F445468

General Info

Members Datasets Scaffolds Average Seq Length
445 272 890 259

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_100000008|Ga0070712_1000000084
Length 288
Sequence MHIYKYSAAGCPRSGRRASLPSVLKSIDVLGLHLQTFGIFFALNFLAWAALIARRLKELGKPVDWAYEMMFAALIGGLAGARGYYLLQNYDAAKGDLVGHIFSGSGLIWYGGLIGGVVAVLLWARWRRFVSLALLDMAAPALALGYAIGRIGCQVSGDGDYGKVSSLPWAMGYPHGTVPTDPGVTVQPTPIYETLSMGLLALVLWRLRDALRPGALFAIYLVGAGLERFVVEFWRRNAHVLGVLTAAQLESLAMGLAGAIWLVVLVRRHGTLRADGAVRPRAARPATA

Samples

Sample ID Description Type Environment
1 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
127 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
128 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
129 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
132 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
133 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
134 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
135 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
136 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
137 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
138 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
153 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
167 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
168 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
169 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
172 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
176 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
177 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
178 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
181 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
185 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
186 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
187 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
192 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
193 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
197 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
198 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
199 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
202 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
220 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
221 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
222 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
223 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
224 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
225 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
226 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
249 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
250 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
261 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
262 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
263 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
264 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
265 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
266 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
267 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
268 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
269 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
272 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.12
Nodule 0
Rhizoplane 9.21
Rhizosphere 86.52
Stem 0
Stem Tuber 0
Unclassified 0.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070712_100000008 3300006175 Bacteria 149644
2 JGI24746J21847_1014142 3300001977 Bacteria 1154
3 JGI24740J21852_10004455 3300001979 Bacteria 6026
4 JGI24751J29686_10032656 3300002459 Bacteria 1079
5 JGI25406J46586_10021246 3300003203 Bacteria 2608
6 rootH2_10028258 3300003320 Bacteria 2231
7 Ga0070683_100008454 3300005329 Bacteria 8745
8 Ga0070683_100045086 3300005329 Bacteria 4070
9 Ga0070683_100213949 3300005329 Bacteria 1831
10 Ga0070670_100482563 3300005331 Bacteria 1101
11 Ga0070666_10009263 3300005335 Bacteria 6137
12 Ga0070680_100214802 3300005336 Bacteria 1623
13 Ga0070682_100000057 3300005337 Bacteria 108832
14 Ga0068868_100001251 3300005338 Bacteria 17460
15 Ga0068868_100001603 3300005338 Bacteria 15430
16 Ga0068868_100492066 3300005338 Bacteria 1073
17 Ga0070660_100113565 3300005339 Bacteria 2157
18 Ga0070689_100084218 3300005340 Bacteria 2499
19 Ga0070691_10000945 3300005341 Bacteria 11810
20 Ga0070661_100000031 3300005344 Bacteria 113816
21 Ga0070692_10011332 3300005345 Bacteria 4089
22 Ga0070668_100084608 3300005347 Bacteria 2492
23 Ga0070669_100020893 3300005353 Bacteria 4677
24 Ga0070674_100347572 3300005356 Bacteria 1197
25 Ga0070688_100000506 3300005365 Bacteria 19723
26 Ga0070688_100000848 3300005365 Bacteria 15156
27 Ga0070688_100052007 3300005365 Bacteria 2557
28 Ga0070659_100000026 3300005366 Bacteria 143542
29 Ga0070659_100002416 3300005366 Bacteria 13275
30 Ga0070667_100009469 3300005367 Bacteria 8079
31 Ga0070667_100012962 3300005367 Bacteria 6894
32 Ga0070714_100000083 3300005435 Bacteria 81010
33 Ga0070714_100015068 3300005435 Bacteria 6217
34 Ga0070714_100288454 3300005435 Bacteria 1527
35 Ga0070713_100000040 3300005436 Bacteria 82527
36 Ga0070710_10000008 3300005437 Bacteria 198148
37 Ga0070700_100249714 3300005441 Bacteria 1272
38 Ga0070663_100000467 3300005455 Bacteria 21352
39 Ga0070678_100063955 3300005456 Bacteria 2725
40 Ga0070662_100000005 3300005457 Bacteria 183056
41 Ga0070681_10003375 3300005458 Bacteria 14931
42 Ga0068867_100003143 3300005459 Bacteria 11643
43 Ga0068867_100421439 3300005459 Bacteria 1131
44 Ga0070685_10000932 3300005466 Bacteria 15756
45 Ga0070685_10002367 3300005466 Bacteria 9704
46 Ga0070685_10032379 3300005466 Bacteria 2928
47 Ga0070699_100307407 3300005518 Bacteria 1423
48 Ga0070679_100000342 3300005530 Bacteria 39556
49 Ga0070684_100003262 3300005535 Bacteria 12148
50 Ga0070684_100230579 3300005535 Bacteria 1691
51 Ga0068853_100423231 3300005539 Bacteria 1249
52 Ga0070693_100000815 3300005547 Bacteria 13820
53 Ga0070665_100000159 3300005548 Bacteria 122613
54 Ga0070665_100042877 3300005548 Bacteria 4548
55 Ga0070665_100095054 3300005548 Bacteria 2985
56 Ga0070665_100186150 3300005548 Bacteria 2077
57 Ga0070665_100400863 3300005548 Bacteria 1380
58 Ga0070665_100404851 3300005548 Bacteria 1372
59 Ga0070704_100326570 3300005549 Bacteria 1287
60 Ga0070664_100038959 3300005564 Bacteria 4003
61 Ga0068856_100001306 3300005614 Bacteria 26220
62 Ga0068856_100011606 3300005614 Bacteria 8546
63 Ga0068856_100032781 3300005614 Bacteria 5087
64 Ga0070702_100266462 3300005615 Bacteria 1169
65 Ga0068859_100750120 3300005617 Bacteria 1065
66 Ga0068864_100000262 3300005618 Bacteria 47006
67 Ga0068863_100028180 3300005841 Bacteria 5362
68 Ga0068863_100380792 3300005841 Bacteria 1377
69 Ga0068858_100000049 3300005842 Bacteria 122693
70 Ga0068860_100008225 3300005843 Bacteria 10383
71 Ga0068862_100033968 3300005844 Bacteria 4314
72 Ga0081455_10035792 3300005937 Bacteria 4430
73 Ga0081455_10056788 3300005937 Bacteria 3321
74 Ga0081455_10132245 3300005937 Bacteria 1949
75 Ga0081538_10000953 3300005981 Bacteria 31063
76 Ga0081540_1000827 3300005983 Bacteria 28230
77 Ga0081540_1089201 3300005983 Bacteria 1361
78 Ga0081539_10003954 3300005985 Bacteria 17165
79 Ga0081539_10047102 3300005985 Bacteria 2465
80 Ga0070717_10000004 3300006028 Bacteria 365525
81 Ga0097621_100254090 3300006237 Bacteria 1540
82 Ga0097621_100522772 3300006237 Bacteria 1077
83 Ga0068871_100188171 3300006358 Bacteria 1777
84 Ga0068871_100289952 3300006358 Bacteria 1434
85 Ga0075428_100013292 3300006844 Bacteria 9159
86 Ga0075430_100029305 3300006846 Bacteria 4671
87 Ga0075430_100329826 3300006846 Bacteria 1261
88 Ga0075433_10000093 3300006852 Bacteria 42077
89 Ga0075433_10083115 3300006852 Bacteria 2825
90 Ga0075429_100038864 3300006880 Bacteria 4143
91 Ga0075429_100339209 3300006880 Bacteria 1315
92 Ga0068865_100000001 3300006881 Bacteria 288199
93 Ga0075435_100199341 3300007076 Bacteria 1696
94 Ga0075435_100214594 3300007076 Bacteria 1633
95 Ga0105240_10231305 3300009093 Bacteria 2148
96 Ga0105240_10356163 3300009093 Bacteria 1659
97 Ga0111539_10727675 3300009094 Bacteria 1155
98 Ga0105245_10000091 3300009098 Bacteria 89925
99 Ga0105245_10001248 3300009098 Bacteria 22969
100 Ga0105245_10001267 3300009098 Bacteria 22830
101 Ga0105247_10130562 3300009101 Bacteria 1637
102 Ga0114129_10174145 3300009147 Bacteria 2931
103 Ga0114129_10383691 3300009147 Bacteria 1855
104 Ga0105242_10114702 3300009176 Bacteria 2302
105 Ga0105237_10106231 3300009545 Bacteria 2799
106 Ga0105238_10000028 3300009551 Bacteria 188361
107 Ga0105238_10900229 3300009551 Bacteria 903
108 Ga0105238_10940779 3300009551 Unclassified 884
109 Ga0105249_10025930 3300009553 Bacteria 5280
110 Ga0105239_10177655 3300010375 Bacteria 2381
111 Ga0105246_10004963 3300011119 Bacteria 8100
112 Ga0157370_10462273 3300013104 Bacteria 1166
113 Ga0157369_10000128 3300013105 Bacteria 108576
114 Ga0157378_10039229 3300013297 Bacteria 4200
115 Ga0163162_10736949 3300013306 Bacteria 1105
116 Ga0157372_10436627 3300013307 Bacteria 1526
117 Ga0157375_10028143 3300013308 Bacteria 5263
118 Ga0163163_10134447 3300014325 Bacteria 2513
119 Ga0163163_10140549 3300014325 Bacteria 2457
120 Ga0157380_10000373 3300014326 Bacteria 26937
121 Ga0157379_10102932 3300014968 Bacteria 2562
122 Ga0157379_10136410 3300014968 Bacteria 2211
123 Ga0157376_10004957 3300014969 Bacteria 9283
124 Ga0157376_10204144 3300014969 Bacteria 1821
125 Ga0163161_10000073 3300017792 Bacteria 102053
126 Ga0163161_10475832 3300017792 Bacteria 1013
127 Ga0207692_10000006 3300025898 Bacteria 294686
128 Ga0207710_10006500 3300025900 Bacteria 4985
129 Ga0207710_10139292 3300025900 Bacteria 1170
130 Ga0207680_10022252 3300025903 Bacteria 3444
131 Ga0207680_10037612 3300025903 Bacteria 2795
132 Ga0207643_10059497 3300025908 Bacteria 2179
133 Ga0207707_10011008 3300025912 Bacteria 7871
134 Ga0207695_10212374 3300025913 Bacteria 1845
135 Ga0207693_10000002 3300025915 Bacteria 304011
136 Ga0207663_10009495 3300025916 Bacteria 5140
137 Ga0207660_10306436 3300025917 Bacteria 1266
138 Ga0207662_10160099 3300025918 Bacteria 1438
139 Ga0207657_10116134 3300025919 Bacteria 2205
140 Ga0207649_10000021 3300025920 Bacteria 209660
141 Ga0207652_10000351 3300025921 Bacteria 47656
142 Ga0207652_10124730 3300025921 Bacteria 2293
143 Ga0207652_10366676 3300025921 Bacteria 1300
144 Ga0207694_10000008 3300025924 Bacteria 484902
145 Ga0207687_10000042 3300025927 Bacteria 108169
146 Ga0207687_10000613 3300025927 Bacteria 24053
147 Ga0207700_10000032 3300025928 Bacteria 125088
148 Ga0207664_10000006 3300025929 Bacteria 408702
149 Ga0207664_10004303 3300025929 Bacteria 9639
150 Ga0207644_10075239 3300025931 Bacteria 2481
151 Ga0207690_10000098 3300025932 Bacteria 71853
152 Ga0207690_10001263 3300025932 Bacteria 16002
153 Ga0207706_10000006 3300025933 Bacteria 216994
154 Ga0207670_10071409 3300025936 Bacteria 2401
155 Ga0207704_10000012 3300025938 Bacteria 178319
156 Ga0207661_10002060 3300025944 Bacteria 13837
157 Ga0207661_10004186 3300025944 Bacteria 10093
158 Ga0207661_10014746 3300025944 Bacteria 5733
159 Ga0207661_10028868 3300025944 Bacteria 4252
160 Ga0207661_10056532 3300025944 Bacteria 3150
161 Ga0207661_10102601 3300025944 Bacteria 2405
162 Ga0207661_10646787 3300025944 Bacteria 972
163 Ga0207679_10000801 3300025945 Bacteria 20458
164 Ga0207712_10416960 3300025961 Bacteria 1132
165 Ga0207668_10040797 3300025972 Bacteria 3134
166 Ga0207658_10017888 3300025986 Bacteria 4885
167 Ga0207677_10000902 3300026023 Bacteria 16642
168 Ga0207677_10004205 3300026023 Bacteria 7707
169 Ga0207703_10000132 3300026035 Bacteria 90163
170 Ga0207703_10059233 3300026035 Bacteria 3128
171 Ga0207639_10031399 3300026041 Bacteria 3904
172 Ga0207678_10017109 3300026067 Bacteria 6366
173 Ga0207678_10638803 3300026067 Bacteria 935
174 Ga0207708_10128963 3300026075 Bacteria 1976
175 Ga0207702_10000316 3300026078 Bacteria 55327
176 Ga0207702_10002888 3300026078 Bacteria 16065
177 Ga0207702_10023625 3300026078 Bacteria 5100
178 Ga0207641_10000071 3300026088 Bacteria 151812
179 Ga0207641_10035448 3300026088 Bacteria 4157
180 Ga0207648_10001595 3300026089 Bacteria 24839
181 Ga0207676_10000038 3300026095 Bacteria 171492
182 Ga0207683_10186815 3300026121 Bacteria 1880
183 Ga0207698_10479780 3300026142 Bacteria 1206
184 Ga0268266_10000023 3300028379 Bacteria 501899
185 Ga0268266_10000498 3300028379 Bacteria 56135
186 Ga0268266_10072429 3300028379 Bacteria 2988
187 Ga0268266_10149561 3300028379 Bacteria 2103
188 Ga0268266_10298440 3300028379 Bacteria 1502
189 Ga0268265_10111830 3300028380 Bacteria 2231
190 Ga0268264_10003521 3300028381 Bacteria 13496
191 Ga0265326_10000010 3300028558 Bacteria 184218
192 Ga0265319_1000548 3300028563 Bacteria 25570
193 Ga0265319_1000862 3300028563 Bacteria 19267
194 Ga0265334_10000003 3300028573 Bacteria 244354
195 Ga0265336_10028725 3300028666 Bacteria 1737
196 Ga0265338_10000047 3300028800 Bacteria 220905
197 Ga0265338_10215594 3300028800 Bacteria 1437
198 Ga0265338_10307385 3300028800 Bacteria 1151
199 Ga0265324_10001716 3300029957 Bacteria 12057
200 Ga0265324_10048017 3300029957 Bacteria 1468
201 Ga0265320_10172856 3300031240 Bacteria 970
202 Ga0265325_10004563 3300031241 Bacteria 8721
203 Ga0265331_10019982 3300031250 Bacteria 3447
204 Ga0265316_10195625 3300031344 Bacteria 1501
205 Ga0307513_10249219 3300031456 Bacteria 1574
206 Ga0316576_10034832 3300031727 Bacteria 3591
207 Ga0316578_10048973 3300031728 Bacteria 2469
208 Ga0307413_10151674 3300031824 Bacteria 1616
209 Ga0307412_10505529 3300031911 Bacteria 1007
210 Ga0307409_100060147 3300031995 Bacteria 2961
211 Ga0307416_100633796 3300032002 Bacteria 1152
212 Ga0307414_10366851 3300032004 Bacteria 1241
213 Ga0307415_100047643 3300032126 Bacteria 2886
214 Ga0373923_0111300 3300035111 Bacteria 1216
215 Ga0373947_0277793 3300035725 Bacteria 1113
216 Ga0373937_0006840 3300036401 Bacteria 9841
217 Ga0373937_0052423 3300036401 Bacteria 3740
218 Ga0395899_0393200 3300037312 Bacteria 919
219 Ga0395898_0050216 3300037466 Bacteria 4083
220 Ga0395905_0266205 3300037471 Bacteria 1600
221 Ga0395901_0043159 3300038443 Bacteria 4678
222 Ga0451791_1235603 3300041451 Bacteria 1474
223 Ga0451841_1241192 3300041498 Bacteria 869
224 Ga0451853_2945721 3300041512 Unclassified 2354
225 Ga0466972_0041272 3300044658 Bacteria 2247
226 Ga0466966_0333628 3300044684 Bacteria 911
227 Ga0466963_0002561 3300044694 Bacteria 10194
228 Ga0466963_0008019 3300044694 Bacteria 6321
229 Ga0466963_0012076 3300044694 Bacteria 5278
230 Ga0466957_0003682 3300044842 Bacteria 8460
231 Ga0466960_0034385 3300044901 Bacteria 2362
232 Ga0466960_0072575 3300044901 Bacteria 1716
233 Ga0466960_0137472 3300044901 Bacteria 1295
234 Ga0466967_0000007 3300045976 Bacteria 135597
235 Ga0466967_0238504 3300045976 Bacteria 1734
236 Ga0466967_0262717 3300045976 Bacteria 1652
237 Ga0466967_0300297 3300045976 Bacteria 1545
238 Ga0495592_0006735 3300046454 Bacteria 8570
239 Ga0495592_0034919 3300046454 Bacteria 3789
240 Ga0495592_0227350 3300046454 Bacteria 1244
241 Ga0495603_0097046 3300046455 Bacteria 1722
242 Ga0495629_0069742 3300046459 Bacteria 2453
243 Ga0495651_0119605 3300046462 Bacteria 1937
244 Ga0495651_0427540 3300046462 Bacteria 860
245 Ga0495653_0036050 3300046463 Bacteria 3899
246 Ga0495653_0158514 3300046463 Bacteria 1573
247 Ga0495653_0330460 3300046463 Bacteria 985
248 Ga0495582_0000007 3300046473 Bacteria 139882
249 Ga0495582_0139833 3300046473 Bacteria 1372
250 Ga0495639_0115490 3300046475 Bacteria 1277
251 Ga0495662_0000121 3300046476 Bacteria 28985
252 Ga0495662_0007222 3300046476 Bacteria 5499
253 Ga0495584_0057482 3300046491 Bacteria 1957
254 Ga0495594_0000005 3300046499 Bacteria 175437
255 Ga0495608_0000590 3300046511 Bacteria 24984
256 Ga0495608_0001675 3300046511 Bacteria 15943
257 Ga0495618_0000003 3300046514 Bacteria 256269
258 Ga0495628_0002265 3300046516 Bacteria 17396
259 Ga0495628_0009797 3300046516 Bacteria 8160
260 Ga0495628_0483054 3300046516 Unclassified 896
261 Ga0495630_0048527 3300046517 Bacteria 3177
262 Ga0495644_0001081 3300046523 Bacteria 11303
263 Ga0495652_0000060 3300046529 Bacteria 111891
264 Ga0495652_0000061 3300046529 Bacteria 111729
265 Ga0495640_0017817 3300046533 Bacteria 5283
266 Ga0495640_0070453 3300046533 Bacteria 2349
267 Ga0495586_0159103 3300046535 Bacteria 1273
268 Ga0495587_0001311 3300046536 Bacteria 16514
269 Ga0495587_0055539 3300046536 Bacteria 2332
270 Ga0495587_0098059 3300046536 Bacteria 1690
271 Ga0495622_0000026 3300046557 Bacteria 137934
272 Ga0495634_0067444 3300046642 Bacteria 2367
273 Ga0495634_0315438 3300046642 Bacteria 942
274 Ga0495625_0000319 3300046660 Bacteria 73241
275 Ga0495635_0000009 3300046663 Bacteria 259024
276 Ga0495657_0000992 3300046675 Bacteria 24981
277 Ga0495599_0006927 3300046678 Bacteria 6853
278 Ga0495623_0213251 3300046679 Bacteria 1104
279 Ga0495647_0004626 3300046681 Bacteria 4484
280 Ga0495658_0000007 3300046683 Bacteria 139822
281 Ga0495669_0000074 3300046684 Bacteria 66373
282 Ga0495613_0000003 3300046689 Bacteria 248826
283 Ga0495613_0000522 3300046689 Bacteria 32082
284 Ga0495613_0379794 3300046689 Bacteria 966
285 Ga0495624_0000002 3300046690 Bacteria 189957
286 Ga0495624_0038248 3300046690 Bacteria 3083
287 Ga0495649_0005823 3300046694 Bacteria 7756
288 Ga0495600_0000841 3300046809 Bacteria 16371
289 Ga0495600_0009409 3300046809 Bacteria 6037
290 Ga0495604_0000344 3300047317 Bacteria 41631
291 Ga0495674_0000027 3300047319 Bacteria 132744
292 Ga0495672_0350561 3300047320 Bacteria 686
293 Ga0495676_0002121 3300047321 Bacteria 17511
294 Ga0495676_0664027 3300047321 Bacteria 676
295 Ga0495680_0000255 3300047322 Bacteria 58745
296 Ga0495680_0083180 3300047322 Bacteria 2414
297 Ga0495675_0000520 3300047444 Bacteria 24971
298 Ga0495675_0276714 3300047444 Bacteria 1002
299 Ga0495686_0021726 3300047472 Bacteria 4256
300 Ga0495593_0026116 3300047673 Bacteria 3228
301 Ga0495593_0076305 3300047673 Bacteria 1737
302 Ga0495602_0000008 3300048088 Bacteria 260157
303 Ga0496100_0000534 3300048903 Bacteria 18056
304 Ga0496101_0001866 3300048904 Bacteria 12729
305 Ga0496102_0095151 3300048905 Bacteria 2760
306 Ga0496102_0171995 3300048905 Bacteria 2039
307 Ga0496103_0104820 3300048906 Bacteria 1792
308 Ga0496103_0248660 3300048906 Bacteria 1144
309 Ga0496104_0000139 3300048907 Bacteria 67432
310 Ga0496104_0020392 3300048907 Bacteria 6077
311 Ga0496104_0026063 3300048907 Bacteria 5393
312 Ga0496104_0042161 3300048907 Bacteria 4282
313 Ga0496104_0061268 3300048907 Bacteria 3567
314 Ga0496104_0260727 3300048907 Bacteria 1646
315 Ga0496105_0000054 3300048908 Bacteria 89081
316 Ga0496105_0007524 3300048908 Bacteria 8438
317 Ga0496105_0083889 3300048908 Bacteria 2631
318 Ga0496106_0074555 3300048909 Bacteria 2598
319 Ga0496107_0032996 3300048910 Bacteria 3703
320 Ga0496107_0280150 3300048910 Bacteria 1241
321 Ga0496108_0010893 3300048911 Bacteria 7381
322 Ga0496109_0010278 3300048912 Bacteria 7991
323 Ga0496109_0018451 3300048912 Bacteria 6129
324 Ga0496109_0089132 3300048912 Bacteria 2852
325 Ga0496109_0108096 3300048912 Bacteria 2585
326 Ga0496109_0425584 3300048912 Bacteria 1254
327 Ga0496110_0012756 3300048913 Bacteria 6920
328 Ga0496110_0282960 3300048913 Bacteria 1510
329 Ga0496111_0009197 3300048914 Bacteria 6580
330 Ga0496111_0406995 3300048914 Bacteria 1005
331 Ga0496112_0000401 3300048915 Bacteria 28280
332 Ga0496112_0002086 3300048915 Bacteria 15849
333 Ga0496112_0046116 3300048915 Bacteria 4274
334 Ga0496112_0156511 3300048915 Bacteria 2246
335 Ga0496112_0424334 3300048915 Bacteria 1268
336 Ga0496113_0000012 3300048916 Bacteria 81903
337 Ga0496113_0098878 3300048916 Bacteria 2259
338 Ga0496113_0101423 3300048916 Bacteria 2231
339 Ga0496113_0150608 3300048916 Bacteria 1835
340 Ga0496114_0075323 3300048917 Bacteria 2842
341 Ga0496114_0268245 3300048917 Bacteria 1504
342 Ga0496115_0000005 3300048918 Bacteria 290756
343 Ga0496116_0000171 3300048919 Bacteria 130787
344 Ga0496117_0001565 3300048920 Bacteria 32481
345 Ga0496117_0109631 3300048920 Bacteria 1723
346 Ga0496118_0016112 3300048921 Bacteria 6875
347 Ga0496119_0000646 3300048922 Bacteria 46969
348 Ga0496119_0016121 3300048922 Bacteria 5707
349 Ga0496119_0017016 3300048922 Bacteria 5497
350 Ga0496120_0002434 3300048923 Bacteria 18836
351 Ga0496121_0003459 3300048924 Bacteria 22507
352 Ga0496125_0049209 3300048928 Bacteria 3505
353 Ga0501031_0002651 3300049568 Bacteria 11391
354 Ga0501032_0004279 3300049569 Bacteria 10781
355 Ga0501033_0002064 3300049570 Bacteria 17448
356 Ga0501033_0557774 3300049570 Bacteria 789
357 Ga0501034_0008906 3300049571 Bacteria 10547
358 Ga0501034_0022297 3300049571 Bacteria 6455
359 Ga0501034_0073214 3300049571 Bacteria 3435
360 Ga0501034_0512810 3300049571 Bacteria 1112
361 Ga0501034_0564966 3300049571 Bacteria 1046
362 Ga0501034_0625185 3300049571 Bacteria 980
363 Ga0501036_0003518 3300049572 Bacteria 12528
364 Ga0501036_0339423 3300049572 Bacteria 1255
365 Ga0501037_0001252 3300049573 Bacteria 18719
366 Ga0501038_0005028 3300049574 Bacteria 12281
367 Ga0501039_0219509 3300049575 Bacteria 1495
368 Ga0501040_0105585 3300049576 Bacteria 1968
369 Ga0501040_0169094 3300049576 Bacteria 1547
370 Ga0501040_0249356 3300049576 Bacteria 1266
371 Ga0501040_0399473 3300049576 Bacteria 987
372 Ga0501042_0049181 3300049578 Bacteria 3008
373 Ga0501042_0070333 3300049578 Bacteria 2503
374 Ga0501042_0083977 3300049578 Bacteria 2283
375 Ga0501043_0001823 3300049579 Bacteria 18291
376 Ga0501046_0000805 3300049580 Bacteria 30458
377 Ga0501046_0138636 3300049580 Bacteria 1842
378 Ga0501047_0022981 3300049581 Bacteria 5986
379 Ga0501047_0042870 3300049581 Bacteria 4371
380 Ga0501047_0101428 3300049581 Bacteria 2757
381 Ga0501047_0152534 3300049581 Bacteria 2186
382 Ga0501048_0001297 3300049582 Bacteria 18966
383 Ga0501067_0022724 3300049583 Bacteria 3471
384 Ga0501067_0151337 3300049583 Bacteria 1293
385 Ga0501068_0091743 3300049584 Bacteria 1875
386 Ga0501069_0027522 3300049585 Bacteria 3114
387 Ga0501069_0029253 3300049585 Bacteria 3023
388 Ga0501070_0000162 3300049586 Bacteria 61079
389 Ga0501070_0000820 3300049586 Bacteria 28241
390 Ga0501070_0053909 3300049586 Bacteria 3335
391 Ga0501070_0077641 3300049586 Bacteria 2748
392 Ga0501070_0095852 3300049586 Bacteria 2454
393 Ga0501070_0425875 3300049586 Bacteria 1071
394 Ga0501071_0040722 3300049587 Bacteria 3325
395 Ga0501071_0480918 3300049587 Bacteria 952
396 Ga0501071_0553116 3300049587 Bacteria 884
397 Ga0501072_0011776 3300049588 Bacteria 6680
398 Ga0501073_0003973 3300049589 Bacteria 11092
399 Ga0501074_0049772 3300049590 Bacteria 3025
400 Ga0501074_0078602 3300049590 Bacteria 2367
401 Ga0501074_0079358 3300049590 Bacteria 2355
402 Ga0501075_0310235 3300049591 Bacteria 1202
403 Ga0501076_0061966 3300049592 Bacteria 2978
404 Ga0501079_0004331 3300049741 Bacteria 10532
405 Ga0501079_0332688 3300049741 Bacteria 1189
406 Ga0501080_0056860 3300049742 Bacteria 3642
407 Ga0501083_0002568 3300049744 Bacteria 12482
408 Ga0501083_0003366 3300049744 Bacteria 11188
409 Ga0501083_0027121 3300049744 Bacteria 3954
410 Ga0501083_0182426 3300049744 Bacteria 1370
411 Ga0501035_0041009 3300049822 Bacteria 4180
412 Ga0501035_0290012 3300049822 Bacteria 1381
413 Ga0501044_0000092 3300049823 Bacteria 110012
414 Ga0501044_0037349 3300049823 Bacteria 5077
415 Ga0501044_0201730 3300049823 Bacteria 1947
416 nmdc:mga05p37_73020_c1 3300050507 Bacteria 4222
417 nmdc:mga09592_2380_c1 3300050508 Bacteria 9018
418 nmdc:mga09592_40394_c1 3300050508 Bacteria 3919
419 nmdc:mga0qj67_24600_c1 3300050509 Bacteria 4644
420 nmdc:mga0n895_210632_c1 3300050512 Bacteria 1974
421 nmdc:mga0rr50_109527_c1 3300050513 Bacteria 2183
422 nmdc:mga0rr50_139436_c1 3300050513 Bacteria 1949
423 nmdc:mga0a205_12_c2 3300050515 Bacteria 69190
424 Ga0495601_0000080 3300053077 Bacteria 51518
425 Ga0495601_0000098 3300053077 Bacteria 48076
426 Ga0495601_0015624 3300053077 Bacteria 4590
427 Ga0495601_0071335 3300053077 Bacteria 2218
428 Ga0495612_0000358 3300053078 Bacteria 18497
429 Ga0495612_0004015 3300053078 Bacteria 6097
430 Ga0495595_0000069 3300053084 Bacteria 50835
431 Ga0495595_0000187 3300053084 Bacteria 24981
432 Ga0495595_0038565 3300053084 Bacteria 2177
433 Ga0495619_0000269 3300053085 Bacteria 37723
434 Ga0495619_0000542 3300053085 Bacteria 24940
435 Ga0495619_0002006 3300053085 Bacteria 13544
436 Ga0500566_0032715 3300053094 Bacteria 3033
437 Ga0500641_0073651 3300053096 Bacteria 1441
438 Ga0500556_0000761 3300053104 Bacteria 19145
439 Ga0500595_014986 3300053119 Bacteria 2924
440 Ga0500616_0008278 3300053153 Bacteria 6477
441 Ga0501084_0054317 3300054114 Bacteria 3351
442 Ga0501084_0150121 3300054114 Bacteria 1964
443 Ga0501084_0361774 3300054114 Unclassified 1226
444 Ga0501082_0382329 3300060353 Bacteria 1228
445 Ga0530510_0189564 3300061734 Bacteria 1526
446 Ga0070712_100000008
447 JGI24746J21847_1014142
448 JGI24740J21852_10004455
449 JGI24751J29686_10032656
450 JGI25406J46586_10021246
451 rootH2_10028258
452 Ga0070683_100008454
453 Ga0070683_100045086
454 Ga0070683_100213949
455 Ga0070670_100482563
456 Ga0070666_10009263
457 Ga0070680_100214802
458 Ga0070682_100000057
459 Ga0068868_100001251
460 Ga0068868_100001603
461 Ga0068868_100492066
462 Ga0070660_100113565
463 Ga0070689_100084218
464 Ga0070691_10000945
465 Ga0070661_100000031
466 Ga0070692_10011332
467 Ga0070668_100084608
468 Ga0070669_100020893
469 Ga0070674_100347572
470 Ga0070688_100000506
471 Ga0070688_100000848
472 Ga0070688_100052007
473 Ga0070659_100000026
474 Ga0070659_100002416
475 Ga0070667_100009469
476 Ga0070667_100012962
477 Ga0070714_100000083
478 Ga0070714_100015068
479 Ga0070714_100288454
480 Ga0070713_100000040
481 Ga0070710_10000008
482 Ga0070700_100249714
483 Ga0070663_100000467
484 Ga0070678_100063955
485 Ga0070662_100000005
486 Ga0070681_10003375
487 Ga0068867_100003143
488 Ga0068867_100421439
489 Ga0070685_10000932
490 Ga0070685_10002367
491 Ga0070685_10032379
492 Ga0070699_100307407
493 Ga0070679_100000342
494 Ga0070684_100003262
495 Ga0070684_100230579
496 Ga0068853_100423231
497 Ga0070693_100000815
498 Ga0070665_100000159
499 Ga0070665_100042877
500 Ga0070665_100095054
501 Ga0070665_100186150
502 Ga0070665_100400863
503 Ga0070665_100404851
504 Ga0070704_100326570
505 Ga0070664_100038959
506 Ga0068856_100001306
507 Ga0068856_100011606
508 Ga0068856_100032781
509 Ga0070702_100266462
510 Ga0068859_100750120
511 Ga0068864_100000262
512 Ga0068863_100028180
513 Ga0068863_100380792
514 Ga0068858_100000049
515 Ga0068860_100008225
516 Ga0068862_100033968
517 Ga0081455_10035792
518 Ga0081455_10056788
519 Ga0081455_10132245
520 Ga0081538_10000953
521 Ga0081540_1000827
522 Ga0081540_1089201
523 Ga0081539_10003954
524 Ga0081539_10047102
525 Ga0070717_10000004
526 Ga0097621_100254090
527 Ga0097621_100522772
528 Ga0068871_100188171
529 Ga0068871_100289952
530 Ga0075428_100013292
531 Ga0075430_100029305
532 Ga0075430_100329826
533 Ga0075433_10000093
534 Ga0075433_10083115
535 Ga0075429_100038864
536 Ga0075429_100339209
537 Ga0068865_100000001
538 Ga0075435_100199341
539 Ga0075435_100214594
540 Ga0105240_10231305
541 Ga0105240_10356163
542 Ga0111539_10727675
543 Ga0105245_10000091
544 Ga0105245_10001248
545 Ga0105245_10001267
546 Ga0105247_10130562
547 Ga0114129_10174145
548 Ga0114129_10383691
549 Ga0105242_10114702
550 Ga0105237_10106231
551 Ga0105238_10000028
552 Ga0105238_10900229
553 Ga0105238_10940779
554 Ga0105249_10025930
555 Ga0105239_10177655
556 Ga0105246_10004963
557 Ga0157370_10462273
558 Ga0157369_10000128
559 Ga0157378_10039229
560 Ga0163162_10736949
561 Ga0157372_10436627
562 Ga0157375_10028143
563 Ga0163163_10134447
564 Ga0163163_10140549
565 Ga0157380_10000373
566 Ga0157379_10102932
567 Ga0157379_10136410
568 Ga0157376_10004957
569 Ga0157376_10204144
570 Ga0163161_10000073
571 Ga0163161_10475832
572 Ga0207692_10000006
573 Ga0207710_10006500
574 Ga0207710_10139292
575 Ga0207680_10022252
576 Ga0207680_10037612
577 Ga0207643_10059497
578 Ga0207707_10011008
579 Ga0207695_10212374
580 Ga0207693_10000002
581 Ga0207663_10009495
582 Ga0207660_10306436
583 Ga0207662_10160099
584 Ga0207657_10116134
585 Ga0207649_10000021
586 Ga0207652_10000351
587 Ga0207652_10124730
588 Ga0207652_10366676
589 Ga0207694_10000008
590 Ga0207687_10000042
591 Ga0207687_10000613
592 Ga0207700_10000032
593 Ga0207664_10000006
594 Ga0207664_10004303
595 Ga0207644_10075239
596 Ga0207690_10000098
597 Ga0207690_10001263
598 Ga0207706_10000006
599 Ga0207670_10071409
600 Ga0207704_10000012
601 Ga0207661_10002060
602 Ga0207661_10004186
603 Ga0207661_10014746
604 Ga0207661_10028868
605 Ga0207661_10056532
606 Ga0207661_10102601
607 Ga0207661_10646787
608 Ga0207679_10000801
609 Ga0207712_10416960
610 Ga0207668_10040797
611 Ga0207658_10017888
612 Ga0207677_10000902
613 Ga0207677_10004205
614 Ga0207703_10000132
615 Ga0207703_10059233
616 Ga0207639_10031399
617 Ga0207678_10017109
618 Ga0207678_10638803
619 Ga0207708_10128963
620 Ga0207702_10000316
621 Ga0207702_10002888
622 Ga0207702_10023625
623 Ga0207641_10000071
624 Ga0207641_10035448
625 Ga0207648_10001595
626 Ga0207676_10000038
627 Ga0207683_10186815
628 Ga0207698_10479780
629 Ga0268266_10000023
630 Ga0268266_10000498
631 Ga0268266_10072429
632 Ga0268266_10149561
633 Ga0268266_10298440
634 Ga0268265_10111830
635 Ga0268264_10003521
636 Ga0265326_10000010
637 Ga0265319_1000548
638 Ga0265319_1000862
639 Ga0265334_10000003
640 Ga0265336_10028725
641 Ga0265338_10000047
642 Ga0265338_10215594
643 Ga0265338_10307385
644 Ga0265324_10001716
645 Ga0265324_10048017
646 Ga0265320_10172856
647 Ga0265325_10004563
648 Ga0265331_10019982
649 Ga0265316_10195625
650 Ga0307513_10249219
651 Ga0316576_10034832
652 Ga0316578_10048973
653 Ga0307413_10151674
654 Ga0307412_10505529
655 Ga0307409_100060147
656 Ga0307416_100633796
657 Ga0307414_10366851
658 Ga0307415_100047643
659 Ga0373923_0111300
660 Ga0373947_0277793
661 Ga0373937_0006840
662 Ga0373937_0052423
663 Ga0395899_0393200
664 Ga0395898_0050216
665 Ga0395905_0266205
666 Ga0395901_0043159
667 Ga0451791_1235603
668 Ga0451841_1241192
669 Ga0451853_2945721
670 Ga0466972_0041272
671 Ga0466966_0333628
672 Ga0466963_0002561
673 Ga0466963_0008019
674 Ga0466963_0012076
675 Ga0466957_0003682
676 Ga0466960_0034385
677 Ga0466960_0072575
678 Ga0466960_0137472
679 Ga0466967_0000007
680 Ga0466967_0238504
681 Ga0466967_0262717
682 Ga0466967_0300297
683 Ga0495592_0006735
684 Ga0495592_0034919
685 Ga0495592_0227350
686 Ga0495603_0097046
687 Ga0495629_0069742
688 Ga0495651_0119605
689 Ga0495651_0427540
690 Ga0495653_0036050
691 Ga0495653_0158514
692 Ga0495653_0330460
693 Ga0495582_0000007
694 Ga0495582_0139833
695 Ga0495639_0115490
696 Ga0495662_0000121
697 Ga0495662_0007222
698 Ga0495584_0057482
699 Ga0495594_0000005
700 Ga0495608_0000590
701 Ga0495608_0001675
702 Ga0495618_0000003
703 Ga0495628_0002265
704 Ga0495628_0009797
705 Ga0495628_0483054
706 Ga0495630_0048527
707 Ga0495644_0001081
708 Ga0495652_0000060
709 Ga0495652_0000061
710 Ga0495640_0017817
711 Ga0495640_0070453
712 Ga0495586_0159103
713 Ga0495587_0001311
714 Ga0495587_0055539
715 Ga0495587_0098059
716 Ga0495622_0000026
717 Ga0495634_0067444
718 Ga0495634_0315438
719 Ga0495625_0000319
720 Ga0495635_0000009
721 Ga0495657_0000992
722 Ga0495599_0006927
723 Ga0495623_0213251
724 Ga0495647_0004626
725 Ga0495658_0000007
726 Ga0495669_0000074
727 Ga0495613_0000003
728 Ga0495613_0000522
729 Ga0495613_0379794
730 Ga0495624_0000002
731 Ga0495624_0038248
732 Ga0495649_0005823
733 Ga0495600_0000841
734 Ga0495600_0009409
735 Ga0495604_0000344
736 Ga0495674_0000027
737 Ga0495672_0350561
738 Ga0495676_0002121
739 Ga0495676_0664027
740 Ga0495680_0000255
741 Ga0495680_0083180
742 Ga0495675_0000520
743 Ga0495675_0276714
744 Ga0495686_0021726
745 Ga0495593_0026116
746 Ga0495593_0076305
747 Ga0495602_0000008
748 Ga0496100_0000534
749 Ga0496101_0001866
750 Ga0496102_0095151
751 Ga0496102_0171995
752 Ga0496103_0104820
753 Ga0496103_0248660
754 Ga0496104_0000139
755 Ga0496104_0020392
756 Ga0496104_0026063
757 Ga0496104_0042161
758 Ga0496104_0061268
759 Ga0496104_0260727
760 Ga0496105_0000054
761 Ga0496105_0007524
762 Ga0496105_0083889
763 Ga0496106_0074555
764 Ga0496107_0032996
765 Ga0496107_0280150
766 Ga0496108_0010893
767 Ga0496109_0010278
768 Ga0496109_0018451
769 Ga0496109_0089132
770 Ga0496109_0108096
771 Ga0496109_0425584
772 Ga0496110_0012756
773 Ga0496110_0282960
774 Ga0496111_0009197
775 Ga0496111_0406995
776 Ga0496112_0000401
777 Ga0496112_0002086
778 Ga0496112_0046116
779 Ga0496112_0156511
780 Ga0496112_0424334
781 Ga0496113_0000012
782 Ga0496113_0098878
783 Ga0496113_0101423
784 Ga0496113_0150608
785 Ga0496114_0075323
786 Ga0496114_0268245
787 Ga0496115_0000005
788 Ga0496116_0000171
789 Ga0496117_0001565
790 Ga0496117_0109631
791 Ga0496118_0016112
792 Ga0496119_0000646
793 Ga0496119_0016121
794 Ga0496119_0017016
795 Ga0496120_0002434
796 Ga0496121_0003459
797 Ga0496125_0049209
798 Ga0501031_0002651
799 Ga0501032_0004279
800 Ga0501033_0002064
801 Ga0501033_0557774
802 Ga0501034_0008906
803 Ga0501034_0022297
804 Ga0501034_0073214
805 Ga0501034_0512810
806 Ga0501034_0564966
807 Ga0501034_0625185
808 Ga0501036_0003518
809 Ga0501036_0339423
810 Ga0501037_0001252
811 Ga0501038_0005028
812 Ga0501039_0219509
813 Ga0501040_0105585
814 Ga0501040_0169094
815 Ga0501040_0249356
816 Ga0501040_0399473
817 Ga0501042_0049181
818 Ga0501042_0070333
819 Ga0501042_0083977
820 Ga0501043_0001823
821 Ga0501046_0000805
822 Ga0501046_0138636
823 Ga0501047_0022981
824 Ga0501047_0042870
825 Ga0501047_0101428
826 Ga0501047_0152534
827 Ga0501048_0001297
828 Ga0501067_0022724
829 Ga0501067_0151337
830 Ga0501068_0091743
831 Ga0501069_0027522
832 Ga0501069_0029253
833 Ga0501070_0000162
834 Ga0501070_0000820
835 Ga0501070_0053909
836 Ga0501070_0077641
837 Ga0501070_0095852
838 Ga0501070_0425875
839 Ga0501071_0040722
840 Ga0501071_0480918
841 Ga0501071_0553116
842 Ga0501072_0011776
843 Ga0501073_0003973
844 Ga0501074_0049772
845 Ga0501074_0078602
846 Ga0501074_0079358
847 Ga0501075_0310235
848 Ga0501076_0061966
849 Ga0501079_0004331
850 Ga0501079_0332688
851 Ga0501080_0056860
852 Ga0501083_0002568
853 Ga0501083_0003366
854 Ga0501083_0027121
855 Ga0501083_0182426
856 Ga0501035_0041009
857 Ga0501035_0290012
858 Ga0501044_0000092
859 Ga0501044_0037349
860 Ga0501044_0201730
861 nmdc:mga05p37_73020_c1
862 nmdc:mga09592_2380_c1
863 nmdc:mga09592_40394_c1
864 nmdc:mga0qj67_24600_c1
865 nmdc:mga0n895_210632_c1
866 nmdc:mga0rr50_109527_c1
867 nmdc:mga0rr50_139436_c1
868 nmdc:mga0a205_12_c2
869 Ga0495601_0000080
870 Ga0495601_0000098
871 Ga0495601_0015624
872 Ga0495601_0071335
873 Ga0495612_0000358
874 Ga0495612_0004015
875 Ga0495595_0000069
876 Ga0495595_0000187
877 Ga0495595_0038565
878 Ga0495619_0000269
879 Ga0495619_0000542
880 Ga0495619_0002006
881 Ga0500566_0032715
882 Ga0500641_0073651
883 Ga0500556_0000761
884 Ga0500595_014986
885 Ga0500616_0008278
886 Ga0501084_0054317
887 Ga0501084_0150121
888 Ga0501084_0361774
889 Ga0501082_0382329
890 Ga0530510_0189564

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01790

LGT

Prolipoprotein diacylglyceryl transferase

25

264

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5azc-assembly1.cif.gz_A crystal structure of escherichia coli lgt in complex with phosphatidylglycerol 0.7783 2 237
5azc-assembly1.cif.gz_A crystal structure of escherichia coli lgt in complex with phosphatidylglycerol 0.7593 2 237
4h1v-assembly1.cif.gz_A gmp-pnp bound dynamin-1-like protein gtpase-ged fusion 0.58 158 233
3eon-assembly1.cif.gz_B 2.55a crystal structure of native glutaryl-coa dehydrogenase from burkholderia pseudomallei in complex with a small molecule 0.4142 94 239
2dvl-assembly1.cif.gz_A crystal structure of project tt0160 from thermus thermophilus hb8 0.4097 89 201
ID Description Score Start End Superfamily
af_B6TCK1_81_261_1.20.120.810 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Vinculin, Vh2 four-helix bundle 0.4404 14 99 1.20.120.810
5lnxA03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.4085 102 236 1.20.140.10
5lnxA03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.4017 102 236 1.20.140.10
3d6bD03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.38 105 241 1.20.140.10
af_P52067_222_406_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3743 14 127 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A6B0WXN0-F1-model_v4 Prolipoprotein diacylglyceryl transferase 0.9678 105 239 GO:0005886
GO:0008961
GO:0042158
AF-A0A3D4B174-F1-model_v4 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (EC 2.5.1.145) 0.9422 1 239 GO:0005886
GO:0008961
GO:0042158
AF-A0A7K0S188-F1-model_v4 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (EC 2.5.1.145) 0.9382 1 242 GO:0005886
GO:0008961
GO:0042158
AF-A0A523HHJ8-F1-model_v4 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (EC 2.5.1.145) 0.9369 1 238 GO:0005886
GO:0008961
GO:0042158
AF-A0A7K0S188-F1-model_v4 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (EC 2.5.1.145) 0.9344 1 242 GO:0005886
GO:0008961
GO:0042158

Map