F445479

General Info

Members Datasets Scaffolds Average Seq Length
445 289 890 195

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_100322044|Ga0075435_1003220443
Length 208
Sequence MVAQKEQQTAEKASSEAGGPRPIPRLQQLYRETVMPSVIKEFALKNVHQAPRLVKVVVNAGVGKFLENQKLKPEIRDTVISTLSIISGQKPIIIMARKSVANFKVREGAPSSFMVTMRADRMWHFLDRLMNLAIPRIKDFRGVKDDSFDAMGNYSMGLSEQAVWPEINMANVNFLHGMHINIVFENSNPKMSRFVLQEMGMPFVRPEA

Samples

Sample ID Description Type Environment
1 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
102 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
103 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
104 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
105 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
106 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
107 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
108 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
109 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
112 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
113 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
114 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
115 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
116 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
117 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
118 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
119 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
120 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
121 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
122 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
123 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
124 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
125 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
126 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
127 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
130 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
143 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
144 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
145 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
146 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
147 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
148 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
149 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
150 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
151 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
152 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
190 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
191 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
192 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
193 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
194 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
195 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
196 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
197 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
198 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
199 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
200 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
201 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
202 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
203 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
205 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059603 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 62R_AD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
233 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
234 2643221546 Microbacterium sp. Root53 Isolate Unclassified
235 2643221553 Microbacterium sp. Root553 Isolate Unclassified
236 2643221566 Microbacterium sp. Root166 Isolate Unclassified
237 2643221572 Leifsonia sp. Root60 Isolate Unclassified
238 2643221575 Microbacterium sp. Root61 Isolate Unclassified
239 2643221597 Microbacterium sp. Root180 Isolate Unclassified
240 2643221630 Microbacterium sp. Root322 Isolate Unclassified
241 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
242 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
243 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
244 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
245 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
246 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
247 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
248 2773857759 Microbacterium sp. 1294 Isolate Unclassified
249 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
250 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
251 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
252 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
253 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
254 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
255 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
256 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
257 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
258 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
259 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
260 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
261 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
262 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
263 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
264 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
265 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
266 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
267 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
268 2919069694 Microbacterium sp. 1154 Isolate Unclassified
269 2919395869 Microbacterium resistens 2980 Isolate Unclassified
270 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
271 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
272 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
273 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
274 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
275 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
276 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
277 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
278 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
279 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
280 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
281 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
282 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
283 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
284 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
285 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
286 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
287 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
288 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
289 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.28
Metatranscriptomes 11.69
Isolates 13.03

Biome Distribution

Category Percentage (%)
Aerial Root 0.45
Bulb 0
Endosphere 9.66
Nodule 0
Rhizoplane 6.07
Rhizosphere 60.22
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075435_100322044 3300007076 Bacteria 1323
2 JGI24740J21852_10000460 3300001979 Bacteria 17440
3 JGI25154J39366_1001910 3300002738 Bacteria 6286
4 Ga0007427J51700_102557 3300003559 Bacteria 6979
5 Ga0006562J51391_1104523 3300003578 Bacteria 2975
6 Ga0006562J51391_1104526 3300003578 Bacteria 660
7 Ga0006780_1007001 3300003735 Bacteria 4772
8 Ga0065714_10067377 3300005288 Bacteria 5585
9 Ga0070658_10009122 3300005327 Bacteria 7974
10 Ga0070658_10080026 3300005327 Bacteria 2683
11 Ga0070677_10150767 3300005333 Bacteria 1082
12 Ga0070660_100036773 3300005339 Bacteria 3710
13 Ga0070660_100468720 3300005339 Bacteria 1046
14 Ga0070661_100018488 3300005344 Bacteria 4954
15 Ga0070668_100754380 3300005347 Bacteria 862
16 Ga0070671_100023253 3300005355 Bacteria 5071
17 Ga0070688_100546599 3300005365 Bacteria 880
18 Ga0070667_100085309 3300005367 Bacteria 2708
19 Ga0070709_10007508 3300005434 Bacteria 5982
20 Ga0070714_100171888 3300005435 Bacteria 1967
21 Ga0070710_10031075 3300005437 Bacteria 2879
22 Ga0070663_100680531 3300005455 Bacteria 873
23 Ga0070678_100463977 3300005456 Bacteria 1112
24 Ga0070679_100474979 3300005530 Bacteria 1195
25 Ga0068853_100010611 3300005539 Bacteria 7452
26 Ga0068853_100293807 3300005539 Bacteria 1500
27 Ga0068853_100793392 3300005539 Bacteria 907
28 Ga0070704_101139420 3300005549 Bacteria 710
29 Ga0068855_100128220 3300005563 Bacteria 2899
30 Ga0068855_100338933 3300005563 Bacteria 1658
31 Ga0068857_100852529 3300005577 Bacteria 872
32 Ga0068854_100212182 3300005578 Bacteria 1528
33 Ga0068856_100414380 3300005614 Bacteria 1367
34 Ga0068856_100482645 3300005614 Bacteria 1260
35 Ga0068856_100587047 3300005614 Bacteria 1135
36 Ga0068851_10000022 3300005834 Bacteria 129607
37 Ga0068858_100001116 3300005842 Bacteria 27809
38 Ga0081538_10140558 3300005981 Bacteria 1114
39 Ga0075365_10015615 3300006038 Bacteria 4597
40 Ga0075365_10029877 3300006038 Bacteria 3486
41 Ga0075365_10186113 3300006038 Bacteria 1452
42 Ga0075368_10016248 3300006042 Bacteria 2774
43 Ga0075363_100050849 3300006048 Bacteria 2208
44 Ga0075363_100094473 3300006048 Bacteria 1649
45 Ga0075363_100205748 3300006048 Bacteria 1125
46 Ga0075364_10021121 3300006051 Bacteria 4100
47 Ga0075364_10027461 3300006051 Bacteria 3636
48 Ga0075364_10077143 3300006051 Bacteria 2199
49 Ga0075364_10111899 3300006051 Bacteria 1823
50 Ga0075364_10172148 3300006051 Bacteria 1464
51 Ga0075367_10009009 3300006178 Bacteria 5197
52 Ga0075369_10037457 3300006186 Bacteria 2066
53 Ga0075369_10156965 3300006186 Bacteria 1042
54 Ga0075370_10015347 3300006353 Bacteria 4099
55 Ga0075370_10077989 3300006353 Bacteria 1901
56 Ga0075370_10246323 3300006353 Bacteria 1059
57 Ga0075428_100471418 3300006844 Bacteria 1344
58 Ga0075428_100663323 3300006844 Bacteria 1112
59 Ga0105244_10004765 3300009036 Bacteria 9234
60 Ga0105244_10036504 3300009036 Bacteria 2574
61 Ga0105240_10070946 3300009093 Bacteria 4308
62 Ga0105240_10420138 3300009093 Bacteria 1502
63 Ga0111539_10306176 3300009094 Bacteria 1849
64 Ga0105245_10118013 3300009098 Bacteria 2475
65 Ga0105245_10438128 3300009098 Bacteria 1313
66 Ga0105243_10044746 3300009148 Bacteria 3475
67 Ga0105241_10734061 3300009174 Bacteria 904
68 Ga0105242_11419043 3300009176 Bacteria 722
69 Ga0105237_10031122 3300009545 Bacteria 5412
70 Ga0105237_10111613 3300009545 Bacteria 2726
71 Ga0105238_10045909 3300009551 Bacteria 4412
72 Ga0105239_10490888 3300010375 Bacteria 1396
73 Ga0105246_10170900 3300011119 Bacteria 1665
74 Ga0157371_10016523 3300013102 Bacteria 5505
75 Ga0157371_10024138 3300013102 Bacteria 4442
76 Ga0157370_10063693 3300013104 Bacteria 3492
77 Ga0157370_10135809 3300013104 Bacteria 2292
78 Ga0157369_10002930 3300013105 Bacteria 20411
79 Ga0157369_10084273 3300013105 Bacteria 3398
80 Ga0171462_1001 3300013250 Bacteria 1135406
81 Ga0163162_10211924 3300013306 Bacteria 2067
82 Ga0163162_10392412 3300013306 Bacteria 1520
83 Ga0163162_10730607 3300013306 Bacteria 1110
84 Ga0157372_10221913 3300013307 Bacteria 2191
85 Ga0157372_10227095 3300013307 Bacteria 2164
86 Ga0157375_10358632 3300013308 Bacteria 1624
87 Ga0157375_11118519 3300013308 Bacteria 922
88 Ga0163163_10076682 3300014325 Bacteria 3338
89 Ga0157380_10034018 3300014326 Bacteria 3929
90 Ga0157379_10092307 3300014968 Bacteria 2716
91 Ga0157376_10240121 3300014969 Bacteria 1688
92 Ga0163161_10058703 3300017792 Bacteria 2796
93 Ga0197907_11050670 3300020069 Bacteria 652
94 Ga0197907_11084650 3300020069 Bacteria 1570
95 Ga0209646_1000013 3300025246 Bacteria 565830
96 Ga0209646_1000014 3300025246 Bacteria 550484
97 Ga0207656_10000005 3300025321 Bacteria 490514
98 Ga0207655_1000386 3300025728 Bacteria 61740
99 Ga0207655_1107406 3300025728 Bacteria 949
100 Ga0207647_10033365 3300025904 Bacteria 3296
101 Ga0207647_10090900 3300025904 Bacteria 1820
102 Ga0207705_10000001 3300025909 Bacteria 2061880
103 Ga0207705_10035339 3300025909 Bacteria 3575
104 Ga0207705_10036550 3300025909 Bacteria 3514
105 Ga0207705_10207372 3300025909 Bacteria 1486
106 Ga0207654_10000001 3300025911 Bacteria 1816198
107 Ga0207695_10082467 3300025913 Bacteria 3251
108 Ga0207695_10418749 3300025913 Bacteria 1224
109 Ga0207671_10000016 3300025914 Bacteria 435413
110 Ga0207657_10005997 3300025919 Bacteria 12644
111 Ga0207657_10036712 3300025919 Bacteria 4384
112 Ga0207657_10399851 3300025919 Bacteria 1080
113 Ga0207649_10024394 3300025920 Bacteria 3514
114 Ga0207694_10000057 3300025924 Bacteria 146441
115 Ga0207687_10416254 3300025927 Bacteria 1108
116 Ga0207664_10169827 3300025929 Bacteria 1866
117 Ga0207644_10123828 3300025931 Bacteria 1971
118 Ga0207690_10003803 3300025932 Bacteria 8937
119 Ga0207709_10068641 3300025935 Bacteria 2241
120 Ga0207709_10254066 3300025935 Bacteria 1285
121 Ga0207669_10156012 3300025937 Bacteria 1606
122 Ga0207667_10035600 3300025949 Bacteria 5340
123 Ga0207667_10083110 3300025949 Bacteria 3316
124 Ga0207667_10282768 3300025949 Bacteria 1695
125 Ga0207668_10206525 3300025972 Bacteria 1568
126 Ga0207640_10037144 3300025981 Bacteria 3063
127 Ga0207658_10014981 3300025986 Bacteria 5316
128 Ga0207639_10071529 3300026041 Bacteria 2713
129 Ga0207639_10135861 3300026041 Bacteria 2042
130 Ga0207639_10524333 3300026041 Bacteria 1085
131 Ga0207678_10101275 3300026067 Bacteria 2460
132 Ga0207678_10320669 3300026067 Bacteria 1333
133 Ga0207678_10466078 3300026067 Bacteria 1099
134 Ga0207708_10303410 3300026075 Bacteria 1299
135 Ga0207702_10100567 3300026078 Bacteria 2551
136 Ga0207702_10848092 3300026078 Bacteria 904
137 Ga0207683_10062314 3300026121 Bacteria 3284
138 Ga0207698_10019872 3300026142 Bacteria 4610
139 Ga0307515_10291079 3300028794 Bacteria 1329
140 Ga0307408_100193935 3300031548 Bacteria 1639
141 Ga0307413_10083111 3300031824 Bacteria 2059
142 Ga0307413_10244917 3300031824 Bacteria 1326
143 Ga0307410_10200263 3300031852 Bacteria 1524
144 Ga0307406_10000938 3300031901 Bacteria 16294
145 Ga0307406_10032617 3300031901 Bacteria 3182
146 Ga0307406_10094564 3300031901 Bacteria 2020
147 Ga0307412_10231849 3300031911 Bacteria 1422
148 Ga0307409_101251406 3300031995 Bacteria 766
149 Ga0307414_10101924 3300032004 Bacteria 2162
150 Ga0316584_0299687 3300036712 Bacteria 1164
151 Ga0395900_1316066 3300037418 Bacteria 636
152 Ga0395901_0085307 3300038443 Bacteria 3301
153 Ga0451789_1294910 3300041443 Bacteria 943
154 Ga0451795_0674751 3300041456 Bacteria 1054
155 Ga0451804_0498327 3300041463 Bacteria 776
156 Ga0451833_0383288 3300041491 Bacteria 704
157 Ga0451841_1105200 3300041498 Bacteria 981
158 Ga0451843_1544020 3300041509 Bacteria 767
159 Ga0451853_2207870 3300041512 Bacteria 890
160 Ga0439431_0146776 3300041997 Bacteria 669
161 Ga0466965_0005434 3300044683 Bacteria 5740
162 Ga0466965_0045670 3300044683 Bacteria 2167
163 Ga0466966_0511554 3300044684 Bacteria 722
164 Ga0466961_0101351 3300044693 Bacteria 1814
165 Ga0466971_0048616 3300044719 Bacteria 1907
166 Ga0466968_0014966 3300044735 Bacteria 3071
167 Ga0466970_0000027 3300044765 Bacteria 56103
168 Ga0466970_0035231 3300044765 Bacteria 2652
169 Ga0466970_0040814 3300044765 Bacteria 2464
170 Ga0466960_0008733 3300044901 Bacteria 4158
171 Ga0466960_0056630 3300044901 Bacteria 1909
172 Ga0466960_0267565 3300044901 Bacteria 954
173 Ga0495627_001687 3300046453 Bacteria 12164
174 Ga0495603_0245202 3300046455 Bacteria 1032
175 Ga0495590_0000902 3300046457 Bacteria 13285
176 Ga0495650_0060302 3300046471 Bacteria 1524
177 Ga0495650_0070523 3300046471 Bacteria 1372
178 Ga0495620_0029591 3300046515 Bacteria 2532
179 Ga0495620_0194160 3300046515 Bacteria 782
180 Ga0495654_0116540 3300046530 Bacteria 1213
181 Ga0495633_0146107 3300046558 Bacteria 1093
182 Ga0495656_0148392 3300046615 Bacteria 1130
183 Ga0495625_0157617 3300046660 Bacteria 1523
184 Ga0495671_0046748 3300046692 Bacteria 2164
185 Ga0495672_0030252 3300047320 Bacteria 3400
186 Ga0495672_0031256 3300047320 Bacteria 3326
187 Ga0495615_0104415 3300048090 Bacteria 804
188 Ga0496101_0002898 3300048904 Bacteria 10559
189 Ga0496101_0187846 3300048904 Bacteria 1594
190 Ga0496102_0196778 3300048905 Bacteria 1900
191 Ga0496103_0005136 3300048906 Bacteria 7881
192 Ga0496104_0044706 3300048907 Bacteria 4161
193 Ga0496104_0757270 3300048907 Bacteria 878
194 Ga0496105_0009192 3300048908 Bacteria 7715
195 Ga0496105_0185075 3300048908 Bacteria 1704
196 Ga0496105_0191704 3300048908 Bacteria 1671
197 Ga0496107_0001328 3300048910 Bacteria 15168
198 Ga0496108_0141305 3300048911 Bacteria 2074
199 Ga0496109_0016841 3300048912 Bacteria 6396
200 Ga0496109_0071948 3300048912 Bacteria 3175
201 Ga0496110_0036804 3300048913 Bacteria 4251
202 Ga0496111_0039015 3300048914 Bacteria 3403
203 Ga0496112_0020079 3300048915 Bacteria 6325
204 Ga0496112_0271824 3300048915 Bacteria 1643
205 Ga0496113_0005620 3300048916 Bacteria 7845
206 Ga0496113_0563403 3300048916 Bacteria 913
207 Ga0496114_0066335 3300048917 Bacteria 3025
208 Ga0496114_0088508 3300048917 Bacteria 2626
209 Ga0496114_0140938 3300048917 Bacteria 2087
210 Ga0496114_0979233 3300048917 Bacteria 728
211 Ga0496115_0002702 3300048918 Bacteria 12733
212 Ga0496117_0000362 3300048920 Bacteria 79224
213 Ga0496117_0003610 3300048920 Bacteria 17825
214 Ga0496117_0004032 3300048920 Bacteria 16539
215 Ga0496117_0006530 3300048920 Bacteria 11750
216 Ga0496117_0009885 3300048920 Bacteria 8783
217 Ga0496117_0028132 3300048920 Bacteria 4358
218 Ga0496117_0031402 3300048920 Bacteria 4055
219 Ga0496117_0070709 3300048920 Bacteria 2342
220 Ga0496117_0115251 3300048920 Bacteria 1664
221 Ga0496117_0137662 3300048920 Bacteria 1468
222 Ga0496118_0002856 3300048921 Bacteria 22535
223 Ga0496118_0006345 3300048921 Bacteria 13050
224 Ga0496118_0008749 3300048921 Bacteria 10383
225 Ga0496118_0040002 3300048921 Bacteria 3733
226 Ga0496118_0056469 3300048921 Bacteria 2951
227 Ga0496118_0068984 3300048921 Bacteria 2564
228 Ga0496119_0000720 3300048922 Bacteria 44520
229 Ga0496119_0003034 3300048922 Bacteria 17774
230 Ga0496119_0023416 3300048922 Bacteria 4380
231 Ga0496119_0025618 3300048922 Bacteria 4113
232 Ga0496119_0054042 3300048922 Bacteria 2448
233 Ga0496119_0307111 3300048922 Bacteria 780
234 Ga0496120_0015932 3300048923 Bacteria 4934
235 Ga0496120_0037279 3300048923 Bacteria 2886
236 Ga0496120_0052780 3300048923 Bacteria 2313
237 Ga0496120_0081010 3300048923 Bacteria 1757
238 Ga0496120_0099767 3300048923 Bacteria 1536
239 Ga0496120_0129031 3300048923 Bacteria 1297
240 Ga0496121_0000497 3300048924 Bacteria 75061
241 Ga0496121_0210207 3300048924 Bacteria 1379
242 Ga0496122_0000022 3300048925 Bacteria 388704
243 Ga0496122_0000799 3300048925 Bacteria 60347
244 Ga0496122_0003594 3300048925 Bacteria 20199
245 Ga0496122_0010341 3300048925 Bacteria 9645
246 Ga0496122_0090523 3300048925 Bacteria 2087
247 Ga0496122_0180178 3300048925 Bacteria 1261
248 Ga0496123_0000009 3300048926 Bacteria 509486
249 Ga0496123_0000016 3300048926 Bacteria 424330
250 Ga0496123_0004251 3300048926 Bacteria 15248
251 Ga0496123_0182613 3300048926 Bacteria 1094
252 Ga0496124_0002766 3300048927 Bacteria 22302
253 Ga0496124_0006965 3300048927 Bacteria 12143
254 Ga0496124_0029307 3300048927 Bacteria 4907
255 Ga0496124_0036040 3300048927 Bacteria 4320
256 Ga0496124_0085327 3300048927 Bacteria 2588
257 Ga0496124_0213967 3300048927 Bacteria 1456
258 Ga0496124_0327918 3300048927 Bacteria 1093
259 Ga0496125_0002082 3300048928 Bacteria 26957
260 Ga0496125_0002578 3300048928 Bacteria 23316
261 Ga0496125_0005769 3300048928 Bacteria 13604
262 Ga0496125_0029529 3300048928 Bacteria 4925
263 Ga0496125_0043499 3300048928 Bacteria 3810
264 Ga0496125_0073122 3300048928 Bacteria 2667
265 Ga0496126_0002077 3300048929 Bacteria 28059
266 Ga0496126_0002563 3300048929 Bacteria 24311
267 Ga0496126_0015145 3300048929 Bacteria 7768
268 Ga0496126_0052186 3300048929 Bacteria 3717
269 Ga0496126_0103173 3300048929 Bacteria 2492
270 Ga0496126_0108175 3300048929 Bacteria 2424
271 Ga0496126_0697241 3300048929 Bacteria 789
272 Ga0501306_009073 3300049127 Bacteria 1226
273 Ga0501308_030330 3300049128 Bacteria 722
274 Ga0501309_014803 3300049129 Bacteria 1050
275 Ga0501310_009305 3300049130 Bacteria 1081
276 Ga0501304_004362 3300049160 Bacteria 1073
277 Ga0501305_007464 3300049161 Bacteria 1390
278 Ga0501307_002229 3300049162 Bacteria 1778
279 Ga0501307_005288 3300049162 Bacteria 1356
280 Ga0501312_014195 3300049528 Bacteria 1117
281 Ga0501317_001118 3300049533 Bacteria 2219
282 Ga0501318_003086 3300049534 Bacteria 1501
283 Ga0501319_000191 3300049535 Bacteria 2497
284 Ga0501320_004361 3300049536 Bacteria 1246
285 Ga0501322_002862 3300049538 Bacteria 1085
286 Ga0501323_002830 3300049539 Bacteria 1721
287 Ga0501323_011339 3300049539 Bacteria 1075
288 Ga0501325_000709 3300049541 Bacteria 1746
289 Ga0501338_00589 3300049554 Bacteria 1698
290 Ga0501031_0025920 3300049568 Bacteria 3824
291 Ga0501032_0001225 3300049569 Bacteria 20568
292 Ga0501032_0205594 3300049569 Bacteria 1284
293 Ga0501032_0256550 3300049569 Bacteria 1134
294 Ga0501034_0002490 3300049571 Bacteria 22119
295 Ga0501034_0012335 3300049571 Bacteria 8829
296 Ga0501034_0023372 3300049571 Bacteria 6298
297 Ga0501034_0032413 3300049571 Bacteria 5306
298 Ga0501034_0037011 3300049571 Bacteria 4941
299 Ga0501034_0040057 3300049571 Bacteria 4744
300 Ga0501034_0055806 3300049571 Bacteria 3975
301 Ga0501036_0106410 3300049572 Bacteria 2372
302 Ga0501037_0357545 3300049573 Bacteria 1006
303 Ga0501038_0000144 3300049574 Bacteria 61149
304 Ga0501038_0020229 3300049574 Bacteria 5988
305 Ga0501038_0370516 3300049574 Bacteria 1112
306 Ga0501039_0069542 3300049575 Bacteria 2734
307 Ga0501043_0037575 3300049579 Bacteria 3808
308 Ga0501043_0087089 3300049579 Bacteria 2454
309 Ga0501043_0254659 3300049579 Bacteria 1351
310 Ga0501046_0092613 3300049580 Bacteria 2323
311 Ga0501047_0011785 3300049581 Bacteria 8268
312 Ga0501047_0028559 3300049581 Bacteria 5380
313 Ga0501067_0042653 3300049583 Bacteria 2519
314 Ga0501067_0567317 3300049583 Bacteria 636
315 Ga0501069_0203378 3300049585 Bacteria 1148
316 Ga0501070_0000874 3300049586 Bacteria 27417
317 Ga0501070_0040019 3300049586 Bacteria 3910
318 Ga0501070_0054412 3300049586 Bacteria 3319
319 Ga0501070_0068175 3300049586 Bacteria 2945
320 Ga0501072_0062259 3300049588 Bacteria 2943
321 Ga0501073_0000030 3300049589 Bacteria 115949
322 Ga0501073_0069543 3300049589 Bacteria 2453
323 Ga0501073_0397237 3300049589 Bacteria 952
324 Ga0501074_0294104 3300049590 Bacteria 1154
325 Ga0501079_0304883 3300049741 Bacteria 1246
326 Ga0501080_0000208 3300049742 Bacteria 43436
327 Ga0501083_0000921 3300049744 Bacteria 19506
328 Ga0501035_0004487 3300049822 Bacteria 13250
329 Ga0501035_0215772 3300049822 Bacteria 1640
330 Ga0501044_0001222 3300049823 Bacteria 30539
331 Ga0501044_0024266 3300049823 Bacteria 6441
332 nmdc:mga03n38_279311_c1 3300050490 Bacteria 891
333 nmdc:mga03n38_33332_c1 3300050490 Bacteria 2190
334 nmdc:mga00v17_105512_c1 3300050491 Bacteria 1783
335 nmdc:mga00v17_34172_c1 3300050491 Bacteria 3018
336 nmdc:mga00v17_8123_c1 3300050491 Bacteria 5634
337 nmdc:mga00v17_99131_c1 3300050491 Bacteria 1838
338 nmdc:mga0yw44_277_c1 3300050492 Bacteria 17596
339 nmdc:mga0yw44_436589_c1 3300050492 Bacteria 887
340 nmdc:mga0yw44_5399_c1 3300050492 Bacteria 6031
341 nmdc:mga06z11_11796_c1 3300050494 Bacteria 3780
342 nmdc:mga07m45_203437_c1 3300050496 Bacteria 1152
343 nmdc:mga07m45_24923_c1 3300050496 Bacteria 3279
344 nmdc:mga0sz30_6222_c2 3300050516 Bacteria 3757
345 Ga0500562_001347 3300053108 Bacteria 6058
346 Ga0500592_049954 3300053116 Bacteria 679
347 Ga0500593_052144 3300053117 Bacteria 1813
348 Ga0500568_0018835 3300053139 Bacteria 3011
349 Ga0500568_0125044 3300053139 Bacteria 957
350 Ga0500590_058221 3300053148 Bacteria 1947
351 Ga0500616_0000027 3300053153 Bacteria 441053
352 Ga0500616_0000117 3300053153 Bacteria 145655
353 Ga0500616_0002723 3300053153 Bacteria 14334
354 Ga0500620_000519 3300053155 Bacteria 6752
355 Ga0500645_080478 3300053730 Bacteria 930
356 Ga0500587_024472 3300053739 Bacteria 802
357 Ga0501084_0082056 3300054114 Bacteria 2705
358 Ga0501084_0776060 3300054114 Bacteria 807
359 Ga0587084_000004 3300059477 Bacteria 10690
360 Ga0587070_000783 3300059491 Bacteria 2928
361 Ga0587070_056946 3300059491 Bacteria 797
362 Ga0587073_0035398 3300059492 Bacteria 1058
363 Ga0587073_0104386 3300059492 Bacteria 741
364 Ga0587077_001116 3300059493 Bacteria 2744
365 Ga0587083_0014219 3300059505 Bacteria 1368
366 Ga0587085_001114 3300059506 Bacteria 2368
367 Ga0587086_000329 3300059507 Bacteria 3204
368 Ga0587088_020892 3300059508 Bacteria 1090
369 Ga0587090_001053 3300059510 Bacteria 2661
370 Ga0587091_000453 3300059511 Bacteria 3511
371 Ga0587092_000723 3300059512 Bacteria 2857
372 Ga0587094_000376 3300059513 Bacteria 3298
373 Ga0587095_000117 3300059514 Bacteria 3212
374 Ga0587097_01194 3300059603 Bacteria 901
375 Ga0587098_000885 3300059604 Bacteria 2088
376 Ga0587125_000594 3300059607 Bacteria 2220
377 Ga0587101_000011 3300059623 Bacteria 8540
378 Ga0587115_000267 3300059626 Bacteria 3477
379 Ga0587130_008048 3300059631 Bacteria 992
380 Ga0587069_006866 3300059642 Bacteria 1385
381 Ga0587100_000081 3300059648 Bacteria 3481
382 Ga0587105_003189 3300059651 Bacteria 982
383 Ga0587107_052222 3300059652 Bacteria 697
384 Ga0587120_004840 3300059659 Bacteria 1016
385 Ga0587124_000269 3300059660 Bacteria 2596
386 Ga0587111_0000761 3300060346 Bacteria 3397
387 Ga0501082_0014801 3300060353 Bacteria 6718
388 2588107955 2585428157 Bacteria 3018951
389 2643732575 2643221542 Bacteria 3563959
390 2643753720 2643221546 Bacteria 2910897
391 2643786359 2643221553 Bacteria 3544260
392 2643847792 2643221566 Bacteria 3460379
393 2643876441 2643221572 Bacteria 3614809
394 2643888104 2643221575 Bacteria 4022601
395 2643994819 2643221597 Bacteria 3347721
396 2644171375 2643221630 Bacteria 3601215
397 2644197857 2643221635 Bacteria 2632343
398 2644383496 2643221669 Bacteria 3611286
399 2644681059 2643221724 Bacteria 3593515
400 2730230508 2728369380 Bacteria 3620317
401 2747952129 2747842429 Bacteria 3914386
402 2758224795 2757320536 Bacteria 3629334
403 2774378919 2773857758 Bacteria 3592392
404 2774382006 2773857759 Bacteria 2963774
405 2774400765 2773857763 Bacteria 4180068
406 2808628767 2808606306 Bacteria 3608896
407 2808884772 2808606368 Bacteria 3174172
408 2809226254 2808606447 Bacteria 3572005
409 2812322091 2811994872 Bacteria 4121241
410 2821269003 2821268502 Bacteria 3750023
411 2833709893 2833709550 Bacteria 4008291
412 2844854323 2844852863 Bacteria 3849151
413 2852632513 2852632344 Bacteria 3463163
414 2852647577 2852646457 Bacteria 3408613
415 2852664089 2852663356 Bacteria 4090475
416 2857722748 2857720070 Bacteria 3189373
417 2857725827 2857723135 Bacteria 4217853
418 2857730655 2857729791 Bacteria 4040535
419 2857738232 2857737099 Bacteria 3104305
420 2870629398 2870628048 Bacteria 3696012
421 2895660616 2895660088 Bacteria 3782833
422 2904510381 2904509784 Bacteria 3520416
423 2908678401 2908678064 Bacteria 3482747
424 2919070725 2919069694 Bacteria 3622919
425 2919397194 2919395869 Bacteria 3704152
426 2928093832 2928090899 Bacteria 3158267
427 2928121461 2928121344 Bacteria 3972376
428 2945968744 2945968032 Bacteria 4111363
429 2946036582 2946033335 Bacteria 3835514
430 2946045185 2946041624 Bacteria 4191385
431 2946084047 2946080515 Bacteria 4310960
432 2974294865 2974294766 Bacteria 3767688
433 2974325335 2974324384 Bacteria 3750535
434 2977230297 2977228692 Bacteria 3450105
435 2977239101 2977236895 Bacteria 3569373
436 2977252167 2977251589 Bacteria 2952848
437 2977265515 2977264416 Bacteria 3750737
438 2984543114 2984542743 Bacteria 3569378
439 2984582481 2984580707 Bacteria 3351387
440 8004184528 8004182704 Bacteria 3391155
441 8004213334 8004212874 Bacteria 2861420
442 8016255120 8016254467 Bacteria 3797036
443 8045832195 8045830549 Bacteria 4444727
444 8056039380 8056037122 Bacteria 3854319
445 8057347412 8057345674 Bacteria 4160394
446 Ga0075435_100322044
447 JGI24740J21852_10000460
448 JGI25154J39366_1001910
449 Ga0007427J51700_102557
450 Ga0006562J51391_1104523
451 Ga0006562J51391_1104526
452 Ga0006780_1007001
453 Ga0065714_10067377
454 Ga0070658_10009122
455 Ga0070658_10080026
456 Ga0070677_10150767
457 Ga0070660_100036773
458 Ga0070660_100468720
459 Ga0070661_100018488
460 Ga0070668_100754380
461 Ga0070671_100023253
462 Ga0070688_100546599
463 Ga0070667_100085309
464 Ga0070709_10007508
465 Ga0070714_100171888
466 Ga0070710_10031075
467 Ga0070663_100680531
468 Ga0070678_100463977
469 Ga0070679_100474979
470 Ga0068853_100010611
471 Ga0068853_100293807
472 Ga0068853_100793392
473 Ga0070704_101139420
474 Ga0068855_100128220
475 Ga0068855_100338933
476 Ga0068857_100852529
477 Ga0068854_100212182
478 Ga0068856_100414380
479 Ga0068856_100482645
480 Ga0068856_100587047
481 Ga0068851_10000022
482 Ga0068858_100001116
483 Ga0081538_10140558
484 Ga0075365_10015615
485 Ga0075365_10029877
486 Ga0075365_10186113
487 Ga0075368_10016248
488 Ga0075363_100050849
489 Ga0075363_100094473
490 Ga0075363_100205748
491 Ga0075364_10021121
492 Ga0075364_10027461
493 Ga0075364_10077143
494 Ga0075364_10111899
495 Ga0075364_10172148
496 Ga0075367_10009009
497 Ga0075369_10037457
498 Ga0075369_10156965
499 Ga0075370_10015347
500 Ga0075370_10077989
501 Ga0075370_10246323
502 Ga0075428_100471418
503 Ga0075428_100663323
504 Ga0105244_10004765
505 Ga0105244_10036504
506 Ga0105240_10070946
507 Ga0105240_10420138
508 Ga0111539_10306176
509 Ga0105245_10118013
510 Ga0105245_10438128
511 Ga0105243_10044746
512 Ga0105241_10734061
513 Ga0105242_11419043
514 Ga0105237_10031122
515 Ga0105237_10111613
516 Ga0105238_10045909
517 Ga0105239_10490888
518 Ga0105246_10170900
519 Ga0157371_10016523
520 Ga0157371_10024138
521 Ga0157370_10063693
522 Ga0157370_10135809
523 Ga0157369_10002930
524 Ga0157369_10084273
525 Ga0171462_1001
526 Ga0163162_10211924
527 Ga0163162_10392412
528 Ga0163162_10730607
529 Ga0157372_10221913
530 Ga0157372_10227095
531 Ga0157375_10358632
532 Ga0157375_11118519
533 Ga0163163_10076682
534 Ga0157380_10034018
535 Ga0157379_10092307
536 Ga0157376_10240121
537 Ga0163161_10058703
538 Ga0197907_11050670
539 Ga0197907_11084650
540 Ga0209646_1000013
541 Ga0209646_1000014
542 Ga0207656_10000005
543 Ga0207655_1000386
544 Ga0207655_1107406
545 Ga0207647_10033365
546 Ga0207647_10090900
547 Ga0207705_10000001
548 Ga0207705_10035339
549 Ga0207705_10036550
550 Ga0207705_10207372
551 Ga0207654_10000001
552 Ga0207695_10082467
553 Ga0207695_10418749
554 Ga0207671_10000016
555 Ga0207657_10005997
556 Ga0207657_10036712
557 Ga0207657_10399851
558 Ga0207649_10024394
559 Ga0207694_10000057
560 Ga0207687_10416254
561 Ga0207664_10169827
562 Ga0207644_10123828
563 Ga0207690_10003803
564 Ga0207709_10068641
565 Ga0207709_10254066
566 Ga0207669_10156012
567 Ga0207667_10035600
568 Ga0207667_10083110
569 Ga0207667_10282768
570 Ga0207668_10206525
571 Ga0207640_10037144
572 Ga0207658_10014981
573 Ga0207639_10071529
574 Ga0207639_10135861
575 Ga0207639_10524333
576 Ga0207678_10101275
577 Ga0207678_10320669
578 Ga0207678_10466078
579 Ga0207708_10303410
580 Ga0207702_10100567
581 Ga0207702_10848092
582 Ga0207683_10062314
583 Ga0207698_10019872
584 Ga0307515_10291079
585 Ga0307408_100193935
586 Ga0307413_10083111
587 Ga0307413_10244917
588 Ga0307410_10200263
589 Ga0307406_10000938
590 Ga0307406_10032617
591 Ga0307406_10094564
592 Ga0307412_10231849
593 Ga0307409_101251406
594 Ga0307414_10101924
595 Ga0316584_0299687
596 Ga0395900_1316066
597 Ga0395901_0085307
598 Ga0451789_1294910
599 Ga0451795_0674751
600 Ga0451804_0498327
601 Ga0451833_0383288
602 Ga0451841_1105200
603 Ga0451843_1544020
604 Ga0451853_2207870
605 Ga0439431_0146776
606 Ga0466965_0005434
607 Ga0466965_0045670
608 Ga0466966_0511554
609 Ga0466961_0101351
610 Ga0466971_0048616
611 Ga0466968_0014966
612 Ga0466970_0000027
613 Ga0466970_0035231
614 Ga0466970_0040814
615 Ga0466960_0008733
616 Ga0466960_0056630
617 Ga0466960_0267565
618 Ga0495627_001687
619 Ga0495603_0245202
620 Ga0495590_0000902
621 Ga0495650_0060302
622 Ga0495650_0070523
623 Ga0495620_0029591
624 Ga0495620_0194160
625 Ga0495654_0116540
626 Ga0495633_0146107
627 Ga0495656_0148392
628 Ga0495625_0157617
629 Ga0495671_0046748
630 Ga0495672_0030252
631 Ga0495672_0031256
632 Ga0495615_0104415
633 Ga0496101_0002898
634 Ga0496101_0187846
635 Ga0496102_0196778
636 Ga0496103_0005136
637 Ga0496104_0044706
638 Ga0496104_0757270
639 Ga0496105_0009192
640 Ga0496105_0185075
641 Ga0496105_0191704
642 Ga0496107_0001328
643 Ga0496108_0141305
644 Ga0496109_0016841
645 Ga0496109_0071948
646 Ga0496110_0036804
647 Ga0496111_0039015
648 Ga0496112_0020079
649 Ga0496112_0271824
650 Ga0496113_0005620
651 Ga0496113_0563403
652 Ga0496114_0066335
653 Ga0496114_0088508
654 Ga0496114_0140938
655 Ga0496114_0979233
656 Ga0496115_0002702
657 Ga0496117_0000362
658 Ga0496117_0003610
659 Ga0496117_0004032
660 Ga0496117_0006530
661 Ga0496117_0009885
662 Ga0496117_0028132
663 Ga0496117_0031402
664 Ga0496117_0070709
665 Ga0496117_0115251
666 Ga0496117_0137662
667 Ga0496118_0002856
668 Ga0496118_0006345
669 Ga0496118_0008749
670 Ga0496118_0040002
671 Ga0496118_0056469
672 Ga0496118_0068984
673 Ga0496119_0000720
674 Ga0496119_0003034
675 Ga0496119_0023416
676 Ga0496119_0025618
677 Ga0496119_0054042
678 Ga0496119_0307111
679 Ga0496120_0015932
680 Ga0496120_0037279
681 Ga0496120_0052780
682 Ga0496120_0081010
683 Ga0496120_0099767
684 Ga0496120_0129031
685 Ga0496121_0000497
686 Ga0496121_0210207
687 Ga0496122_0000022
688 Ga0496122_0000799
689 Ga0496122_0003594
690 Ga0496122_0010341
691 Ga0496122_0090523
692 Ga0496122_0180178
693 Ga0496123_0000009
694 Ga0496123_0000016
695 Ga0496123_0004251
696 Ga0496123_0182613
697 Ga0496124_0002766
698 Ga0496124_0006965
699 Ga0496124_0029307
700 Ga0496124_0036040
701 Ga0496124_0085327
702 Ga0496124_0213967
703 Ga0496124_0327918
704 Ga0496125_0002082
705 Ga0496125_0002578
706 Ga0496125_0005769
707 Ga0496125_0029529
708 Ga0496125_0043499
709 Ga0496125_0073122
710 Ga0496126_0002077
711 Ga0496126_0002563
712 Ga0496126_0015145
713 Ga0496126_0052186
714 Ga0496126_0103173
715 Ga0496126_0108175
716 Ga0496126_0697241
717 Ga0501306_009073
718 Ga0501308_030330
719 Ga0501309_014803
720 Ga0501310_009305
721 Ga0501304_004362
722 Ga0501305_007464
723 Ga0501307_002229
724 Ga0501307_005288
725 Ga0501312_014195
726 Ga0501317_001118
727 Ga0501318_003086
728 Ga0501319_000191
729 Ga0501320_004361
730 Ga0501322_002862
731 Ga0501323_002830
732 Ga0501323_011339
733 Ga0501325_000709
734 Ga0501338_00589
735 Ga0501031_0025920
736 Ga0501032_0001225
737 Ga0501032_0205594
738 Ga0501032_0256550
739 Ga0501034_0002490
740 Ga0501034_0012335
741 Ga0501034_0023372
742 Ga0501034_0032413
743 Ga0501034_0037011
744 Ga0501034_0040057
745 Ga0501034_0055806
746 Ga0501036_0106410
747 Ga0501037_0357545
748 Ga0501038_0000144
749 Ga0501038_0020229
750 Ga0501038_0370516
751 Ga0501039_0069542
752 Ga0501043_0037575
753 Ga0501043_0087089
754 Ga0501043_0254659
755 Ga0501046_0092613
756 Ga0501047_0011785
757 Ga0501047_0028559
758 Ga0501067_0042653
759 Ga0501067_0567317
760 Ga0501069_0203378
761 Ga0501070_0000874
762 Ga0501070_0040019
763 Ga0501070_0054412
764 Ga0501070_0068175
765 Ga0501072_0062259
766 Ga0501073_0000030
767 Ga0501073_0069543
768 Ga0501073_0397237
769 Ga0501074_0294104
770 Ga0501079_0304883
771 Ga0501080_0000208
772 Ga0501083_0000921
773 Ga0501035_0004487
774 Ga0501035_0215772
775 Ga0501044_0001222
776 Ga0501044_0024266
777 nmdc:mga03n38_279311_c1
778 nmdc:mga03n38_33332_c1
779 nmdc:mga00v17_105512_c1
780 nmdc:mga00v17_34172_c1
781 nmdc:mga00v17_8123_c1
782 nmdc:mga00v17_99131_c1
783 nmdc:mga0yw44_277_c1
784 nmdc:mga0yw44_436589_c1
785 nmdc:mga0yw44_5399_c1
786 nmdc:mga06z11_11796_c1
787 nmdc:mga07m45_203437_c1
788 nmdc:mga07m45_24923_c1
789 nmdc:mga0sz30_6222_c2
790 Ga0500562_001347
791 Ga0500592_049954
792 Ga0500593_052144
793 Ga0500568_0018835
794 Ga0500568_0125044
795 Ga0500590_058221
796 Ga0500616_0000027
797 Ga0500616_0000117
798 Ga0500616_0002723
799 Ga0500620_000519
800 Ga0500645_080478
801 Ga0500587_024472
802 Ga0501084_0082056
803 Ga0501084_0776060
804 Ga0587084_000004
805 Ga0587070_000783
806 Ga0587070_056946
807 Ga0587073_0035398
808 Ga0587073_0104386
809 Ga0587077_001116
810 Ga0587083_0014219
811 Ga0587085_001114
812 Ga0587086_000329
813 Ga0587088_020892
814 Ga0587090_001053
815 Ga0587091_000453
816 Ga0587092_000723
817 Ga0587094_000376
818 Ga0587095_000117
819 Ga0587097_01194
820 Ga0587098_000885
821 Ga0587125_000594
822 Ga0587101_000011
823 Ga0587115_000267
824 Ga0587130_008048
825 Ga0587069_006866
826 Ga0587100_000081
827 Ga0587105_003189
828 Ga0587107_052222
829 Ga0587120_004840
830 Ga0587124_000269
831 Ga0587111_0000761
832 Ga0501082_0014801
833 2588107955
834 2643732575
835 2643753720
836 2643786359
837 2643847792
838 2643876441
839 2643888104
840 2643994819
841 2644171375
842 2644197857
843 2644383496
844 2644681059
845 2730230508
846 2747952129
847 2758224795
848 2774378919
849 2774382006
850 2774400765
851 2808628767
852 2808884772
853 2809226254
854 2812322091
855 2821269003
856 2833709893
857 2844854323
858 2852632513
859 2852647577
860 2852664089
861 2857722748
862 2857725827
863 2857730655
864 2857738232
865 2870629398
866 2895660616
867 2904510381
868 2908678401
869 2919070725
870 2919397194
871 2928093832
872 2928121461
873 2945968744
874 2946036582
875 2946045185
876 2946084047
877 2974294865
878 2974325335
879 2977230297
880 2977239101
881 2977252167
882 2977265515
883 2984543114
884 2984582481
885 8004184528
886 8004213334
887 8016255120
888 8045832195
889 8056039380
890 8057347412

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00673

Ribosomal_L5_C

ribosomal L5P family C-terminus

110

203

0.98

PF00281

Ribosomal_L5

Ribosomal protein L5

46

106

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ns3-assembly1.cif.gz_B crystal structures of cy5 cyanine fluorophores stacked onto the end of double-stranded rna 0.9755 16 189
8crx-assembly1.cif.gz_f cutibacterium acnes 70s ribosome with mrna, p-site trna and sarecycline bound 0.9727 13 191
8cvm-assembly1.cif.gz_f cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9691 13 193
8fn2-assembly1.cif.gz_G the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.9658 11 191
7azo-assembly1.cif.gz_L5A 70s thermus thermophilus ribosome with bound antibiotic lead seq-977 0.965 15 191
ID Description Score Start End Superfamily
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9602 15 189 3.30.1440.10
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9445 15 189 3.30.1440.10
af_P36519_120_288_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9144 34 189 3.30.1440.10
af_A0A1D8PHY2_119_286_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9065 34 191 3.30.1440.10
af_O14337_108_278_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9057 34 185 3.30.1440.10
ID Description Score Start End GO Terms
AF-A0A534PYF4-F1-model_v4 Large ribosomal subunit protein uL5 0.9849 13 191 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-B3QYD6-F1-model_v4 Large ribosomal subunit protein uL5 0.9844 12 191 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A6B8VES7-F1-model_v4 Large ribosomal subunit protein uL5 0.9838 13 191 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7Y2FLE2-F1-model_v4 Large ribosomal subunit protein uL5 0.9834 14 191 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A4Q5X1Z8-F1-model_v4 Large ribosomal subunit protein uL5 0.9833 9 191 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map