F445470

General Info

Members Datasets Scaffolds Average Seq Length
445 214 890 168

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_100193757|Ga0068871_1001937573
Length 196
Sequence MPPPLPAKPELDEHSHRAPGSGDPAMAGAPSGDAAGGDVLPLSSIDIAAVRALLAGHGIALEIVGDGAPIPGSFWGDSEAGVIGTTVYVRADTPVHSLLHEACHLIVAPADRRERIHTDASDSQAEEDATCYLQIVLAGALPGVGCARLCEDMDRWGYTFRLGSARAWFEHDAEDARAWLIERGLLDDTAAAKIPI

Samples

Sample ID Description Type Environment
1 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
69 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
70 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
73 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
74 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
126 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
127 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
128 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
131 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
132 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
135 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
136 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
139 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
140 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
141 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
142 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
143 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
144 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
145 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
146 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
147 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
148 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
149 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
150 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
155 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
156 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
157 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
158 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
159 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
160 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
161 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
162 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
172 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
173 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
174 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
206 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
207 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
211 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
212 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
213 2919404418 Luteibacter sp. 3190 Isolate Unclassified
214 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 0
Isolates 1.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.72
Nodule 0
Rhizoplane 1.8
Rhizosphere 86.29
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068871_100193757 3300006358 Bacteria 1752
2 JGI25152J39213_1000146 3300002773 Bacteria 48401
3 JGI25150J39212_1000120 3300002774 Bacteria 44029
4 JGI25151J46595_10000107 3300003187 Bacteria 113288
5 JGI25153J46596_10000078 3300003215 Bacteria 113288
6 Ga0055536_1013234 3300003781 Bacteria 2996
7 Ga0055531_10019412 3300003794 Bacteria 2750
8 Ga0065165_1000108 3300005262 Bacteria 139605
9 Ga0070683_100489650 3300005329 Bacteria 1174
10 Ga0070690_100021925 3300005330 Bacteria 3905
11 Ga0070670_100089644 3300005331 Bacteria 2643
12 Ga0070670_100411065 3300005331 Bacteria 1196
13 Ga0068869_100043216 3300005334 Bacteria 3235
14 Ga0070666_10000636 3300005335 Bacteria 21149
15 Ga0070666_10010925 3300005335 Bacteria 5688
16 Ga0070666_10030857 3300005335 Bacteria 3534
17 Ga0070680_100055870 3300005336 Bacteria 3226
18 Ga0068868_100167113 3300005338 Bacteria 1820
19 Ga0070661_100031158 3300005344 Bacteria 3855
20 Ga0070661_100165445 3300005344 Bacteria 1677
21 Ga0070661_100209806 3300005344 Bacteria 1490
22 Ga0070668_100008957 3300005347 Bacteria 7431
23 Ga0070668_100295660 3300005347 Bacteria 1357
24 Ga0070671_100097651 3300005355 Bacteria 2463
25 Ga0070688_101136865 3300005365 Bacteria 625
26 Ga0070667_100007761 3300005367 Bacteria 8895
27 Ga0070667_100009126 3300005367 Bacteria 8206
28 Ga0070667_100124980 3300005367 Bacteria 2241
29 Ga0070667_100169717 3300005367 Bacteria 1926
30 Ga0070667_100799493 3300005367 Bacteria 876
31 Ga0070709_10073071 3300005434 Bacteria 2219
32 Ga0070663_100066203 3300005455 Bacteria 2617
33 Ga0070663_100069655 3300005455 Bacteria 2556
34 Ga0070663_100143304 3300005455 Unclassified 1826
35 Ga0070663_101215791 3300005455 Bacteria 662
36 Ga0070662_100146859 3300005457 Bacteria 1832
37 Ga0070681_10049558 3300005458 Bacteria 4193
38 Ga0070681_10079916 3300005458 Bacteria 3226
39 Ga0068867_100144175 3300005459 Bacteria 1864
40 Ga0070685_10013931 3300005466 Bacteria 4254
41 Ga0070679_100032036 3300005530 Bacteria 5198
42 Ga0070679_100081455 3300005530 Bacteria 3226
43 Ga0070684_100437259 3300005535 Bacteria 1208
44 Ga0068853_100001939 3300005539 Bacteria 15267
45 Ga0068853_100007540 3300005539 Bacteria 8708
46 Ga0068853_100013549 3300005539 Bacteria 6663
47 Ga0068853_100014175 3300005539 Bacteria 6526
48 Ga0068853_100017218 3300005539 Bacteria 5965
49 Ga0068853_100305437 3300005539 Bacteria 1472
50 Ga0068853_100540176 3300005539 Bacteria 1103
51 Ga0068853_100891788 3300005539 Bacteria 854
52 Ga0070696_100002124 3300005546 Bacteria 13032
53 Ga0070665_100000092 3300005548 Bacteria 174397
54 Ga0070665_100000807 3300005548 Bacteria 40948
55 Ga0070665_100059503 3300005548 Bacteria 3830
56 Ga0070665_101171483 3300005548 Bacteria 779
57 Ga0070665_101668646 3300005548 Bacteria 645
58 Ga0068855_100007741 3300005563 Bacteria 12975
59 Ga0068855_100013153 3300005563 Bacteria 9981
60 Ga0068855_100157367 3300005563 Bacteria 2581
61 Ga0068855_101327662 3300005563 Bacteria 743
62 Ga0068857_100023484 3300005577 Bacteria 5428
63 Ga0068857_100030412 3300005577 Bacteria 4768
64 Ga0068857_100245902 3300005577 Bacteria 1639
65 Ga0068854_100242172 3300005578 Bacteria 1437
66 Ga0068854_101192540 3300005578 Bacteria 682
67 Ga0068856_100016152 3300005614 Bacteria 7219
68 Ga0068856_100153649 3300005614 Bacteria 2311
69 Ga0068852_100812463 3300005616 Bacteria 949
70 Ga0068864_100046469 3300005618 Bacteria 3725
71 Ga0068864_100397201 3300005618 Bacteria 1310
72 Ga0068851_10000643 3300005834 Bacteria 14875
73 Ga0068863_100000329 3300005841 Bacteria 48080
74 Ga0068863_100003282 3300005841 Bacteria 15974
75 Ga0068863_100063614 3300005841 Bacteria 3489
76 Ga0068863_100175017 3300005841 Bacteria 2059
77 Ga0068863_100230413 3300005841 Bacteria 1787
78 Ga0068863_100257111 3300005841 Bacteria 1688
79 Ga0068858_100002671 3300005842 Bacteria 17949
80 Ga0068858_100040752 3300005842 Bacteria 4308
81 Ga0068858_100115536 3300005842 Bacteria 2508
82 Ga0068858_100908159 3300005842 Bacteria 861
83 Ga0068860_100005962 3300005843 Bacteria 12260
84 Ga0068860_100011701 3300005843 Bacteria 8648
85 Ga0068860_100025326 3300005843 Bacteria 5726
86 Ga0068860_100738197 3300005843 Bacteria 996
87 Ga0068862_100007271 3300005844 Bacteria 9187
88 Ga0068862_100505488 3300005844 Bacteria 1148
89 Ga0068862_101033756 3300005844 Bacteria 814
90 Ga0075364_10065436 3300006051 Bacteria 2386
91 Ga0075369_10442611 3300006186 Bacteria 615
92 Ga0097621_100096973 3300006237 Bacteria 2475
93 Ga0097621_100104980 3300006237 Bacteria 2381
94 Ga0097621_100122246 3300006237 Bacteria 2209
95 Ga0097621_100291209 3300006237 Bacteria 1439
96 Ga0097621_101182731 3300006237 Bacteria 720
97 Ga0068871_100491245 3300006358 Bacteria 1105
98 Ga0068865_100324000 3300006881 Bacteria 1240
99 Ga0097620_100001643 3300006931 Bacteria 22816
100 Ga0097620_100574048 3300006931 Bacteria 1221
101 Ga0105240_10000617 3300009093 Bacteria 65935
102 Ga0105240_10021268 3300009093 Bacteria 8631
103 Ga0105240_10595580 3300009093 Bacteria 1218
104 Ga0105245_10498165 3300009098 Bacteria 1234
105 Ga0105241_10022409 3300009174 Bacteria 4679
106 Ga0105241_10041687 3300009174 Bacteria 3470
107 Ga0105241_10269566 3300009174 Bacteria 1450
108 Ga0105242_10431355 3300009176 Bacteria 1238
109 Ga0105248_10233341 3300009177 Bacteria 2071
110 Ga0105237_10010967 3300009545 Bacteria 9616
111 Ga0105237_10383537 3300009545 Bacteria 1410
112 Ga0105237_10562569 3300009545 Bacteria 1147
113 Ga0105238_10001654 3300009551 Bacteria 22378
114 Ga0105238_10014095 3300009551 Bacteria 8083
115 Ga0105238_10262532 3300009551 Bacteria 1706
116 Ga0105238_10281603 3300009551 Bacteria 1644
117 Ga0105238_10308229 3300009551 Bacteria 1568
118 Ga0105249_10012883 3300009553 Bacteria 7377
119 Ga0105239_10008231 3300010375 Bacteria 11895
120 Ga0105239_10022128 3300010375 Bacteria 7006
121 Ga0105239_10024562 3300010375 Bacteria 6639
122 Ga0105239_10047732 3300010375 Bacteria 4693
123 Ga0105239_10050021 3300010375 Bacteria 4584
124 Ga0105239_10155520 3300010375 Bacteria 2553
125 Ga0105246_10021624 3300011119 Bacteria 4141
126 Ga0157373_10015585 3300013100 Bacteria 5555
127 Ga0157370_10000272 3300013104 Bacteria 65739
128 Ga0157370_10017678 3300013104 Bacteria 7188
129 Ga0157369_10004930 3300013105 Bacteria 15633
130 Ga0157369_10050765 3300013105 Bacteria 4490
131 Ga0157369_10060661 3300013105 Bacteria 4078
132 Ga0157369_10515425 3300013105 Bacteria 1237
133 Ga0157374_10015724 3300013296 Bacteria 6644
134 Ga0157374_10028502 3300013296 Bacteria 5046
135 Ga0157374_10377120 3300013296 Bacteria 1412
136 Ga0157374_10581260 3300013296 Bacteria 1129
137 Ga0157378_10281908 3300013297 Bacteria 1602
138 Ga0157372_10023028 3300013307 Bacteria 6749
139 Ga0157372_10137491 3300013307 Bacteria 2815
140 Ga0157372_10160372 3300013307 Bacteria 2599
141 Ga0157372_10249433 3300013307 Bacteria 2060
142 Ga0157375_10136397 3300013308 Bacteria 2578
143 Ga0157375_10867185 3300013308 Bacteria 1048
144 Ga0163163_10000589 3300014325 Bacteria 32012
145 Ga0163163_10029266 3300014325 Bacteria 5298
146 Ga0157379_10000908 3300014968 Bacteria 23906
147 Ga0157379_10102727 3300014968 Bacteria 2565
148 Ga0157379_10607340 3300014968 Bacteria 1022
149 Ga0157379_11285780 3300014968 Bacteria 706
150 Ga0157376_10141880 3300014969 Bacteria 2156
151 Ga0157376_10666915 3300014969 Unclassified 1042
152 Ga0157376_11949911 3300014969 Bacteria 625
153 Ga0182006_1000034 3300015261 Bacteria 232484
154 Ga0182007_10003139 3300015262 Bacteria 7942
155 Ga0182005_1000104 3300015265 Bacteria 63629
156 Ga0182005_1187672 3300015265 Bacteria 616
157 Ga0163161_10011738 3300017792 Bacteria 6075
158 Ga0207425_1000028 3300025245 Bacteria 286333
159 Ga0209129_1000065 3300025258 Bacteria 232568
160 Ga0209130_1011999 3300025284 Bacteria 2291
161 Ga0209025_1000002 3300025294 Bacteria 1393142
162 Ga0209758_1000003 3300025297 Bacteria 1398533
163 Ga0209050_1023576 3300025298 Bacteria 2159
164 Ga0209256_1005457 3300025299 Bacteria 7315
165 Ga0209051_1081026 3300025303 Bacteria 936
166 Ga0209257_1016124 3300025304 Bacteria 3047
167 Ga0207656_10015123 3300025321 Bacteria 2983
168 Ga0207656_10067239 3300025321 Bacteria 1586
169 Ga0207710_10009441 3300025900 Bacteria 4104
170 Ga0207680_10023288 3300025903 Bacteria 3379
171 Ga0207680_10056174 3300025903 Bacteria 2376
172 Ga0207680_10164433 3300025903 Bacteria 1490
173 Ga0207647_10000124 3300025904 Bacteria 60056
174 Ga0207647_10008548 3300025904 Bacteria 7330
175 Ga0207647_10032368 3300025904 Bacteria 3360
176 Ga0207699_10063173 3300025906 Bacteria 2236
177 Ga0207654_10000255 3300025911 Bacteria 32349
178 Ga0207654_10182826 3300025911 Bacteria 1369
179 Ga0207654_10418522 3300025911 Bacteria 935
180 Ga0207707_10000572 3300025912 Bacteria 37383
181 Ga0207707_10114155 3300025912 Bacteria 2361
182 Ga0207695_10000032 3300025913 Bacteria 521283
183 Ga0207695_10064043 3300025913 Bacteria 3788
184 Ga0207671_10029087 3300025914 Bacteria 4127
185 Ga0207671_10508793 3300025914 Bacteria 960
186 Ga0207671_11136725 3300025914 Bacteria 613
187 Ga0207663_10075906 3300025916 Bacteria 2182
188 Ga0207660_10013041 3300025917 Bacteria 5443
189 Ga0207657_10002223 3300025919 Bacteria 21052
190 Ga0207649_10033212 3300025920 Bacteria 3081
191 Ga0207649_10272939 3300025920 Bacteria 1226
192 Ga0207649_10378575 3300025920 Bacteria 1054
193 Ga0207649_10409832 3300025920 Bacteria 1016
194 Ga0207652_10000209 3300025921 Bacteria 61861
195 Ga0207694_10002009 3300025924 Bacteria 16833
196 Ga0207694_10051151 3300025924 Bacteria 3202
197 Ga0207650_10019958 3300025925 Bacteria 4719
198 Ga0207650_10046759 3300025925 Bacteria 3187
199 Ga0207687_10195137 3300025927 Bacteria 1578
200 Ga0207644_10115386 3300025931 Bacteria 2037
201 Ga0207644_10628483 3300025931 Bacteria 893
202 Ga0207644_10789085 3300025931 Bacteria 794
203 Ga0207706_10788275 3300025933 Bacteria 808
204 Ga0207704_10008276 3300025938 Bacteria 4960
205 Ga0207691_10070446 3300025940 Bacteria 3157
206 Ga0207711_10116386 3300025941 Bacteria 2383
207 Ga0207689_10063072 3300025942 Bacteria 3048
208 Ga0207689_10149448 3300025942 Bacteria 1925
209 Ga0207689_10617399 3300025942 Bacteria 913
210 Ga0207661_10127563 3300025944 Bacteria 2174
211 Ga0207679_10051104 3300025945 Bacteria 3024
212 Ga0207667_10002516 3300025949 Bacteria 22863
213 Ga0207667_10013082 3300025949 Bacteria 9525
214 Ga0207667_10499340 3300025949 Bacteria 1234
215 Ga0207651_10071190 3300025960 Bacteria 2464
216 Ga0207712_10021091 3300025961 Bacteria 4274
217 Ga0207668_10188229 3300025972 Bacteria 1633
218 Ga0207668_10203884 3300025972 Bacteria 1577
219 Ga0207640_10180440 3300025981 Bacteria 1582
220 Ga0207658_10006517 3300025986 Bacteria 7969
221 Ga0207658_10035000 3300025986 Bacteria 3594
222 Ga0207658_10270468 3300025986 Bacteria 1452
223 Ga0207703_10001626 3300026035 Bacteria 20244
224 Ga0207703_10057270 3300026035 Bacteria 3177
225 Ga0207703_10271603 3300026035 Bacteria 1536
226 Ga0207639_10000465 3300026041 Bacteria 27917
227 Ga0207639_10000722 3300026041 Bacteria 22566
228 Ga0207639_10006308 3300026041 Bacteria 8055
229 Ga0207639_10019646 3300026041 Bacteria 4821
230 Ga0207639_10448626 3300026041 Bacteria 1171
231 Ga0207678_10003824 3300026067 Bacteria 13545
232 Ga0207678_10038784 3300026067 Bacteria 4137
233 Ga0207678_10089429 3300026067 Bacteria 2632
234 Ga0207678_10177338 3300026067 Bacteria 1820
235 Ga0207702_10075543 3300026078 Bacteria 2911
236 Ga0207702_10749428 3300026078 Bacteria 964
237 Ga0207641_10004772 3300026088 Bacteria 11692
238 Ga0207641_10133806 3300026088 Bacteria 2229
239 Ga0207641_10237802 3300026088 Bacteria 1696
240 Ga0207648_10028187 3300026089 Bacteria 4980
241 Ga0207676_10005851 3300026095 Bacteria 8685
242 Ga0207676_10043844 3300026095 Bacteria 3447
243 Ga0207674_10001063 3300026116 Bacteria 35707
244 Ga0207674_10016664 3300026116 Bacteria 8032
245 Ga0207674_10081639 3300026116 Bacteria 3235
246 Ga0207674_10267850 3300026116 Bacteria 1656
247 Ga0207674_10535903 3300026116 Bacteria 1131
248 Ga0207698_10002152 3300026142 Bacteria 11636
249 Ga0268266_10000001 3300028379 Bacteria 4040580
250 Ga0268266_10000013 3300028379 Bacteria 649715
251 Ga0268266_10025209 3300028379 Bacteria 5062
252 Ga0268266_10025689 3300028379 Bacteria 5011
253 Ga0268266_10145676 3300028379 Bacteria 2129
254 Ga0268266_11176198 3300028379 Bacteria 742
255 Ga0268265_10011917 3300028380 Bacteria 5881
256 Ga0268265_10069110 3300028380 Bacteria 2742
257 Ga0268265_10475436 3300028380 Bacteria 1172
258 Ga0268264_10005817 3300028381 Bacteria 10454
259 Ga0268264_10025070 3300028381 Bacteria 4873
260 Ga0268264_10709382 3300028381 Bacteria 1000
261 Ga0436364_1523962 3300037853 Bacteria 705
262 Ga0436363_1302782 3300039450 Bacteria 793
263 Ga0451793_1427862 3300041452 Bacteria 1407
264 Ga0451793_1616407 3300041452 Bacteria 1513
265 Ga0451833_0390586 3300041491 Bacteria 1845
266 Ga0451837_1104326 3300041494 Bacteria 1266
267 Ga0451853_1966601 3300041512 Bacteria 5659
268 Ga0439449_0036278 3300042007 Bacteria 1834
269 Ga0466982_0000036 3300044672 Bacteria 43109
270 Ga0466970_0000560 3300044765 Bacteria 18162
271 Ga0466957_0087490 3300044842 Bacteria 1948
272 Ga0495617_000083 3300046452 Bacteria 69141
273 Ga0495627_080778 3300046453 Bacteria 942
274 Ga0495590_0233279 3300046457 Bacteria 682
275 Ga0495638_0000340 3300046460 Bacteria 58967
276 Ga0495638_0023277 3300046460 Bacteria 4053
277 Ga0495650_0003395 3300046471 Bacteria 11655
278 Ga0495650_0005796 3300046471 Bacteria 7884
279 Ga0495584_0005272 3300046491 Bacteria 6848
280 Ga0495585_0028347 3300046492 Bacteria 3193
281 Ga0495607_0000247 3300046501 Bacteria 57993
282 Ga0495607_0006220 3300046501 Bacteria 8421
283 Ga0495607_0028180 3300046501 Bacteria 3467
284 Ga0495607_0103909 3300046501 Bacteria 1517
285 Ga0495583_0106959 3300046506 Bacteria 1188
286 Ga0495606_0001102 3300046507 Bacteria 38655
287 Ga0495606_0002571 3300046507 Bacteria 20791
288 Ga0495606_0003612 3300046507 Bacteria 16264
289 Ga0495606_0086338 3300046507 Bacteria 1939
290 Ga0495610_0011396 3300046512 Bacteria 5439
291 Ga0495616_0029914 3300046513 Bacteria 2868
292 Ga0495620_0000791 3300046515 Bacteria 19421
293 Ga0495620_0006935 3300046515 Bacteria 6189
294 Ga0495631_0000153 3300046518 Bacteria 47259
295 Ga0495631_0000603 3300046518 Bacteria 23596
296 Ga0495632_0068928 3300046519 Bacteria 1703
297 Ga0495632_0076831 3300046519 Bacteria 1597
298 Ga0495648_0061797 3300046524 Bacteria 2222
299 Ga0495609_0004838 3300046538 Bacteria 7262
300 Ga0495668_0003638 3300046616 Bacteria 11412
301 Ga0495668_0248412 3300046616 Bacteria 974
302 Ga0495611_0000029 3300046648 Bacteria 115887
303 Ga0495611_0000076 3300046648 Bacteria 69480
304 Ga0495625_0000260 3300046660 Bacteria 82175
305 Ga0495625_0231536 3300046660 Bacteria 1206
306 Ga0495625_0393935 3300046660 Bacteria 866
307 Ga0495625_0561749 3300046660 Bacteria 690
308 Ga0495670_0006569 3300046691 Bacteria 5717
309 Ga0495670_0126109 3300046691 Bacteria 1332
310 Ga0495671_0000545 3300046692 Bacteria 28273
311 Ga0495589_0000173 3300046794 Bacteria 58030
312 Ga0495660_0000235 3300046810 Bacteria 54297
313 Ga0495660_0000918 3300046810 Bacteria 21697
314 Ga0495672_0121812 3300047320 Bacteria 1385
315 Ga0495683_0000349 3300047323 Bacteria 38284
316 Ga0495679_000091 3300047446 Bacteria 82366
317 Ga0495673_0000175 3300047469 Bacteria 105273
318 Ga0495673_0000392 3300047469 Bacteria 51434
319 Ga0495673_0000548 3300047469 Bacteria 38312
320 Ga0495686_0001098 3300047472 Bacteria 32179
321 Ga0495686_0043821 3300047472 Bacteria 2835
322 Ga0495686_0101511 3300047472 Bacteria 1734
323 Ga0495686_0114560 3300047472 Bacteria 1613
324 Ga0496100_0003750 3300048903 Bacteria 7957
325 Ga0496101_0001114 3300048904 Bacteria 15992
326 Ga0496103_0056665 3300048906 Bacteria 2433
327 Ga0496106_0000238 3300048909 Bacteria 38599
328 Ga0496114_0095349 3300048917 Bacteria 2532
329 Ga0496115_0000063 3300048918 Bacteria 100073
330 Ga0496118_0008948 3300048921 Bacteria 10217
331 Ga0496118_0012510 3300048921 Bacteria 8136
332 Ga0496118_0300897 3300048921 Bacteria 881
333 Ga0496118_0343605 3300048921 Bacteria 798
334 Ga0496121_0000290 3300048924 Bacteria 104280
335 Ga0496121_0005560 3300048924 Bacteria 16099
336 Ga0496121_0008870 3300048924 Bacteria 11701
337 Ga0496121_0125081 3300048924 Bacteria 1934
338 Ga0496121_0359646 3300048924 Bacteria 967
339 Ga0496122_0015375 3300048925 Bacteria 7321
340 Ga0496122_0085884 3300048925 Bacteria 2168
341 Ga0496122_0396432 3300048925 Bacteria 702
342 Ga0496122_0545643 3300048925 Bacteria 553
343 Ga0496123_0009952 3300048926 Bacteria 8478
344 Ga0496123_0042350 3300048926 Bacteria 3143
345 Ga0496123_0044834 3300048926 Bacteria 3019
346 Ga0496124_0004391 3300048927 Bacteria 16476
347 Ga0496124_0005917 3300048927 Bacteria 13535
348 Ga0496124_0347059 3300048927 Bacteria 1051
349 Ga0496125_0117126 3300048928 Bacteria 1911
350 Ga0496126_0000057 3300048929 Bacteria 276781
351 Ga0496126_0086921 3300048929 Bacteria 2755
352 Ga0495678_000729 3300049459 Bacteria 29843
353 Ga0501031_0004292 3300049568 Bacteria 9220
354 Ga0501031_0345921 3300049568 Bacteria 962
355 Ga0501032_0011047 3300049569 Bacteria 6490
356 Ga0501032_0064228 3300049569 Bacteria 2457
357 Ga0501032_0846001 3300049569 Bacteria 577
358 Ga0501033_0001294 3300049570 Bacteria 22249
359 Ga0501033_0006898 3300049570 Bacteria 8868
360 Ga0501033_0507801 3300049570 Bacteria 833
361 Ga0501034_0003304 3300049571 Bacteria 18416
362 Ga0501034_0008643 3300049571 Bacteria 10741
363 Ga0501034_0207975 3300049571 Bacteria 1913
364 Ga0501034_0404274 3300049571 Bacteria 1288
365 Ga0501036_0020819 3300049572 Bacteria 5509
366 Ga0501036_0035489 3300049572 Bacteria 4219
367 Ga0501036_0166242 3300049572 Bacteria 1859
368 Ga0501037_0000336 3300049573 Bacteria 39761
369 Ga0501037_0007375 3300049573 Bacteria 8046
370 Ga0501037_0321863 3300049573 Bacteria 1070
371 Ga0501038_0001941 3300049574 Bacteria 19073
372 Ga0501038_0007466 3300049574 Bacteria 10087
373 Ga0501038_0153632 3300049574 Bacteria 1875
374 Ga0501038_0394474 3300049574 Bacteria 1071
375 Ga0501038_0734268 3300049574 Bacteria 737
376 Ga0501039_0004188 3300049575 Bacteria 10866
377 Ga0501039_0009876 3300049575 Bacteria 7278
378 Ga0501039_0360289 3300049575 Bacteria 1142
379 Ga0501042_0316584 3300049578 Bacteria 1127
380 Ga0501043_0003301 3300049579 Bacteria 13288
381 Ga0501043_0013035 3300049579 Bacteria 6498
382 Ga0501046_0000908 3300049580 Bacteria 28913
383 Ga0501046_0023460 3300049580 Bacteria 5076
384 Ga0501046_0033883 3300049580 Bacteria 4124
385 Ga0501046_0312685 3300049580 Bacteria 1145
386 Ga0501047_0002412 3300049581 Bacteria 17859
387 Ga0501047_0088990 3300049581 Bacteria 2964
388 Ga0501047_0461816 3300049581 Bacteria 1098
389 Ga0501047_0577479 3300049581 Bacteria 947
390 Ga0501048_0041714 3300049582 Bacteria 3286
391 Ga0501048_0607581 3300049582 Bacteria 785
392 Ga0501067_0089572 3300049583 Bacteria 1707
393 Ga0501067_0145427 3300049583 Bacteria 1321
394 Ga0501068_0013490 3300049584 Bacteria 4651
395 Ga0501068_0101222 3300049584 Bacteria 1786
396 Ga0501069_0040299 3300049585 Bacteria 2581
397 Ga0501070_0082075 3300049586 Bacteria 2667
398 Ga0501070_0239420 3300049586 Bacteria 1485
399 Ga0501070_0371464 3300049586 Bacteria 1159
400 Ga0501070_0654480 3300049586 Bacteria 834
401 Ga0501070_0997941 3300049586 Bacteria 649
402 Ga0501072_0345050 3300049588 Bacteria 1182
403 Ga0501073_0007580 3300049589 Bacteria 8064
404 Ga0501073_0007837 3300049589 Bacteria 7929
405 Ga0501073_0155884 3300049589 Bacteria 1582
406 Ga0501073_0352364 3300049589 Bacteria 1016
407 Ga0501073_0385508 3300049589 Bacteria 968
408 Ga0501073_0411457 3300049589 Bacteria 934
409 Ga0501074_0030118 3300049590 Bacteria 3933
410 Ga0501076_0363342 3300049592 Bacteria 1189
411 Ga0501076_0958400 3300049592 Bacteria 705
412 Ga0501077_0326191 3300049593 Bacteria 979
413 Ga0501079_0014162 3300049741 Bacteria 6078
414 Ga0501079_0016454 3300049741 Bacteria 5647
415 Ga0501080_0006470 3300049742 Bacteria 10522
416 Ga0501080_0017877 3300049742 Bacteria 6563
417 Ga0501080_0139131 3300049742 Bacteria 2245
418 Ga0501080_0569646 3300049742 Bacteria 1007
419 Ga0501080_0573574 3300049742 Bacteria 1003
420 Ga0501081_0320863 3300049743 Bacteria 1138
421 Ga0501083_0049062 3300049744 Bacteria 2848
422 Ga0501083_0321350 3300049744 Bacteria 1007
423 Ga0501035_0003512 3300049822 Bacteria 14985
424 Ga0501035_0034698 3300049822 Bacteria 4582
425 Ga0501035_0040452 3300049822 Bacteria 4212
426 Ga0501035_0055997 3300049822 Bacteria 3520
427 Ga0501035_0240638 3300049822 Bacteria 1539
428 Ga0501044_0025386 3300049823 Bacteria 6280
429 Ga0501044_0026321 3300049823 Bacteria 6159
430 Ga0501044_0029711 3300049823 Bacteria 5763
431 Ga0501044_0054905 3300049823 Bacteria 4092
432 Ga0501044_0591332 3300049823 Bacteria 1003
433 Ga0500643_000012 3300053087 Bacteria 369839
434 Ga0500555_000153 3300053103 Bacteria 32878
435 Ga0500568_0000874 3300053139 Bacteria 21141
436 Ga0501084_0304021 3300054114 Bacteria 1347
437 Ga0501084_0634630 3300054114 Bacteria 902
438 Ga0501084_0734150 3300054114 Bacteria 832
439 Ga0501082_0010708 3300060353 Bacteria 7894
440 Ga0501082_0936957 3300060353 Bacteria 757
441 2819565898 2818991440 Bacteria 4774720
442 2842922185 2842918807 Bacteria 4289178
443 2904466169 2904463128 Bacteria 4775606
444 2919408109 2919404418 Bacteria 4232372
445 2953997302 2953994433 Bacteria 4303959
446 Ga0068871_100193757
447 JGI25152J39213_1000146
448 JGI25150J39212_1000120
449 JGI25151J46595_10000107
450 JGI25153J46596_10000078
451 Ga0055536_1013234
452 Ga0055531_10019412
453 Ga0065165_1000108
454 Ga0070683_100489650
455 Ga0070690_100021925
456 Ga0070670_100089644
457 Ga0070670_100411065
458 Ga0068869_100043216
459 Ga0070666_10000636
460 Ga0070666_10010925
461 Ga0070666_10030857
462 Ga0070680_100055870
463 Ga0068868_100167113
464 Ga0070661_100031158
465 Ga0070661_100165445
466 Ga0070661_100209806
467 Ga0070668_100008957
468 Ga0070668_100295660
469 Ga0070671_100097651
470 Ga0070688_101136865
471 Ga0070667_100007761
472 Ga0070667_100009126
473 Ga0070667_100124980
474 Ga0070667_100169717
475 Ga0070667_100799493
476 Ga0070709_10073071
477 Ga0070663_100066203
478 Ga0070663_100069655
479 Ga0070663_100143304
480 Ga0070663_101215791
481 Ga0070662_100146859
482 Ga0070681_10049558
483 Ga0070681_10079916
484 Ga0068867_100144175
485 Ga0070685_10013931
486 Ga0070679_100032036
487 Ga0070679_100081455
488 Ga0070684_100437259
489 Ga0068853_100001939
490 Ga0068853_100007540
491 Ga0068853_100013549
492 Ga0068853_100014175
493 Ga0068853_100017218
494 Ga0068853_100305437
495 Ga0068853_100540176
496 Ga0068853_100891788
497 Ga0070696_100002124
498 Ga0070665_100000092
499 Ga0070665_100000807
500 Ga0070665_100059503
501 Ga0070665_101171483
502 Ga0070665_101668646
503 Ga0068855_100007741
504 Ga0068855_100013153
505 Ga0068855_100157367
506 Ga0068855_101327662
507 Ga0068857_100023484
508 Ga0068857_100030412
509 Ga0068857_100245902
510 Ga0068854_100242172
511 Ga0068854_101192540
512 Ga0068856_100016152
513 Ga0068856_100153649
514 Ga0068852_100812463
515 Ga0068864_100046469
516 Ga0068864_100397201
517 Ga0068851_10000643
518 Ga0068863_100000329
519 Ga0068863_100003282
520 Ga0068863_100063614
521 Ga0068863_100175017
522 Ga0068863_100230413
523 Ga0068863_100257111
524 Ga0068858_100002671
525 Ga0068858_100040752
526 Ga0068858_100115536
527 Ga0068858_100908159
528 Ga0068860_100005962
529 Ga0068860_100011701
530 Ga0068860_100025326
531 Ga0068860_100738197
532 Ga0068862_100007271
533 Ga0068862_100505488
534 Ga0068862_101033756
535 Ga0075364_10065436
536 Ga0075369_10442611
537 Ga0097621_100096973
538 Ga0097621_100104980
539 Ga0097621_100122246
540 Ga0097621_100291209
541 Ga0097621_101182731
542 Ga0068871_100491245
543 Ga0068865_100324000
544 Ga0097620_100001643
545 Ga0097620_100574048
546 Ga0105240_10000617
547 Ga0105240_10021268
548 Ga0105240_10595580
549 Ga0105245_10498165
550 Ga0105241_10022409
551 Ga0105241_10041687
552 Ga0105241_10269566
553 Ga0105242_10431355
554 Ga0105248_10233341
555 Ga0105237_10010967
556 Ga0105237_10383537
557 Ga0105237_10562569
558 Ga0105238_10001654
559 Ga0105238_10014095
560 Ga0105238_10262532
561 Ga0105238_10281603
562 Ga0105238_10308229
563 Ga0105249_10012883
564 Ga0105239_10008231
565 Ga0105239_10022128
566 Ga0105239_10024562
567 Ga0105239_10047732
568 Ga0105239_10050021
569 Ga0105239_10155520
570 Ga0105246_10021624
571 Ga0157373_10015585
572 Ga0157370_10000272
573 Ga0157370_10017678
574 Ga0157369_10004930
575 Ga0157369_10050765
576 Ga0157369_10060661
577 Ga0157369_10515425
578 Ga0157374_10015724
579 Ga0157374_10028502
580 Ga0157374_10377120
581 Ga0157374_10581260
582 Ga0157378_10281908
583 Ga0157372_10023028
584 Ga0157372_10137491
585 Ga0157372_10160372
586 Ga0157372_10249433
587 Ga0157375_10136397
588 Ga0157375_10867185
589 Ga0163163_10000589
590 Ga0163163_10029266
591 Ga0157379_10000908
592 Ga0157379_10102727
593 Ga0157379_10607340
594 Ga0157379_11285780
595 Ga0157376_10141880
596 Ga0157376_10666915
597 Ga0157376_11949911
598 Ga0182006_1000034
599 Ga0182007_10003139
600 Ga0182005_1000104
601 Ga0182005_1187672
602 Ga0163161_10011738
603 Ga0207425_1000028
604 Ga0209129_1000065
605 Ga0209130_1011999
606 Ga0209025_1000002
607 Ga0209758_1000003
608 Ga0209050_1023576
609 Ga0209256_1005457
610 Ga0209051_1081026
611 Ga0209257_1016124
612 Ga0207656_10015123
613 Ga0207656_10067239
614 Ga0207710_10009441
615 Ga0207680_10023288
616 Ga0207680_10056174
617 Ga0207680_10164433
618 Ga0207647_10000124
619 Ga0207647_10008548
620 Ga0207647_10032368
621 Ga0207699_10063173
622 Ga0207654_10000255
623 Ga0207654_10182826
624 Ga0207654_10418522
625 Ga0207707_10000572
626 Ga0207707_10114155
627 Ga0207695_10000032
628 Ga0207695_10064043
629 Ga0207671_10029087
630 Ga0207671_10508793
631 Ga0207671_11136725
632 Ga0207663_10075906
633 Ga0207660_10013041
634 Ga0207657_10002223
635 Ga0207649_10033212
636 Ga0207649_10272939
637 Ga0207649_10378575
638 Ga0207649_10409832
639 Ga0207652_10000209
640 Ga0207694_10002009
641 Ga0207694_10051151
642 Ga0207650_10019958
643 Ga0207650_10046759
644 Ga0207687_10195137
645 Ga0207644_10115386
646 Ga0207644_10628483
647 Ga0207644_10789085
648 Ga0207706_10788275
649 Ga0207704_10008276
650 Ga0207691_10070446
651 Ga0207711_10116386
652 Ga0207689_10063072
653 Ga0207689_10149448
654 Ga0207689_10617399
655 Ga0207661_10127563
656 Ga0207679_10051104
657 Ga0207667_10002516
658 Ga0207667_10013082
659 Ga0207667_10499340
660 Ga0207651_10071190
661 Ga0207712_10021091
662 Ga0207668_10188229
663 Ga0207668_10203884
664 Ga0207640_10180440
665 Ga0207658_10006517
666 Ga0207658_10035000
667 Ga0207658_10270468
668 Ga0207703_10001626
669 Ga0207703_10057270
670 Ga0207703_10271603
671 Ga0207639_10000465
672 Ga0207639_10000722
673 Ga0207639_10006308
674 Ga0207639_10019646
675 Ga0207639_10448626
676 Ga0207678_10003824
677 Ga0207678_10038784
678 Ga0207678_10089429
679 Ga0207678_10177338
680 Ga0207702_10075543
681 Ga0207702_10749428
682 Ga0207641_10004772
683 Ga0207641_10133806
684 Ga0207641_10237802
685 Ga0207648_10028187
686 Ga0207676_10005851
687 Ga0207676_10043844
688 Ga0207674_10001063
689 Ga0207674_10016664
690 Ga0207674_10081639
691 Ga0207674_10267850
692 Ga0207674_10535903
693 Ga0207698_10002152
694 Ga0268266_10000001
695 Ga0268266_10000013
696 Ga0268266_10025209
697 Ga0268266_10025689
698 Ga0268266_10145676
699 Ga0268266_11176198
700 Ga0268265_10011917
701 Ga0268265_10069110
702 Ga0268265_10475436
703 Ga0268264_10005817
704 Ga0268264_10025070
705 Ga0268264_10709382
706 Ga0436364_1523962
707 Ga0436363_1302782
708 Ga0451793_1427862
709 Ga0451793_1616407
710 Ga0451833_0390586
711 Ga0451837_1104326
712 Ga0451853_1966601
713 Ga0439449_0036278
714 Ga0466982_0000036
715 Ga0466970_0000560
716 Ga0466957_0087490
717 Ga0495617_000083
718 Ga0495627_080778
719 Ga0495590_0233279
720 Ga0495638_0000340
721 Ga0495638_0023277
722 Ga0495650_0003395
723 Ga0495650_0005796
724 Ga0495584_0005272
725 Ga0495585_0028347
726 Ga0495607_0000247
727 Ga0495607_0006220
728 Ga0495607_0028180
729 Ga0495607_0103909
730 Ga0495583_0106959
731 Ga0495606_0001102
732 Ga0495606_0002571
733 Ga0495606_0003612
734 Ga0495606_0086338
735 Ga0495610_0011396
736 Ga0495616_0029914
737 Ga0495620_0000791
738 Ga0495620_0006935
739 Ga0495631_0000153
740 Ga0495631_0000603
741 Ga0495632_0068928
742 Ga0495632_0076831
743 Ga0495648_0061797
744 Ga0495609_0004838
745 Ga0495668_0003638
746 Ga0495668_0248412
747 Ga0495611_0000029
748 Ga0495611_0000076
749 Ga0495625_0000260
750 Ga0495625_0231536
751 Ga0495625_0393935
752 Ga0495625_0561749
753 Ga0495670_0006569
754 Ga0495670_0126109
755 Ga0495671_0000545
756 Ga0495589_0000173
757 Ga0495660_0000235
758 Ga0495660_0000918
759 Ga0495672_0121812
760 Ga0495683_0000349
761 Ga0495679_000091
762 Ga0495673_0000175
763 Ga0495673_0000392
764 Ga0495673_0000548
765 Ga0495686_0001098
766 Ga0495686_0043821
767 Ga0495686_0101511
768 Ga0495686_0114560
769 Ga0496100_0003750
770 Ga0496101_0001114
771 Ga0496103_0056665
772 Ga0496106_0000238
773 Ga0496114_0095349
774 Ga0496115_0000063
775 Ga0496118_0008948
776 Ga0496118_0012510
777 Ga0496118_0300897
778 Ga0496118_0343605
779 Ga0496121_0000290
780 Ga0496121_0005560
781 Ga0496121_0008870
782 Ga0496121_0125081
783 Ga0496121_0359646
784 Ga0496122_0015375
785 Ga0496122_0085884
786 Ga0496122_0396432
787 Ga0496122_0545643
788 Ga0496123_0009952
789 Ga0496123_0042350
790 Ga0496123_0044834
791 Ga0496124_0004391
792 Ga0496124_0005917
793 Ga0496124_0347059
794 Ga0496125_0117126
795 Ga0496126_0000057
796 Ga0496126_0086921
797 Ga0495678_000729
798 Ga0501031_0004292
799 Ga0501031_0345921
800 Ga0501032_0011047
801 Ga0501032_0064228
802 Ga0501032_0846001
803 Ga0501033_0001294
804 Ga0501033_0006898
805 Ga0501033_0507801
806 Ga0501034_0003304
807 Ga0501034_0008643
808 Ga0501034_0207975
809 Ga0501034_0404274
810 Ga0501036_0020819
811 Ga0501036_0035489
812 Ga0501036_0166242
813 Ga0501037_0000336
814 Ga0501037_0007375
815 Ga0501037_0321863
816 Ga0501038_0001941
817 Ga0501038_0007466
818 Ga0501038_0153632
819 Ga0501038_0394474
820 Ga0501038_0734268
821 Ga0501039_0004188
822 Ga0501039_0009876
823 Ga0501039_0360289
824 Ga0501042_0316584
825 Ga0501043_0003301
826 Ga0501043_0013035
827 Ga0501046_0000908
828 Ga0501046_0023460
829 Ga0501046_0033883
830 Ga0501046_0312685
831 Ga0501047_0002412
832 Ga0501047_0088990
833 Ga0501047_0461816
834 Ga0501047_0577479
835 Ga0501048_0041714
836 Ga0501048_0607581
837 Ga0501067_0089572
838 Ga0501067_0145427
839 Ga0501068_0013490
840 Ga0501068_0101222
841 Ga0501069_0040299
842 Ga0501070_0082075
843 Ga0501070_0239420
844 Ga0501070_0371464
845 Ga0501070_0654480
846 Ga0501070_0997941
847 Ga0501072_0345050
848 Ga0501073_0007580
849 Ga0501073_0007837
850 Ga0501073_0155884
851 Ga0501073_0352364
852 Ga0501073_0385508
853 Ga0501073_0411457
854 Ga0501074_0030118
855 Ga0501076_0363342
856 Ga0501076_0958400
857 Ga0501077_0326191
858 Ga0501079_0014162
859 Ga0501079_0016454
860 Ga0501080_0006470
861 Ga0501080_0017877
862 Ga0501080_0139131
863 Ga0501080_0569646
864 Ga0501080_0573574
865 Ga0501081_0320863
866 Ga0501083_0049062
867 Ga0501083_0321350
868 Ga0501035_0003512
869 Ga0501035_0034698
870 Ga0501035_0040452
871 Ga0501035_0055997
872 Ga0501035_0240638
873 Ga0501044_0025386
874 Ga0501044_0026321
875 Ga0501044_0029711
876 Ga0501044_0054905
877 Ga0501044_0591332
878 Ga0500643_000012
879 Ga0500555_000153
880 Ga0500568_0000874
881 Ga0501084_0304021
882 Ga0501084_0634630
883 Ga0501084_0734150
884 Ga0501082_0010708
885 Ga0501082_0936957
886 2819565898
887 2842922185
888 2904466169
889 2919408109
890 2953997302

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fex-assembly2.cif.gz_C-2 the crystal structure of dj-1 superfamily protein atu0886 from agrobacterium tumefaciens 0.4907 46 88
6zyv-assembly2.cif.gz_B structure of a plasmodium pir protein ectodomain 0.329 68 155
4xcp-assembly1.cif.gz_A fatty acid and retinol binding protein na-far-1 from necator americanus 0.3113 71 153
4uet-assembly1.cif.gz_A diversity in the structures and ligand binding sites among the fatty acid and retinol binding proteins of nematodes revealed by na-far-1 from necator americanus 0.3075 71 154
3f5d-assembly1.cif.gz_A crystal structure of a protein of unknown function from bacillus subtilis 0.2927 25 85
ID Description Score Start End Superfamily
af_Q9VRJ6_99_221_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.4869 91 156 1.10.510.10
af_Q9P7N1_116_235_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.4761 91 156 1.10.510.10
af_Q9H040_45_153_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.4636 25 79 3.30.2010.10
af_Q8IG67_219_343_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.4326 67 156 1.10.10.10
af_Q2FXE0_43_154_1.10.10.2910 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.414 18 106 1.10.10.2910
ID Description Score Start End GO Terms
AF-A0A2W6VXR7-F1-model_v4 Uncharacterized protein 1.003 13 158
AF-A0A4Q7RYP2-F1-model_v4 deleted 0.9995 1 156
AF-A0A0K0GIC6-F1-model_v4 IrrE N-terminal-like domain-containing protein 0.9982 14 157
AF-A0A1H3JZW0-F1-model_v4 IrrE N-terminal-like domain-containing protein 0.9962 11 156
AF-A0A1H7JW06-F1-model_v4 IrrE N-terminal-like domain-containing protein 0.9958 11 158

Map