501074_0013784 Ga0501074_0013784_4322_5323 314
77 3300049593 Ga0501077_0008866 Ga0501077_0008866_3382_4383 314
78 3300049741 Ga0501079_0040019 Ga0501079_0040019_639_1640 314
79 3300049742 Ga0501080_0118856 Ga0501080_0118856_612_1613 314
80 3300049744 Ga0501083_0051964 Ga0501083_0051964_252_1253 314
81 3300050509 nmdc:mga0qj67_50014_c1 nmdc:mga0qj67_50014_c1_1500_2456 314
82 3300054114 Ga0501084_0081818 Ga0501084_0081818_764_1765 314
83 3300060353 Ga0501082_0008404 Ga0501082_0008404_1960_2961 314
84 3300037068 Ga0373925_0034155 Ga0373925_0034155_1722_2687 317
85 3300046459 Ga0495629_0001783 Ga0495629_0001783_6483_7448 317
86 3300046473 Ga0495582_0000046 Ga0495582_0000046_28654_29619 317
87 3300046475 Ga0495639_0002418 Ga0495639_0002418_3501_4466 317
88 3300046531 Ga0495665_0079487 Ga0495665_0079487_482_1447 317
89 3300046535 Ga0495586_0084055 Ga0495586_0084055_472_1437 317
90 3300046683 Ga0495658_0000392 Ga0495658_0000392_14245_15210 317
91 3300046689 Ga0495613_0000466 Ga0495613_0000466_26845_27810 317
92 3300047315 Ga0495581_0003492 Ga0495581_0003492_6127_7092 317
93 3300047321 Ga0495676_0233501 Ga0495676_0233501_112_1077 317
94 3300047673 Ga0495593_0132812 Ga0495593_0132812_43_1008 317
95 3300005336 Ga0070680_100384899 Ga0070680_1003848992 319
96 3300005339 Ga0070660_100087801 Ga0070660_1000878012 319
97 3300005354 Ga0070675_100298535 Ga0070675_1002985352 319
98 3300005356 Ga0070674_100036888 Ga0070674_1000368881 319
99 3300005366 Ga0070659_100037229 Ga0070659_1000372293 319
100 3300005366 Ga0070659_100062717 Ga0070659_1000627172 319
101 3300005435 Ga0070714_100109324 Ga0070714_1001093243 319
102 3300005441 Ga0070700_100119224 Ga0070700_1001192242 319
103 3300005459 Ga0068867_100089361 Ga0068867_1000893611 319
104 3300005536 Ga0070697_100086184 Ga0070697_1000861842 319
105 3300005546 Ga0070696_100020515 Ga0070696_1000205153 319
106 3300005549 Ga0070704_100052660 Ga0070704_1000526602 319
107 3300005842 Ga0068858_100077122 Ga0068858_1000771222 319
108 3300005981 Ga0081538_10088286 Ga0081538_100882862 319
109 3300006881 Ga0068865_100097807 Ga0068865_1000978072 319
110 3300006881 Ga0068865_100277968 Ga0068865_1002779682 319
111 3300009098 Ga0105245_10140215 Ga0105245_101402153 319
112 3300009148 Ga0105243_10004456 Ga0105243_1000445615 319
113 3300009148 Ga0105243_10074972 Ga0105243_100749723 319
114 3300009176 Ga0105242_10021883 Ga0105242_100218832 319
115 3300009177 Ga0105248_10533127 Ga0105248_105331272 319
116 3300009551 Ga0105238_10119391 Ga0105238_101193912 319
117 3300013307 Ga0157372_10127336 Ga0157372_101273362 319
118 3300013307 Ga0157372_10335722 Ga0157372_103357222 319
119 3300014969 Ga0157376_10267368 Ga0157376_102673682 319
120 3300025924 Ga0207694_10110442 Ga0207694_101104422 319
121 3300025927 Ga0207687_10010541 Ga0207687_100105414 319
122 3300025929 Ga0207664_10035082 Ga0207664_100350822 319
123 3300025932 Ga0207690_10043342 Ga0207690_100433423 319
124 3300025934 Ga0207686_10006237 Ga0207686_100062372 319
125 3300025935 Ga0207709_10016792 Ga0207709_100167923 319
126 3300025935 Ga0207709_10031732 Ga0207709_100317323 319
127 3300025937 Ga0207669_10339546 Ga0207669_103395461 319
128 3300026023 Ga0207677_10001529 Ga0207677_1000152910 319
129 3300026035 Ga0207703_10044319 Ga0207703_100443192 319
130 3300026075 Ga0207708_10022119 Ga0207708_100221192 319
131 3300026089 Ga0207648_10045878 Ga0207648_100458784 319
132 3300026089 Ga0207648_10144256 Ga0207648_101442562 319
133 3300026121 Ga0207683_10086695 Ga0207683_100866953 319
134 3300026142 Ga0207698_10321355 Ga0207698_103213551 319
135 3300028577 Ga0265318_10005367 Ga0265318_100053674 319
136 3300044842 Ga0466957_0193490 Ga0466957_0193490_19_990 319
137 3300046472 Ga0495580_0080397 Ga0495580_0080397_1181_2182 319
138 3300046473 Ga0495582_0081718 Ga0495582_0081718_642_1616 319
139 3300046491 Ga0495584_0069495 Ga0495584_0069495_589_1569 319
140 3300047321 Ga0495676_0038398 Ga0495676_0038398_1707_2681 319
141 3300048904 Ga0496101_0006925 Ga0496101_0006925_1367_2344 319
142 3300048905 Ga0496102_0088616 Ga0496102_0088616_69_1046 319
143 3300048909 Ga0496106_0003551 Ga0496106_0003551_2622_3599 319
144 3300048910 Ga0496107_0005982 Ga0496107_0005982_5351_6328 319
145 3300048911 Ga0496108_0004687 Ga0496108_0004687_7946_8923 319
146 3300048912 Ga0496109_0008206 Ga0496109_0008206_7795_8772 319
147 3300048912 Ga0496109_0255753 Ga0496109_0255753_87_1067 319
148 3300048913 Ga0496110_0007315 Ga0496110_0007315_2642_3622 319
149 3300048913 Ga0496110_0043529 Ga0496110_0043529_1946_2923 319
150 3300048914 Ga0496111_0044691 Ga0496111_0044691_1776_2753 319
151 3300048914 Ga0496111_0094538 Ga0496111_0094538_403_1383 319
152 3300048915 Ga0496112_0030345 Ga0496112_0030345_3652_4629 319
153 3300049583 Ga0501067_0108566 Ga0501067_0108566_367_1338 319
154 3300005983 Ga0081540_1011189 Ga0081540_10111892 320
155 3300006028 Ga0070717_10269920 Ga0070717_102699202 320
156 3300005339 Ga0070660_100017332 Ga0070660_1000173323 321
157 3300005340 Ga0070689_100053265 Ga0070689_1000532653 321
158 3300005356 Ga0070674_100040802 Ga0070674_1000408022 321
159 3300005364 Ga0070673_100077716 Ga0070673_1000777163 321
160 3300005365 Ga0070688_100013890 Ga0070688_1000138902 321
161 3300005366 Ga0070659_100076160 Ga0070659_1000761603 321
162 3300005435 Ga0070714_100013456 Ga0070714_1000134564 321
163 3300005435 Ga0070714_100047591 Ga0070714_1000475913 321
164 3300005439 Ga0070711_100020040 Ga0070711_1000200403 321
165 3300005441 Ga0070700_100026777 Ga0070700_1000267773 321
166 3300005456 Ga0070678_100109566 Ga0070678_1001095662 321
167 3300005466 Ga0070685_10001622 Ga0070685_100016223 321
168 3300005530 Ga0070679_100068907 Ga0070679_1000689073 321
169 3300005543 Ga0070672_100073675 Ga0070672_1000736751 321
170 3300005544 Ga0070686_100086375 Ga0070686_1000863752 321
171 3300005546 Ga0070696_100169335 Ga0070696_1001693352 321
172 3300005548 Ga0070665_100008946 Ga0070665_1000089469 321
173 3300005577 Ga0068857_100096467 Ga0068857_1000964672 321
174 3300005614 Ga0068856_100020101 Ga0068856_1000201016 321
175 3300005614 Ga0068856_100148262 Ga0068856_1001482622 321
176 3300005842 Ga0068858_100032468 Ga0068858_1000324682 321
177 3300005843 Ga0068860_100126190 Ga0068860_1001261903 321
178 3300005937 Ga0081455_10012097 Ga0081455_100120972 321
179 3300005981 Ga0081538_10075001 Ga0081538_100750011 321
180 3300006028 Ga0070717_10066896 Ga0070717_100668963 321
181 3300006175 Ga0070712_100017097 Ga0070712_1000170972 321
182 3300006881 Ga0068865_100009503 Ga0068865_1000095033 321
183 3300009093 Ga0105240_10146247 Ga0105240_101462472 321
184 3300009094 Ga0111539_10031521 Ga0111539_100315212 321
185 3300009094 Ga0111539_10294164 Ga0111539_102941642 321
186 3300009098 Ga0105245_10032347 Ga0105245_100323474 321
187 3300009101 Ga0105247_10004915 Ga0105247_100049153 321
188 3300009147 Ga0114129_10134713 Ga0114129_101347133 321
189 3300009148 Ga0105243_10014220 Ga0105243_100142205 321
190 3300009148 Ga0105243_10177460 Ga0105243_101774601 321
191 3300009174 Ga0105241_10121623 Ga0105241_101216232 321
192 3300009176 Ga0105242_10133036 Ga0105242_101330361 321
193 3300009176 Ga0105242_10374999 Ga0105242_103749991 321
194 3300009545 Ga0105237_10042484 Ga0105237_100424844 321
195 3300009551 Ga0105238_10025415 Ga0105238_100254153 321
196 3300011119 Ga0105246_10007076 Ga0105246_100070764 321
197 3300011119 Ga0105246_10041462 Ga0105246_100414623 321
198 3300011119 Ga0105246_10055650 Ga0105246_100556502 321
199 3300013100 Ga0157373_10313842 Ga0157373_103138422 321
200 3300013296 Ga0157374_10013611 Ga0157374_100136114 321
201 3300013307 Ga0157372_10098396 Ga0157372_100983962 321
202 3300014325 Ga0163163_10042678 Ga0163163_100426783 321
203 3300014326 Ga0157380_10025717 Ga0157380_100257173 321
204 3300014968 Ga0157379_10211401 Ga0157379_102114012 321
205 3300014969 Ga0157376_10042053 Ga0157376_100420533 321
206 3300025898 Ga0207692_10131996 Ga0207692_101319962 321
207 3300025900 Ga0207710_10006640 Ga0207710_100066403 321
208 3300025907 Ga0207645_10079688 Ga0207645_100796882 321
209 3300025911 Ga0207654_10067367 Ga0207654_100673672 321
210 3300025914 Ga0207671_10027641 Ga0207671_100276414 321
211 3300025915 Ga0207693_10012834 Ga0207693_100128344 321
212 3300025916 Ga0207663_10152276 Ga0207663_101522762 321
213 3300025919 Ga0207657_10005485 Ga0207657_100054853 321
214 3300025924 Ga0207694_10006830 Ga0207694_100068302 321
215 3300025925 Ga0207650_10012178 Ga0207650_100121782 321
216 3300025925 Ga0207650_10061316 Ga0207650_100613162 321
217 3300025926 Ga0207659_10070610 Ga0207659_100706102 321
218 3300025927 Ga0207687_10023730 Ga0207687_100237303 321
219 3300025929 Ga0207664_10006489 Ga0207664_100064894 321
220 3300025929 Ga0207664_10028445 Ga0207664_100284453 321
221 3300025932 Ga0207690_10109732 Ga0207690_101097322 321
222 3300025934 Ga0207686_10040090 Ga0207686_100400903 321
223 3300025936 Ga0207670_10055216 Ga0207670_100552163 321
224 3300025937 Ga0207669_10027755 Ga0207669_100277552 321
225 3300025940 Ga0207691_10221397 Ga0207691_102213971 321
226 3300025949 Ga0207667_10060555 Ga0207667_100605554 321
227 3300026035 Ga0207703_10093795 Ga0207703_100937952 321
228 3300026067 Ga0207678_10196250 Ga0207678_101962502 321
229 3300026075 Ga0207708_10033891 Ga0207708_100338912 321
230 3300026089 Ga0207648_10039143 Ga0207648_100391433 321
231 3300026089 Ga0207648_10062462 Ga0207648_100624623 321
232 3300026116 Ga0207674_10038934 Ga0207674_100389343 321
233 3300026118 Ga0207675_100237251 Ga0207675_1002372512 321
234 3300026121 Ga0207683_10041299 Ga0207683_100412992 321
235 3300026121 Ga0207683_10060237 Ga0207683_100602373 321
236 3300026121 Ga0207683_10111514 Ga0207683_101115142 321
237 3300026121 Ga0207683_10162198 Ga0207683_101621982 321
238 3300027907 Ga0207428_10007430 Ga0207428_1000743012 321
239 3300028380 Ga0268265_10089484 Ga0268265_100894842 321
240 3300028381 Ga0268264_10305932 Ga0268264_103059322 321
241 3300028563 Ga0265319_1017058 Ga0265319_10170583 321
242 3300028577 Ga0265318_10038654 Ga0265318_100386542 321
243 3300035113 Ga0373936_0001581 Ga0373936_0001581_4510_5502 321
244 3300035119 Ga0373956_0004280 Ga0373956_0004280_4181_5173 321
245 3300035692 Ga0373935_0001570 Ga0373935_0001570_5023_6015 321
246 3300035725 Ga0373947_0016519 Ga0373947_0016519_2630_3622 321
247 3300037068 Ga0373925_0068483 Ga0373925_0068483_696_1688 321
248 3300044684 Ga0466966_0012887 Ga0466966_0012887_4172_5146 321
249 3300044693 Ga0466961_0002175 Ga0466961_0002175_7396_8370 321
250 3300044706 Ga0466964_0006462 Ga0466964_0006462_258_1232 321
251 3300044706 Ga0466964_0010535 Ga0466964_0010535_132_1106 321
252 3300045049 Ga0466959_0050687 Ga0466959_0050687_302_1276 321
253 3300045836 Ga0466958_0062206 Ga0466958_0062206_442_1416 321
254 3300045976 Ga0466967_0139802 Ga0466967_0139802_271_1245 321
255 3300046459 Ga0495629_0004186 Ga0495629_0004186_5535_6527 321
256 3300046461 Ga0495641_0011452 Ga0495641_0011452_1231_2223 321
257 3300046462 Ga0495651_0051578 Ga0495651_0051578_1600_2577 321
258 3300046473 Ga0495582_0202629 Ga0495582_0202629_41_1024 321
259 3300046475 Ga0495639_0049753 Ga0495639_0049753_199_1191 321
260 3300046476 Ga0495662_0001972 Ga0495662_0001972_1872_2864 321
261 3300046477 Ga0495664_0001002 Ga0495664_0001002_4380_5372 321
262 3300046511 Ga0495608_0019006 Ga0495608_0019006_2824_3816 321
263 3300046516 Ga0495628_0070948 Ga0495628_0070948_946_1923 321
264 3300046516 Ga0495628_0103719 Ga0495628_0103719_594_1586 321
265 3300046526 Ga0495666_0045443 Ga0495666_0045443_1009_2001 321
266 3300046531 Ga0495665_0011613 Ga0495665_0011613_1852_2844 321
267 3300046533 Ga0495640_0100202 Ga0495640_0100202_81_1073 321
268 3300046543 Ga0495645_0065113 Ga0495645_0065113_1271_2263 321
269 3300046674 Ga0495588_0050366 Ga0495588_0050366_1000_1983 321
270 3300046675 Ga0495657_0026779 Ga0495657_0026779_1521_2513 321
271 3300046678 Ga0495599_0088647 Ga0495599_0088647_694_1686 321
272 3300046679 Ga0495623_0086538 Ga0495623_0086538_694_1686 321
273 3300046683 Ga0495658_0006318 Ga0495658_0006318_2054_3046 321
274 3300046689 Ga0495613_0048133 Ga0495613_0048133_1464_2456 321
275 3300046809 Ga0495600_0019580 Ga0495600_0019580_694_1686 321
276 3300047315 Ga0495581_0004501 Ga0495581_0004501_6558_7550 321
277 3300047319 Ga0495674_0085443 Ga0495674_0085443_1388_2371 321
278 3300047322 Ga0495680_0092866 Ga0495680_0092866_702_1694 321
279 3300047471 Ga0495684_0013063 Ga0495684_0013063_4015_4992 321
280 3300047673 Ga0495593_0003924 Ga0495593_0003924_5791_6783 321
281 3300048088 Ga0495602_0135230 Ga0495602_0135230_374_1366 321
282 3300048903 Ga0496100_0006306 Ga0496100_0006306_1248_2228 321
283 3300048904 Ga0496101_0005030 Ga0496101_0005030_5829_6809 321
284 3300048904 Ga0496101_0015828 Ga0496101_0015828_3939_4922 321
285 3300048905 Ga0496102_0008857 Ga0496102_0008857_5199_6182 321
286 3300048905 Ga0496102_0042798 Ga0496102_0042798_1248_2228 321
287 3300048905 Ga0496102_0138338 Ga0496102_0138338_1023_2006 321
288 3300048906 Ga0496103_0014531 Ga0496103_0014531_356_1339 321
289 3300048907 Ga0496104_0120441 Ga0496104_0120441_1421_2401 321
290 3300048908 Ga0496105_0057540 Ga0496105_0057540_876_1856 321
291 3300048909 Ga0496106_0024299 Ga0496106_0024299_2801_3781 321
292 3300048909 Ga0496106_0039973 Ga0496106_0039973_1074_2057 321
293 3300048910 Ga0496107_0063395 Ga0496107_0063395_340_1320 321
294 3300048910 Ga0496107_0194649 Ga0496107_0194649_183_1166 321
295 3300048911 Ga0496108_0002279 Ga0496108_0002279_10760_11740 321
296 3300048911 Ga0496108_0106212 Ga0496108_0106212_396_1379 321
297 3300048911 Ga0496108_0200911 Ga0496108_0200911_615_1589 321
298 3300048912 Ga0496109_0010158 Ga0496109_0010158_1753_2733 321
299 3300048912 Ga0496109_0025570 Ga0496109_0025570_1246_2229 321
300 3300048912 Ga0496109_0323329 Ga0496109_0323329_394_1377 321
301 3300048913 Ga0496110_0006322 Ga0496110_0006322_6229_7209 321
302 3300048913 Ga0496110_0065324 Ga0496110_0065324_234_1217 321
303 3300048914 Ga0496111_0003268 Ga0496111_0003268_2784_3767 321
304 3300048914 Ga0496111_0030913 Ga0496111_0030913_251_1231 321
305 3300048915 Ga0496112_0000818 Ga0496112_0000818_17536_18519 321
306 3300048915 Ga0496112_0023739 Ga0496112_0023739_4588_5568 321
307 3300048916 Ga0496113_0001377 Ga0496113_0001377_11842_12822 321
308 3300048917 Ga0496114_0028566 Ga0496114_0028566_3399_4382 321
309 3300048917 Ga0496114_0307271 Ga0496114_0307271_62_1045 321
310 3300048918 Ga0496115_0020224 Ga0496115_0020224_1588_2571 321
311 3300049568 Ga0501031_0000337 Ga0501031_0000337_21459_22436 321
312 3300049568 Ga0501031_0000469 Ga0501031_0000469_21328_22305 321
313 3300049569 Ga0501032_0002411 Ga0501032_0002411_8100_9077 321
314 3300049569 Ga0501032_0003914 Ga0501032_0003914_8045_9022 321
315 3300049570 Ga0501033_0001256 Ga0501033_0001256_2526_3503 321
316 3300049570 Ga0501033_0021422 Ga0501033_0021422_2801_3778 321
317 3300049571 Ga0501034_0004420 Ga0501034_0004420_1879_2856 321
318 3300049571 Ga0501034_0015178 Ga0501034_0015178_1160_2137 321
319 3300049572 Ga0501036_0000665 Ga0501036_0000665_20378_21355 321
320 3300049572 Ga0501036_0083912 Ga0501036_0083912_545_1522 321
321 3300049573 Ga0501037_0001501 Ga0501037_0001501_7019_7996 321
322 3300049574 Ga0501038_0000184 Ga0501038_0000184_12699_13676 321
323 3300049574 Ga0501038_0010857 Ga0501038_0010857_1642_2619 321
324 3300049575 Ga0501039_0000458 Ga0501039_0000458_19189_20166 321
325 3300049576 Ga0501040_0000219 Ga0501040_0000219_22464_23441 321
326 3300049576 Ga0501040_0000416 Ga0501040_0000416_11218_12195 321
327 3300049577 Ga0501041_0000287 Ga0501041_0000287_4182_5159 321
328 3300049577 Ga0501041_0000353 Ga0501041_0000353_19189_20166 321
329 3300049578 Ga0501042_0000363 Ga0501042_0000363_2526_3503 321
330 3300049578 Ga0501042_0014280 Ga0501042_0014280_1642_2619 321
331 3300049578 Ga0501042_0378077 Ga0501042_0378077_22_1005 321
332 3300049579 Ga0501043_0000119 Ga0501043_0000119_35872_36849 321
333 3300049580 Ga0501046_0000322 Ga0501046_0000322_34603_35580 321
334 3300049580 Ga0501046_0002263 Ga0501046_0002263_11488_12465 321
335 3300049581 Ga0501047_0002174 Ga0501047_0002174_9502_10479 321
336 3300049581 Ga0501047_0052786 Ga0501047_0052786_209_1186 321
337 3300049582 Ga0501048_0004223 Ga0501048_0004223_1993_2970 321
338 3300049582 Ga0501048_0047493 Ga0501048_0047493_1018_1995 321
339 3300049582 Ga0501048_0224079 Ga0501048_0224079_330_1313 321
340 3300049583 Ga0501067_0076528 Ga0501067_0076528_131_1108 321
341 3300049583 Ga0501067_0125694 Ga0501067_0125694_126_1100 321
342 3300049584 Ga0501068_0000006 Ga0501068_0000006_36588_37565 321
343 3300049584 Ga0501068_0000646 Ga0501068_0000646_748_1725 321
344 3300049585 Ga0501069_0003567 Ga0501069_0003567_2331_3308 321
345 3300049585 Ga0501069_0005130 Ga0501069_0005130_4308_5285 321
346 3300049586 Ga0501070_0006775 Ga0501070_0006775_8278_9255 321
347 3300049586 Ga0501070_0068539 Ga0501070_0068539_976_1953 321
348 3300049587 Ga0501071_0000083 Ga0501071_0000083_24425_25402 321
349 3300049587 Ga0501071_0000573 Ga0501071_0000573_1642_2619 321
350 3300049588 Ga0501072_0000273 Ga0501072_0000273_1183_2160 321
351 3300049588 Ga0501072_0001625 Ga0501072_0001625_3352_4329 321
352 3300049589 Ga0501073_0002315 Ga0501073_0002315_9340_10317 321
353 3300049589 Ga0501073_0010605 Ga0501073_0010605_1018_1995 321
354 3300049590 Ga0501074_0000005 Ga0501074_0000005_80854_81831 321
355 3300049590 Ga0501074_0006686 Ga0501074_0006686_1642_2619 321
356 3300049591 Ga0501075_0000453 Ga0501075_0000453_17381_18358 321
357 3300049592 Ga0501076_0000130 Ga0501076_0000130_6588_7565 321
358 3300049592 Ga0501076_0000257 Ga0501076_0000257_30865_31842 321
359 3300049592 Ga0501076_0049803 Ga0501076_0049803_105_1082 321
360 3300049593 Ga0501077_0001764 Ga0501077_0001764_11438_12415 321
361 3300049593 Ga0501077_0020980 Ga0501077_0020980_1515_2492 321
362 3300049741 Ga0501079_0001220 Ga0501079_0001220_5918_6895 321
363 3300049741 Ga0501079_0016558 Ga0501079_0016558_945_1922 321
364 3300049742 Ga0501080_0000144 Ga0501080_0000144_39959_40936 321
365 3300049743 Ga0501081_0000141 Ga0501081_0000141_19189_20166 321
366 3300049743 Ga0501081_0001829 Ga0501081_0001829_6374_7351 321
367 3300049743 Ga0501081_0042631 Ga0501081_0042631_702_1679 321
368 3300049744 Ga0501083_0000115 Ga0501083_0000115_34910_35887 321
369 3300049822 Ga0501035_0000908 Ga0501035_0000908_19189_20166 321
370 3300049822 Ga0501035_0038616 Ga0501035_0038616_545_1522 321
371 3300049823 Ga0501044_0005391 Ga0501044_0005391_10256_11233 321
372 3300049824 Ga0501045_0000289 Ga0501045_0000289_19189_20166 321
373 3300049824 Ga0501045_0011289 Ga0501045_0011289_545_1522 321
374 3300050511 nmdc:mga08y16_112109_c1 nmdc:mga08y16_112109_c1_1726_2700 321
375 3300050511 nmdc:mga08y16_279546_c1 nmdc:mga08y16_279546_c1_268_1245 321
376 3300050512 nmdc:mga0n895_88731_c1 nmdc:mga0n895_88731_c1_1216_2199 321
377 3300053077 Ga0495601_0005068 Ga0495601_0005068_3172_4149 321
378 3300053084 Ga0495595_0003467 Ga0495595_0003467_4536_5528 321
379 3300053085 Ga0495619_0008741 Ga0495619_0008741_4932_5924 321
380 3300054114 Ga0501084_0000067 Ga0501084_0000067_40681_41658 321
381 3300054114 Ga0501084_0000997 Ga0501084_0000997_20378_21355 321
382 3300060353 Ga0501082_0000203 Ga0501082_0000203_44046_45023 321
383 3300060353 Ga0501082_0000735 Ga0501082_0000735_2901_3878 321
384 3300060353 Ga0501082_0126781 Ga0501082_0126781_652_1635 321
385 3300061734 Ga0530510_0000059 Ga0530510_0000059_39956_40933 321
386 3300061734 Ga0530510_0000413 Ga0530510_0000413_20044_21021 321
387 3300005335 Ga0070666_10080723 Ga0070666_100807231 322
388 3300005455 Ga0070663_100133771 Ga0070663_1001337711 322
389 3300005544 Ga0070686_100013322 Ga0070686_1000133224 322
390 3300005545 Ga0070695_100397468 Ga0070695_1003974681 322
391 3300005546 Ga0070696_100079246 Ga0070696_1000792462 322
392 3300005548 Ga0070665_100196743 Ga0070665_1001967432 322
393 3300005843 Ga0068860_100057455 Ga0068860_1000574554 322
394 3300009098 Ga0105245_10218820 Ga0105245_102188202 322
395 3300009101 Ga0105247_10011813 Ga0105247_100118132 322
396 3300009148 Ga0105243_10049326 Ga0105243_100493262 322
397 3300009176 Ga0105242_10010880 Ga0105242_100108807 322
398 3300009177 Ga0105248_10019948 Ga0105248_100199484 322
399 3300013306 Ga0163162_10223295 Ga0163162_102232952 322
400 3300013308 Ga0157375_10149355 Ga0157375_101493553 322
401 3300014968 Ga0157379_10017619 Ga0157379_100176192 322
402 3300025900 Ga0207710_10020266 Ga0207710_100202663 322
403 3300025927 Ga0207687_10079964 Ga0207687_100799642 322
404 3300025934 Ga0207686_10119653 Ga0207686_101196532 322
405 3300025937 Ga0207669_10072250 Ga0207669_100722502 322
406 3300025941 Ga0207711_10010549 Ga0207711_100105497 322
407 3300025944 Ga0207661_10071964 Ga0207661_100719642 322
408 3300026067 Ga0207678_10166838 Ga0207678_101668382 322
409 3300026089 Ga0207648_10019246 Ga0207648_100192464 322
410 3300026121 Ga0207683_10000766 Ga0207683_1000076621 322
411 3300031251 Ga0265327_10013105 Ga0265327_100131054 322
412 3300031711 Ga0265314_10218601 Ga0265314_102186011 322
413 3300046499 Ga0495594_0101665 Ga0495594_0101665_586_1578 322
414 3300046674 Ga0495588_0048678 Ga0495588_0048678_722_1714 322
415 3300046690 Ga0495624_0175658 Ga0495624_0175658_273_1268 322
416 3300048903 Ga0496100_0024556 Ga0496100_0024556_1181_2149 322
417 3300048905 Ga0496102_0011995 Ga0496102_0011995_3322_4311 322
418 3300048905 Ga0496102_0019437 Ga0496102_0019437_1181_2149 322
419 3300048906 Ga0496103_0013408 Ga0496103_0013408_3102_4070 322
420 3300048907 Ga0496104_0030071 Ga0496104_0030071_3099_4085 322
421 3300048908 Ga0496105_0037195 Ga0496105_0037195_2145_3113 322
422 3300048909 Ga0496106_0007455 Ga0496106_0007455_32_1021 322
423 3300048910 Ga0496107_0002785 Ga0496107_0002785_1657_2625 322
424 3300048910 Ga0496107_0008762 Ga0496107_0008762_2737_3726 322
425 3300048917 Ga0496114_0005179 Ga0496114_0005179_2118_3107 322
426 3300048917 Ga0496114_0065657 Ga0496114_0065657_831_1799 322
427 3300049568 Ga0501031_0083912 Ga0501031_0083912_420_1400 322
428 3300049573 Ga0501037_0104849 Ga0501037_0104849_614_1594 322
429 3300049574 Ga0501038_0046419 Ga0501038_0046419_968_1948 322
430 3300049575 Ga0501039_0080467 Ga0501039_0080467_798_1778 322
431 3300049576 Ga0501040_0076294 Ga0501040_0076294_129_1109 322
432 3300049583 Ga0501067_0000179 Ga0501067_0000179_28783_29769 322
433 3300049584 Ga0501068_0000055 Ga0501068_0000055_7851_8837 322
434 3300049585 Ga0501069_0000029 Ga0501069_0000029_27631_28617 322
435 3300049587 Ga0501071_0031495 Ga0501071_0031495_167_1150 322
436 3300049591 Ga0501075_0129958 Ga0501075_0129958_550_1533 322
437 3300049592 Ga0501076_0074343 Ga0501076_0074343_469_1452 322
438 3300053078 Ga0495612_0029683 Ga0495612_0029683_672_1667 322
439 3300053085 Ga0495619_0025413 Ga0495619_0025413_620_1615 322
440 3300054114 Ga0501084_0039983 Ga0501084_0039983_2029_3009 322
441 3300060353 Ga0501082_0077556 Ga0501082_0077556_414_1397 322
442 3300060353 Ga0501082_0430366 Ga0501082_0430366_127_1110 322
443 3300061734 Ga0530510_0049662 Ga0530510_0049662_1418_2398 322
444 3300061734 Ga0530510_0055132 Ga0530510_0055132_162_1145 322
445 3300061734 Ga0530510_0091352 Ga0530510_0091352_764_1750 322

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08352

oligo_HPY

Oligopeptide/dipeptide transporter, C-terminal region

231

294

0.99

PF00005

ABC_tran

ABC transporter

24

180

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lj9-assembly3.cif.gz_C structure of the e. coli macb abc domain (c2221) 0.9265 5 238
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9212 5 236
6z67-assembly3.cif.gz_E ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9208 5 239
4fwi-assembly1.cif.gz_B crystal structure of the nucleotide-binding domain of a dipeptide abc transporter 0.9191 5 317
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9187 4 238
ID Description Score Start End Superfamily
af_Q2FZR1_3_327_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9559 5 317 3.40.50.300
af_Q2FZR5_3_331_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9508 5 322 3.40.50.300
af_P9WQJ5_2_332_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9498 5 318 3.40.50.300
af_P0AAG0_1_323_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9448 5 316 3.40.50.300
af_Q2FZR0_1_324_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9434 5 318 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A537NHN9-F1-model_v4 ABC transporter ATP-binding protein 0.9601 5 316 GO:0005524
GO:0005886
GO:0015833
GO:0016887
AF-A0A2S9BS46-F1-model_v4 Dipeptide/oligopeptide/nickel ABC transporter ATP-binding protein 0.9597 26 256 GO:0005524
GO:0005886
GO:0016887
AF-A0A2G6PBS8-F1-model_v4 Dipeptide/oligopeptide/nickel ABC transporter ATP-binding protein 0.9589 3 316 GO:0005524
GO:0015833
GO:0016887
AF-A0A3D9GTG5-F1-model_v4 Peptide/nickel transport system ATP-binding protein/oligopeptide transport system ATP-binding protein 0.9567 5 320 GO:0005524
GO:0015833
GO:0016887
AF-A0A3N1M2H0-F1-model_v4 Peptide/nickel transport system ATP-binding protein 0.9557 4 318 GO:0005524
GO:0005886
GO:0015833
GO:0016887

Feature Viewer

pLDDT pTM Quality
93.2 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map