metagRoot

F445502

General Info

Members	Datasets	Scaffolds	Average Seq Length
445	200	445	170

Family's Representative Sequence

Representative Sequence	3300013296\|Ga0157374_10232619\|Ga0157374_102326192
Length	185
Sequence	MSLCYSAASEECTELTMPDAPDIPRPSQLWKRLSAERKLLAADAFWQDENAAAEQAEAVVMIAQRIKFRVRSVQTLAREKKSRHLVNLGSVSEMVAARLLVAYHLHHQRAMMAAFLDALGIAHDNGLIADEELKAPSADRLRDAARAIGAAYPAEDVALYLATLMWQDPETWAGLTELPELAQHA

Samples

	Sample ID	Description	Type	Environment
1	2162886012	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1	Metagenome	Rhizosphere
2	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
3	3300002155	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7	Metagenome	Rhizosphere
4	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
5	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
6	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
7	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
8	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
9	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
10	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
11	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
12	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
13	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
14	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
15	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
16	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
17	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
18	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
19	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
20	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
21	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
22	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
23	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
24	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
25	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
26	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
27	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
28	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
29	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
30	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
31	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
32	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
33	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
34	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
35	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
36	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
37	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
38	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
39	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
40	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
41	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
42	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
43	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
44	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
45	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
46	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
47	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
48	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
49	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
50	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
51	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
52	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
53	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
54	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
55	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
56	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
57	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
58	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
59	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
60	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
61	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
62	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
63	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
64	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
65	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
66	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
67	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
68	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
69	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
70	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
71	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
72	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
73	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
74	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
75	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
76	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
77	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
78	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
79	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
80	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
81	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
82	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
83	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
84	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
85	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
86	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
87	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
88	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
89	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
90	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
91	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
92	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
93	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
94	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
95	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
96	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
97	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
98	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
99	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
100	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300027552	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
147	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
151	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
152	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
153	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
154	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
155	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
156	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
157	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
158	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
159	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
160	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
161	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
162	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
163	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
164	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
165	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
166	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
167	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
168	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
169	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
170	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
171	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
172	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
173	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
174	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
175	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
176	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
177	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
178	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
179	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
180	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
181	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
182	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
183	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
184	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
185	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
186	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
187	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
188	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
189	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
190	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
191	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
192	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
193	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
194	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
195	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
196	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
197	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
198	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
199	3300059423	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
200	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0
Nodule	0
Rhizoplane	0.45
Rhizosphere	99.55
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	MBSR1b_contig_7035149	2162886012	Bacteria	903
2	JGI24746J21847_1000693	3300001977	Bacteria	5169
3	JGI24033J26618_1002985	3300002155	Bacteria	1766
4	Ga0065712_10011901	3300005290	Bacteria	3269
5	Ga0065712_10194425	3300005290	Bacteria	1134
6	Ga0065715_10106514	3300005293	Bacteria	2812
7	Ga0065707_10094176	3300005295	Bacteria	3529
8	Ga0070676_10006083	3300005328	Bacteria	6442
9	Ga0070676_10067528	3300005328	Bacteria	2138
10	Ga0070676_10250029	3300005328	Bacteria	1183
11	Ga0070676_10362522	3300005328	Unclassified	999
12	Ga0070690_100128791	3300005330	Bacteria	1707
13	Ga0070690_100598065	3300005330	Bacteria	837
14	Ga0070670_100001257	3300005331	Bacteria	20188
15	Ga0070670_100022864	3300005331	Bacteria	5380
16	Ga0070670_100053100	3300005331	Bacteria	3480
17	Ga0070670_100966311	3300005331	Unclassified	774
18	Ga0070677_10015211	3300005333	Bacteria	2723
19	Ga0070677_10028966	3300005333	Bacteria	2096
20	Ga0070677_10032824	3300005333	Bacteria	1995
21	Ga0068869_100012842	3300005334	Bacteria	5544
22	Ga0068869_100014179	3300005334	Bacteria	5321
23	Ga0070666_10001736	3300005335	Bacteria	13290
24	Ga0070666_10011237	3300005335	Bacteria	5616
25	Ga0068868_100004581	3300005338	Bacteria	9703
26	Ga0068868_100545719	3300005338	Bacteria	1021
27	Ga0070660_100214767	3300005339	Bacteria	1562
28	Ga0070689_100109452	3300005340	Bacteria	2196
29	Ga0070687_100079347	3300005343	Bacteria	1786
30	Ga0070661_100069592	3300005344	Bacteria	2588
31	Ga0070661_100349083	3300005344	Bacteria	1160
32	Ga0070668_100016357	3300005347	Bacteria	5547
33	Ga0070668_100428361	3300005347	Bacteria	1134
34	Ga0070669_100014927	3300005353	Bacteria	5535
35	Ga0070669_100032570	3300005353	Bacteria	3766
36	Ga0070669_100111824	3300005353	Bacteria	2073
37	Ga0070669_100133221	3300005353	Bacteria	1909
38	Ga0070669_100272010	3300005353	Bacteria	1355
39	Ga0070675_100002921	3300005354	Bacteria	12885
40	Ga0070675_100026216	3300005354	Bacteria	4676
41	Ga0070675_100215920	3300005354	Bacteria	1669
42	Ga0070675_100252023	3300005354	Bacteria	1545
43	Ga0070671_100070690	3300005355	Bacteria	2912
44	Ga0070674_100000032	3300005356	Bacteria	64311
45	Ga0070674_100317410	3300005356	Bacteria	1248
46	Ga0070673_100011279	3300005364	Bacteria	6094
47	Ga0070673_100159277	3300005364	Bacteria	1918
48	Ga0070673_100242581	3300005364	Bacteria	1567
49	Ga0070673_101834115	3300005364	Unclassified	575
50	Ga0070688_100004862	3300005365	Bacteria	7028
51	Ga0070688_100160971	3300005365	Bacteria	1542
52	Ga0070688_100201352	3300005365	Bacteria	1393
53	Ga0070659_100097980	3300005366	Bacteria	2357
54	Ga0070659_100190841	3300005366	Bacteria	1684
55	Ga0070659_100368435	3300005366	Bacteria	1208
56	Ga0070667_100005771	3300005367	Bacteria	10334
57	Ga0070667_101025620	3300005367	Bacteria	770
58	Ga0070713_100370355	3300005436	Bacteria	1333
59	Ga0070701_10013819	3300005438	Bacteria	3684
60	Ga0070701_10110757	3300005438	Bacteria	1533
61	Ga0070701_10604098	3300005438	Bacteria	727
62	Ga0070700_100055302	3300005441	Bacteria	2484
63	Ga0070700_100078548	3300005441	Bacteria	2125
64	Ga0070700_100576376	3300005441	Bacteria	878
65	Ga0070694_100418613	3300005444	Bacteria	1052
66	Ga0070694_100487049	3300005444	Bacteria	979
67	Ga0070708_100068859	3300005445	Bacteria	3182
68	Ga0070663_100017123	3300005455	Bacteria	4723
69	Ga0070678_100031871	3300005456	Bacteria	3641
70	Ga0070678_100098130	3300005456	Bacteria	2264
71	Ga0070662_100030484	3300005457	Bacteria	3775
72	Ga0070662_100086229	3300005457	Bacteria	2348
73	Ga0068867_100002741	3300005459	Bacteria	12417
74	Ga0068867_100068939	3300005459	Bacteria	2640
75	Ga0068867_100069053	3300005459	Bacteria	2638
76	Ga0068867_100166806	3300005459	Bacteria	1741
77	Ga0068867_100354509	3300005459	Unclassified	1225
78	Ga0068867_100500610	3300005459	Bacteria	1044
79	Ga0070685_10001085	3300005466	Bacteria	14552
80	Ga0070685_10079263	3300005466	Bacteria	1965
81	Ga0070685_10271373	3300005466	Bacteria	1132
82	Ga0070706_100003379	3300005467	Bacteria	15734
83	Ga0070707_100030534	3300005468	Bacteria	5131
84	Ga0070698_100041266	3300005471	Bacteria	4737
85	Ga0070697_100206851	3300005536	Bacteria	1670
86	Ga0068853_100350767	3300005539	Bacteria	1373
87	Ga0070672_100004171	3300005543	Bacteria	9435
88	Ga0070672_100035995	3300005543	Bacteria	3767
89	Ga0070672_100056778	3300005543	Bacteria	3071
90	Ga0070672_100175563	3300005543	Bacteria	1783
91	Ga0070672_100227844	3300005543	Bacteria	1565
92	Ga0070672_100271460	3300005543	Bacteria	1432
93	Ga0070686_100061356	3300005544	Bacteria	2429
94	Ga0070686_100112653	3300005544	Bacteria	1856
95	Ga0070665_100017696	3300005548	Bacteria	7156
96	Ga0070704_100434669	3300005549	Bacteria	1127
97	Ga0070704_100539313	3300005549	Bacteria	1018
98	Ga0070664_100007165	3300005564	Bacteria	8988
99	Ga0070664_100268023	3300005564	Bacteria	1538
100	Ga0068857_100178940	3300005577	Bacteria	1930
101	Ga0068857_100342156	3300005577	Bacteria	1384
102	Ga0068857_101232419	3300005577	Unclassified	725
103	Ga0068854_100842686	3300005578	Unclassified	802
104	Ga0068856_100010295	3300005614	Bacteria	9090
105	Ga0070702_100093511	3300005615	Bacteria	1828
106	Ga0068852_101497865	3300005616	Bacteria	697
107	Ga0068859_100016203	3300005617	Bacteria	7487
108	Ga0068859_100205677	3300005617	Bacteria	2054
109	Ga0068859_100371464	3300005617	Bacteria	1526
110	Ga0068864_100370161	3300005618	Bacteria	1356
111	Ga0068864_100725090	3300005618	Bacteria	973
112	Ga0068866_10036029	3300005718	Bacteria	2421
113	Ga0068866_10088735	3300005718	Bacteria	1679
114	Ga0068861_100061057	3300005719	Bacteria	2891
115	Ga0068861_100075563	3300005719	Bacteria	2623
116	Ga0068861_100994636	3300005719	Bacteria	800
117	Ga0068851_10007663	3300005834	Bacteria	4966
118	Ga0068870_10000427	3300005840	Bacteria	15916
119	Ga0068870_10052460	3300005840	Bacteria	2162
120	Ga0068870_10145202	3300005840	Bacteria	1392
121	Ga0068870_10200923	3300005840	Bacteria	1208
122	Ga0068863_100097945	3300005841	Bacteria	2785
123	Ga0068863_101900554	3300005841	Unclassified	605
124	Ga0068858_100013400	3300005842	Bacteria	7739
125	Ga0068858_100029531	3300005842	Bacteria	5091
126	Ga0068858_100089572	3300005842	Bacteria	2863
127	Ga0068858_100796180	3300005842	Bacteria	922
128	Ga0068860_100066024	3300005843	Bacteria	3436
129	Ga0068860_100656789	3300005843	Bacteria	1057
130	Ga0068860_101368774	3300005843	Bacteria	729
131	Ga0068862_100004495	3300005844	Bacteria	11758
132	Ga0068862_100151298	3300005844	Bacteria	2066
133	Ga0068862_100475608	3300005844	Bacteria	1182
134	Ga0068862_101146599	3300005844	Unclassified	774
135	Ga0081539_10000750	3300005985	Bacteria	64517
136	Ga0075432_10038343	3300006058	Bacteria	1669
137	Ga0070712_100087513	3300006175	Unclassified	2273
138	Ga0097621_100323377	3300006237	Bacteria	1367
139	Ga0097621_100383868	3300006237	Bacteria	1255
140	Ga0097621_100589807	3300006237	Bacteria	1015
141	Ga0097621_100641548	3300006237	Bacteria	974
142	Ga0068871_100057440	3300006358	Bacteria	3166
143	Ga0068871_100369551	3300006358	Bacteria	1272
144	Ga0075428_100000166	3300006844	Bacteria	60871
145	Ga0075428_100006995	3300006844	Bacteria	12512
146	Ga0075428_100043662	3300006844	Bacteria	4929
147	Ga0075428_100144973	3300006844	Bacteria	2581
148	Ga0075428_100165640	3300006844	Bacteria	2398
149	Ga0075428_100425935	3300006844	Bacteria	1422
150	Ga0075428_100588399	3300006844	Bacteria	1189
151	Ga0075430_100003054	3300006846	Bacteria	13996
152	Ga0075430_100007091	3300006846	Bacteria	9453
153	Ga0075430_100046423	3300006846	Bacteria	3669
154	Ga0075430_100248966	3300006846	Bacteria	1472
155	Ga0075430_100430584	3300006846	Bacteria	1089
156	Ga0075431_100001063	3300006847	Bacteria	24567
157	Ga0075431_100007187	3300006847	Bacteria	11072
158	Ga0075431_100028570	3300006847	Bacteria	5734
159	Ga0075431_100091012	3300006847	Bacteria	3149
160	Ga0075433_10006662	3300006852	Bacteria	9146
161	Ga0075434_100011195	3300006871	Bacteria	8443
162	Ga0075429_100006130	3300006880	Bacteria	10392
163	Ga0075429_100017594	3300006880	Bacteria	6180
164	Ga0075429_100022337	3300006880	Bacteria	5486
165	Ga0075429_100047136	3300006880	Bacteria	3750
166	Ga0075429_100221706	3300006880	Bacteria	1656
167	Ga0075429_100466060	3300006880	Bacteria	1107
168	Ga0068865_100122026	3300006881	Bacteria	1939
169	Ga0068865_100274929	3300006881	Bacteria	1339
170	Ga0068865_100567786	3300006881	Unclassified	955
171	Ga0097620_100016204	3300006931	Bacteria	7487
172	Ga0097620_100205658	3300006931	Bacteria	2054
173	Ga0097620_100371467	3300006931	Bacteria	1526
174	Ga0075435_100056721	3300007076	Bacteria	3167
175	Ga0099794_10015104	3300007265	Bacteria	3401
176	Ga0105240_10006183	3300009093	Bacteria	17642
177	Ga0111539_10002366	3300009094	Bacteria	25064
178	Ga0111539_10006794	3300009094	Bacteria	14720
179	Ga0111539_10116693	3300009094	Bacteria	3130
180	Ga0111539_10181412	3300009094	Bacteria	2459
181	Ga0111539_10904083	3300009094	Bacteria	1027
182	Ga0105245_10501296	3300009098	Bacteria	1230
183	Ga0114129_10048904	3300009147	Bacteria	5943
184	Ga0114129_10055617	3300009147	Bacteria	5545
185	Ga0114129_10756408	3300009147	Bacteria	1243
186	Ga0105243_10316625	3300009148	Bacteria	1420
187	Ga0105242_10002200	3300009176	Bacteria	15384
188	Ga0105242_10320176	3300009176	Bacteria	1422
189	Ga0105248_10164602	3300009177	Bacteria	2500
190	Ga0105248_10180319	3300009177	Bacteria	2380
191	Ga0105248_10568904	3300009177	Unclassified	1279
192	Ga0105248_10636363	3300009177	Bacteria	1203
193	Ga0105248_10784972	3300009177	Bacteria	1075
194	Ga0105248_10815657	3300009177	Bacteria	1053
195	Ga0105248_11863805	3300009177	Bacteria	682
196	Ga0105237_10540017	3300009545	Unclassified	1172
197	Ga0105238_10013406	3300009551	Bacteria	8274
198	Ga0105249_10002282	3300009553	Bacteria	16655
199	Ga0105246_10008930	3300011119	Bacteria	6168
200	Ga0157371_10136221	3300013102	Bacteria	1749
201	Ga0157369_10227495	3300013105	Unclassified	1951
202	Ga0157374_10232619	3300013296	Bacteria	1811
203	Ga0157378_10699366	3300013297	Bacteria	1033
204	Ga0163162_10001129	3300013306	Bacteria	24849
205	Ga0163162_10208037	3300013306	Bacteria	2086
206	Ga0163162_10334418	3300013306	Unclassified	1647
207	Ga0157375_10042456	3300013308	Bacteria	4401
208	Ga0157375_10090851	3300013308	Bacteria	3113
209	Ga0157375_10425344	3300013308	Bacteria	1494
210	Ga0163163_10086930	3300014325	Bacteria	3136
211	Ga0163163_10111093	3300014325	Bacteria	2770
212	Ga0163163_10385144	3300014325	Bacteria	1460
213	Ga0163163_11908203	3300014325	Bacteria	654
214	Ga0157380_10026746	3300014326	Bacteria	4383
215	Ga0157380_10029839	3300014326	Bacteria	4171
216	Ga0157380_10344982	3300014326	Bacteria	1391
217	Ga0157380_10465960	3300014326	Bacteria	1218
218	Ga0157380_10755515	3300014326	Bacteria	984
219	Ga0157377_10003595	3300014745	Bacteria	7019
220	Ga0157377_10260082	3300014745	Bacteria	1129
221	Ga0157377_10317905	3300014745	Bacteria	1033
222	Ga0157379_10016196	3300014968	Bacteria	6558
223	Ga0157376_10025552	3300014969	Bacteria	4653
224	Ga0157376_10226140	3300014969	Bacteria	1736
225	Ga0163161_10001928	3300017792	Bacteria	15134
226	Ga0163161_10120251	3300017792	Bacteria	1973
227	Ga0163161_10271877	3300017792	Bacteria	1326
228	Ga0207697_10001326	3300025315	Bacteria	13620
229	Ga0207656_10009654	3300025321	Bacteria	3586
230	Ga0207682_10003365	3300025893	Bacteria	6965
231	Ga0207682_10006149	3300025893	Bacteria	4850
232	Ga0207682_10015097	3300025893	Bacteria	3008
233	Ga0207682_10066628	3300025893	Bacteria	1518
234	Ga0207682_10278018	3300025893	Bacteria	783
235	Ga0207642_10314247	3300025899	Bacteria	913
236	Ga0207688_10000947	3300025901	Bacteria	14707
237	Ga0207688_10046958	3300025901	Bacteria	2411
238	Ga0207688_10062722	3300025901	Bacteria	2095
239	Ga0207680_10031310	3300025903	Bacteria	3012
240	Ga0207680_10711168	3300025903	Bacteria	720
241	Ga0207645_10000611	3300025907	Bacteria	29564
242	Ga0207645_10006074	3300025907	Bacteria	8685
243	Ga0207645_10044764	3300025907	Bacteria	2831
244	Ga0207645_10219088	3300025907	Bacteria	1254
245	Ga0207643_10000068	3300025908	Bacteria	69282
246	Ga0207643_10002646	3300025908	Bacteria	9695
247	Ga0207643_10062260	3300025908	Bacteria	2132
248	Ga0207643_10149400	3300025908	Bacteria	1400
249	Ga0207643_10153803	3300025908	Bacteria	1380
250	Ga0207684_10080887	3300025910	Bacteria	2764
251	Ga0207684_10477336	3300025910	Unclassified	1070
252	Ga0207695_10023644	3300025913	Bacteria	6934
253	Ga0207693_10442822	3300025915	Bacteria	1015
254	Ga0207662_10065342	3300025918	Bacteria	2191
255	Ga0207662_10081195	3300025918	Bacteria	1979
256	Ga0207657_10189624	3300025919	Bacteria	1659
257	Ga0207649_10273340	3300025920	Bacteria	1226
258	Ga0207649_10550334	3300025920	Bacteria	883
259	Ga0207646_10026668	3300025922	Bacteria	5270
260	Ga0207681_10027526	3300025923	Bacteria	3676
261	Ga0207681_10119372	3300025923	Bacteria	1931
262	Ga0207681_10122034	3300025923	Bacteria	1912
263	Ga0207681_10235329	3300025923	Bacteria	1423
264	Ga0207681_10253635	3300025923	Bacteria	1374
265	Ga0207694_10003599	3300025924	Bacteria	12277
266	Ga0207650_10006429	3300025925	Bacteria	8008
267	Ga0207650_10042419	3300025925	Bacteria	3338
268	Ga0207650_10092874	3300025925	Bacteria	2309
269	Ga0207650_10752155	3300025925	Bacteria	825
270	Ga0207659_10015134	3300025926	Bacteria	4991
271	Ga0207659_10028375	3300025926	Bacteria	3803
272	Ga0207659_10048077	3300025926	Bacteria	3020
273	Ga0207659_10134260	3300025926	Bacteria	1914
274	Ga0207687_10606449	3300025927	Bacteria	923
275	Ga0207644_10058758	3300025931	Bacteria	2780
276	Ga0207644_10159315	3300025931	Bacteria	1753
277	Ga0207644_10324739	3300025931	Unclassified	1245
278	Ga0207690_10857186	3300025932	Bacteria	752
279	Ga0207706_10002047	3300025933	Bacteria	19775
280	Ga0207706_10007978	3300025933	Bacteria	9775
281	Ga0207709_10134150	3300025935	Bacteria	1692
282	Ga0207709_10376477	3300025935	Bacteria	1079
283	Ga0207670_10164159	3300025936	Bacteria	1661
284	Ga0207670_10185908	3300025936	Bacteria	1568
285	Ga0207669_10001787	3300025937	Bacteria	9119
286	Ga0207691_10004937	3300025940	Bacteria	12870
287	Ga0207691_10014496	3300025940	Bacteria	7517
288	Ga0207691_10082133	3300025940	Bacteria	2895
289	Ga0207691_10159706	3300025940	Bacteria	1978
290	Ga0207691_10316070	3300025940	Bacteria	1339
291	Ga0207691_10554318	3300025940	Bacteria	974
292	Ga0207711_10461441	3300025941	Bacteria	1183
293	Ga0207689_10000219	3300025942	Bacteria	50693
294	Ga0207689_10005878	3300025942	Bacteria	10870
295	Ga0207689_10123222	3300025942	Bacteria	2132
296	Ga0207689_10279594	3300025942	Bacteria	1382
297	Ga0207689_10585203	3300025942	Bacteria	938
298	Ga0207679_10002803	3300025945	Bacteria	10807
299	Ga0207679_10544372	3300025945	Bacteria	1041
300	Ga0207679_11140019	3300025945	Bacteria	715
301	Ga0207651_10123456	3300025960	Bacteria	1968
302	Ga0207651_10162445	3300025960	Bacteria	1752
303	Ga0207651_10289959	3300025960	Bacteria	1356
304	Ga0207651_10634818	3300025960	Bacteria	936
305	Ga0207668_10177622	3300025972	Bacteria	1676
306	Ga0207658_10019228	3300025986	Bacteria	4723
307	Ga0207658_10285338	3300025986	Bacteria	1417
308	Ga0207658_10639172	3300025986	Bacteria	958
309	Ga0207677_10116487	3300026023	Bacteria	2000
310	Ga0207677_10298891	3300026023	Bacteria	1329
311	Ga0207703_10042138	3300026035	Bacteria	3661
312	Ga0207703_10056658	3300026035	Bacteria	3193
313	Ga0207703_10723762	3300026035	Bacteria	947
314	Ga0207703_10947016	3300026035	Bacteria	825
315	Ga0207678_10009882	3300026067	Bacteria	8377
316	Ga0207678_10026465	3300026067	Bacteria	5059
317	Ga0207678_10250281	3300026067	Bacteria	1517
318	Ga0207708_10018007	3300026075	Bacteria	5315
319	Ga0207708_10062064	3300026075	Bacteria	2854
320	Ga0207708_10610922	3300026075	Bacteria	925
321	Ga0207702_10015197	3300026078	Bacteria	6383
322	Ga0207641_10533316	3300026088	Bacteria	1143
323	Ga0207641_11070612	3300026088	Unclassified	804
324	Ga0207648_10000660	3300026089	Bacteria	38626
325	Ga0207648_10015486	3300026089	Bacteria	7012
326	Ga0207648_10090507	3300026089	Bacteria	2673
327	Ga0207676_10122443	3300026095	Bacteria	2196
328	Ga0207676_10400104	3300026095	Bacteria	1283
329	Ga0207676_10622998	3300026095	Bacteria	1038
330	Ga0207674_10179889	3300026116	Bacteria	2066
331	Ga0207674_10346065	3300026116	Bacteria	1437
332	Ga0207674_10352083	3300026116	Bacteria	1424
333	Ga0207675_100004566	3300026118	Bacteria	13356
334	Ga0207675_100040575	3300026118	Bacteria	4347
335	Ga0207675_100067041	3300026118	Bacteria	3355
336	Ga0207683_10009806	3300026121	Bacteria	8168
337	Ga0207683_10069383	3300026121	Bacteria	3113
338	Ga0207683_10102149	3300026121	Bacteria	2560
339	Ga0209982_1017618	3300027552	Bacteria	1090
340	Ga0209588_1014064	3300027671	Bacteria	2447
341	Ga0207428_10000977	3300027907	Bacteria	31600
342	Ga0207428_10022626	3300027907	Bacteria	5301
343	Ga0207428_10352922	3300027907	Bacteria	1082
344	Ga0207428_10468299	3300027907	Bacteria	917
345	Ga0268266_10091960	3300028379	Bacteria	2661
346	Ga0268265_10020424	3300028380	Bacteria	4622
347	Ga0268265_10177315	3300028380	Bacteria	1828
348	Ga0268265_10916400	3300028380	Bacteria	861
349	Ga0268264_10219545	3300028381	Bacteria	1749
350	Ga0268264_10499116	3300028381	Bacteria	1187
351	Ga0307408_100061634	3300031548	Bacteria	2739
352	Ga0307408_100111533	3300031548	Bacteria	2102
353	Ga0307408_100448569	3300031548	Bacteria	1118
354	Ga0307408_100528987	3300031548	Bacteria	1037
355	Ga0307405_10034327	3300031731	Bacteria	3018
356	Ga0307405_10129455	3300031731	Bacteria	1741
357	Ga0307405_11001695	3300031731	Bacteria	713
358	Ga0307405_11396681	3300031731	Unclassified	612
359	Ga0307413_10004622	3300031824	Bacteria	6019
360	Ga0307413_10473907	3300031824	Bacteria	999
361	Ga0307410_10045744	3300031852	Bacteria	2916
362	Ga0307410_10048560	3300031852	Bacteria	2843
363	Ga0307410_10396174	3300031852	Bacteria	1114
364	Ga0307406_10137335	3300031901	Bacteria	1725
365	Ga0307407_10016221	3300031903	Bacteria	3704
366	Ga0307412_10026265	3300031911	Bacteria	3617
367	Ga0307412_10153180	3300031911	Bacteria	1704
368	Ga0307412_10563695	3300031911	Bacteria	959
369	Ga0307412_10795471	3300031911	Bacteria	820
370	Ga0307409_100111627	3300031995	Bacteria	2294
371	Ga0307409_100278731	3300031995	Bacteria	1544
372	Ga0307409_100737507	3300031995	Bacteria	988
373	Ga0307409_100739255	3300031995	Bacteria	987
374	Ga0307409_101569573	3300031995	Unclassified	686
375	Ga0307416_100068188	3300032002	Bacteria	2938
376	Ga0307416_100099601	3300032002	Bacteria	2524
377	Ga0307416_100104632	3300032002	Bacteria	2475
378	Ga0307416_100151539	3300032002	Bacteria	2127
379	Ga0307416_100717589	3300032002	Bacteria	1090
380	Ga0307414_10051432	3300032004	Bacteria	2860
381	Ga0307414_10210801	3300032004	Unclassified	1588
382	Ga0307414_10443336	3300032004	Bacteria	1137
383	Ga0307411_10008706	3300032005	Bacteria	5276
384	Ga0307411_10941140	3300032005	Bacteria	770
385	Ga0307415_100313058	3300032126	Bacteria	1305
386	Ga0373950_0031557	3300034818	Unclassified	983
387	Ga0373934_0046702	3300035086	Bacteria	1713
388	Ga0373939_0082462	3300035114	Bacteria	1071
389	Ga0373953_0365012	3300035117	Unclassified	633
390	Ga0373960_0039529	3300035121	Bacteria	1357
391	Ga0373955_0139077	3300035172	Bacteria	1423
392	Ga0373955_0316900	3300035172	Bacteria	942
393	Ga0373962_0059841	3300035242	Bacteria	1116
394	Ga0373931_0074434	3300035691	Bacteria	1860
395	Ga0373937_0017411	3300036401	Bacteria	6401
396	Ga0373937_0063140	3300036401	Bacteria	3406
397	Ga0439439_0144198	3300041406	Bacteria	674
398	Ga0451807_1101640	3300041486	Bacteria	1015
399	Ga0439446_0075925	3300042156	Bacteria	1034
400	Ga0439435_0189734	3300042436	Bacteria	674
401	Ga0439464_0030429	3300042439	Bacteria	1512
402	Ga0453683_0560654	3300044673	Bacteria	744
403	Ga0451576_0089653	3300045051	Bacteria	3198
404	Ga0495580_0305448	3300046472	Unclassified	1083
405	Ga0495662_0269946	3300046476	Unclassified	837
406	Ga0495598_0105753	3300046537	Bacteria	937
407	Ga0495613_0010825	3300046689	Bacteria	6767
408	Ga0495636_0018584	3300047318	Bacteria	2790
409	Ga0496113_0315336	3300048916	Bacteria	1253
410	Ga0501071_0298657	3300049587	Bacteria	1221
411	Ga0501073_1035008	3300049589	Bacteria	565
412	Ga0501076_0251206	3300049592	Bacteria	1447
413	Ga0501076_0419696	3300049592	Bacteria	1101
414	Ga0501249_029542	3300049679	Bacteria	1219
415	Ga0501249_036854	3300049679	Bacteria	1103
416	Ga0501225_0087486	3300049705	Bacteria	900
417	Ga0501083_0946170	3300049744	Bacteria	561
418	nmdc:mga05p37_207754_c1	3300050507	Bacteria	2368
419	nmdc:mga05p37_705840_c1	3300050507	Bacteria	1120
420	nmdc:mga09592_144478_c1	3300050508	Bacteria	2051
421	nmdc:mga09592_21599_c1	3300050508	Bacteria	5306
422	nmdc:mga09592_34457_c1	3300050508	Bacteria	4232
423	nmdc:mga09592_47605_c1	3300050508	Bacteria	3614
424	nmdc:mga09592_808526_c1	3300050508	Bacteria	793
425	nmdc:mga0qj67_11606_c1	3300050509	Bacteria	6607
426	nmdc:mga0qj67_2209_c1	3300050509	Bacteria	13829
427	nmdc:mga0qj67_72093_c1	3300050509	Bacteria	2757
428	nmdc:mga0qj67_815306_c1	3300050509	Bacteria	738
429	nmdc:mga0qj67_86730_c1	3300050509	Bacteria	2512
430	nmdc:mga06r32_1768_c1	3300050510	Bacteria	19402
431	nmdc:mga06r32_30119_c1	3300050510	Bacteria	5092
432	nmdc:mga06r32_446114_c1	3300050510	Bacteria	1274
433	nmdc:mga08y16_360473_c1	3300050511	Bacteria	1493
434	nmdc:mga08y16_386151_c1	3300050511	Bacteria	1435
435	nmdc:mga08y16_44058_c1	3300050511	Bacteria	4675
436	nmdc:mga0n895_6276_c1	3300050512	Bacteria	10071
437	nmdc:mga0n895_671829_c1	3300050512	Unclassified	1033
438	nmdc:mga0rr50_107185_c1	3300050513	Unclassified	2205
439	nmdc:mga0rr50_44215_c1	3300050513	Bacteria	3265
440	nmdc:mga0a205_1229_c1	3300050515	Bacteria	21485
441	nmdc:mga0a205_911927_c1	3300050515	Bacteria	725
442	Ga0590071_001004	3300059421	Bacteria	7699
443	Ga0590071_043777	3300059421	Bacteria	1079
444	Ga0590074_005958	3300059423	Bacteria	2022
445	Ga0590075_006033	3300059424	Bacteria	2867

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005441	Ga0070700_100576376	Ga0070700_1005763761	146
2	3300026075	Ga0207708_10610922	Ga0207708_106109222	146
3	3300042436	Ga0439435_0189734	Ga0439435_0189734_201_641	146
4	3300005344	Ga0070661_100349083	Ga0070661_1003490831	150
5	3300005467	Ga0070706_100003379	Ga0070706_10000337911	150
6	3300005539	Ga0068853_100350767	Ga0068853_1003507672	150
7	3300005614	Ga0068856_100010295	Ga0068856_1000102958	150
8	3300009093	Ga0105240_10006183	Ga0105240_1000618312	150
9	3300025910	Ga0207684_10080887	Ga0207684_100808872	150
10	3300025913	Ga0207695_10023644	Ga0207695_100236446	150
11	3300025920	Ga0207649_10550334	Ga0207649_105503342	150
12	3300025940	Ga0207691_10316070	Ga0207691_103160702	150
13	3300026078	Ga0207702_10015197	Ga0207702_100151972	150
14	3300049744	Ga0501083_0946170	Ga0501083_0946170_19_477	150
15	3300005543	Ga0070672_100227844	Ga0070672_1002278443	151
16	3300006847	Ga0075431_100028570	Ga0075431_1000285702	151
17	3300050510	nmdc:mga06r32_30119_c1	nmdc:mga06r32_30119_c1_2468_2974	151
18	3300006175	Ga0070712_100087513	Ga0070712_1000875134	152
19	3300025915	Ga0207693_10442822	Ga0207693_104428222	152
20	3300005445	Ga0070708_100068859	Ga0070708_1000688593	153
21	3300005459	Ga0068867_100354509	Ga0068867_1003545092	153
22	3300005468	Ga0070707_100030534	Ga0070707_1000305347	153
23	3300005536	Ga0070697_100206851	Ga0070697_1002068512	153
24	3300025910	Ga0207684_10477336	Ga0207684_104773362	153
25	3300031995	Ga0307409_100111627	Ga0307409_1001116273	153
26	3300031995	Ga0307409_101569573	Ga0307409_1015695731	153
27	3300032004	Ga0307414_10210801	Ga0307414_102108012	153
28	3300035117	Ga0373953_0365012	Ga0373953_0365012_124_591	153
29	3300047318	Ga0495636_0018584	Ga0495636_0018584_2027_2494	153
30	3300005356	Ga0070674_100317410	Ga0070674_1003174103	154
31	3300006844	Ga0075428_100006995	Ga0075428_1000069959	155
32	3300006880	Ga0075429_100047136	Ga0075429_1000471363	155
33	3300009147	Ga0114129_10048904	Ga0114129_100489042	155
34	3300050507	nmdc:mga05p37_207754_c1	nmdc:mga05p37_207754_c1_699_1205	155
35	3300050508	nmdc:mga09592_47605_c1	nmdc:mga09592_47605_c1_1119_1625	155
36	3300005985	Ga0081539_10000750	Ga0081539_1000075012	157
37	3300006880	Ga0075429_100221706	Ga0075429_1002217062	157
38	3300007265	Ga0099794_10015104	Ga0099794_100151044	159
39	3300027671	Ga0209588_1014064	Ga0209588_10140642	159
40	3300031731	Ga0307405_10034327	Ga0307405_100343274	159
41	3300031824	Ga0307413_10473907	Ga0307413_104739071	159
42	3300031995	Ga0307409_100278731	Ga0307409_1002787312	159
43	3300032002	Ga0307416_100717589	Ga0307416_1007175892	159
44	3300049587	Ga0501071_0298657	Ga0501071_0298657_139_627	160
45	3300049679	Ga0501249_036854	Ga0501249_036854_278_784	160
46	3300049705	Ga0501225_0087486	Ga0501225_0087486_216_722	160
47	3300031548	Ga0307408_100111533	Ga0307408_1001115333	161
48	3300005436	Ga0070713_100370355	Ga0070713_1003703552	162
49	3300035086	Ga0373934_0046702	Ga0373934_0046702_159_671	162
50	3300035172	Ga0373955_0316900	Ga0373955_0316900_72_584	162
51	3300036401	Ga0373937_0063140	Ga0373937_0063140_1280_1792	162
52	3300005471	Ga0070698_100041266	Ga0070698_1000412664	163
53	3300009545	Ga0105237_10540017	Ga0105237_105400172	164
54	3300025922	Ga0207646_10026668	Ga0207646_100266686	164
55	3300031995	Ga0307409_100739255	Ga0307409_1007392552	164
56	3300005328	Ga0070676_10362522	Ga0070676_103625222	166
57	3300005331	Ga0070670_100053100	Ga0070670_1000531003	166
58	3300005338	Ga0068868_100545719	Ga0068868_1005457192	166
59	3300005353	Ga0070669_100032570	Ga0070669_1000325704	166
60	3300005367	Ga0070667_101025620	Ga0070667_1010256201	166
61	3300005459	Ga0068867_100500610	Ga0068867_1005006101	166
62	3300005578	Ga0068854_100842686	Ga0068854_1008426862	166
63	3300005616	Ga0068852_101497865	Ga0068852_1014978651	166
64	3300005844	Ga0068862_100475608	Ga0068862_1004756083	166
65	3300006237	Ga0097621_100383868	Ga0097621_1003838682	166
66	3300006358	Ga0068871_100369551	Ga0068871_1003695512	166
67	3300009177	Ga0105248_10180319	Ga0105248_101803193	166
68	3300014969	Ga0157376_10226140	Ga0157376_102261403	166
69	3300025893	Ga0207682_10278018	Ga0207682_102780182	166
70	3300025925	Ga0207650_10042419	Ga0207650_100424194	166
71	3300025941	Ga0207711_10461441	Ga0207711_104614411	166
72	3300026023	Ga0207677_10298891	Ga0207677_102988912	166
73	3300026067	Ga0207678_10250281	Ga0207678_102502813	166
74	3300026088	Ga0207641_10533316	Ga0207641_105333162	166
75	3300028380	Ga0268265_10177315	Ga0268265_101773153	166
76	3300031995	Ga0307409_100737507	Ga0307409_1007375072	166
77	3300031731	Ga0307405_11001695	Ga0307405_110016951	167
78	3300031911	Ga0307412_10563695	Ga0307412_105636952	167
79	3300049592	Ga0501076_0419696	Ga0501076_0419696_201_710	167
80	3300049679	Ga0501249_029542	Ga0501249_029542_476_979	167
81	3300005331	Ga0070670_100001257	Ga0070670_10000125712	168
82	3300005344	Ga0070661_100069592	Ga0070661_1000695924	168
83	3300005366	Ga0070659_100368435	Ga0070659_1003684352	168
84	3300005549	Ga0070704_100539313	Ga0070704_1005393132	168
85	3300005618	Ga0068864_100370161	Ga0068864_1003701612	168
86	3300005840	Ga0068870_10145202	Ga0068870_101452022	168
87	3300005841	Ga0068863_101900554	Ga0068863_1019005541	168
88	3300006844	Ga0075428_100165640	Ga0075428_1001656403	168
89	3300009177	Ga0105248_11863805	Ga0105248_118638052	168
90	3300017792	Ga0163161_10120251	Ga0163161_101202513	168
91	3300025908	Ga0207643_10149400	Ga0207643_101494002	168
92	3300025920	Ga0207649_10273340	Ga0207649_102733402	168
93	3300025925	Ga0207650_10006429	Ga0207650_100064296	168
94	3300026088	Ga0207641_11070612	Ga0207641_110706121	168
95	3300026095	Ga0207676_10622998	Ga0207676_106229982	168
96	3300031548	Ga0307408_100061634	Ga0307408_1000616343	168
97	3300031548	Ga0307408_100448569	Ga0307408_1004485691	168
98	3300031731	Ga0307405_10129455	Ga0307405_101294552	168
99	3300031824	Ga0307413_10004622	Ga0307413_100046227	168
100	3300031852	Ga0307410_10045744	Ga0307410_100457442	168
101	3300031852	Ga0307410_10048560	Ga0307410_100485603	168
102	3300031852	Ga0307410_10396174	Ga0307410_103961742	168
103	3300031901	Ga0307406_10137335	Ga0307406_101373352	168
104	3300031903	Ga0307407_10016221	Ga0307407_100162213	168
105	3300031911	Ga0307412_10026265	Ga0307412_100262654	168
106	3300031911	Ga0307412_10795471	Ga0307412_107954712	168
107	3300032002	Ga0307416_100068188	Ga0307416_1000681882	168
108	3300032002	Ga0307416_100099601	Ga0307416_1000996014	168
109	3300032002	Ga0307416_100104632	Ga0307416_1001046323	168
110	3300032002	Ga0307416_100151539	Ga0307416_1001515391	168
111	3300032004	Ga0307414_10051432	Ga0307414_100514324	168
112	3300032004	Ga0307414_10443336	Ga0307414_104433362	168
113	3300032005	Ga0307411_10008706	Ga0307411_100087063	168
114	3300032126	Ga0307415_100313058	Ga0307415_1003130582	168
115	3300041486	Ga0451807_1101640	Ga0451807_1101640_251_757	168
116	3300059424	Ga0590075_006033	Ga0590075_006033_350_862	168
117	3300001977	JGI24746J21847_1000693	JGI24746J21847_10006934	169
118	3300005290	Ga0065712_10194425	Ga0065712_101944252	169
119	3300005293	Ga0065715_10106514	Ga0065715_101065143	169
120	3300005295	Ga0065707_10094176	Ga0065707_100941763	169
121	3300005328	Ga0070676_10006083	Ga0070676_100060833	169
122	3300005328	Ga0070676_10067528	Ga0070676_100675283	169
123	3300005330	Ga0070690_100598065	Ga0070690_1005980651	169
124	3300005331	Ga0070670_100966311	Ga0070670_1009663112	169
125	3300005333	Ga0070677_10028966	Ga0070677_100289663	169
126	3300005334	Ga0068869_100012842	Ga0068869_1000128424	169
127	3300005334	Ga0068869_100014179	Ga0068869_1000141793	169
128	3300005335	Ga0070666_10001736	Ga0070666_1000173610	169
129	3300005338	Ga0068868_100004581	Ga0068868_10000458110	169
130	3300005339	Ga0070660_100214767	Ga0070660_1002147672	169
131	3300005343	Ga0070687_100079347	Ga0070687_1000793473	169
132	3300005347	Ga0070668_100016357	Ga0070668_1000163575	169
133	3300005353	Ga0070669_100014927	Ga0070669_1000149273	169
134	3300005353	Ga0070669_100133221	Ga0070669_1001332212	169
135	3300005354	Ga0070675_100002921	Ga0070675_1000029215	169
136	3300005354	Ga0070675_100026216	Ga0070675_1000262166	169
137	3300005354	Ga0070675_100215920	Ga0070675_1002159202	169
138	3300005355	Ga0070671_100070690	Ga0070671_1000706904	169
139	3300005364	Ga0070673_100011279	Ga0070673_1000112796	169
140	3300005364	Ga0070673_100159277	Ga0070673_1001592772	169
141	3300005364	Ga0070673_100242581	Ga0070673_1002425813	169
142	3300005364	Ga0070673_101834115	Ga0070673_1018341151	169
143	3300005365	Ga0070688_100004862	Ga0070688_1000048624	169
144	3300005365	Ga0070688_100201352	Ga0070688_1002013523	169
145	3300005366	Ga0070659_100097980	Ga0070659_1000979802	169
146	3300005367	Ga0070667_100005771	Ga0070667_1000057714	169
147	3300005438	Ga0070701_10013819	Ga0070701_100138192	169
148	3300005444	Ga0070694_100487049	Ga0070694_1004870492	169
149	3300005455	Ga0070663_100017123	Ga0070663_1000171236	169
150	3300005456	Ga0070678_100031871	Ga0070678_1000318713	169
151	3300005456	Ga0070678_100098130	Ga0070678_1000981302	169
152	3300005457	Ga0070662_100086229	Ga0070662_1000862292	169
153	3300005459	Ga0068867_100002741	Ga0068867_10000274112	169
154	3300005459	Ga0068867_100166806	Ga0068867_1001668062	169
155	3300005466	Ga0070685_10001085	Ga0070685_1000108512	169
156	3300005466	Ga0070685_10271373	Ga0070685_102713732	169
157	3300005543	Ga0070672_100004171	Ga0070672_1000041712	169
158	3300005543	Ga0070672_100056778	Ga0070672_1000567782	169
159	3300005543	Ga0070672_100175563	Ga0070672_1001755632	169
160	3300005543	Ga0070672_100271460	Ga0070672_1002714603	169
161	3300005544	Ga0070686_100061356	Ga0070686_1000613562	169
162	3300005544	Ga0070686_100112653	Ga0070686_1001126533	169
163	3300005548	Ga0070665_100017696	Ga0070665_1000176962	169
164	3300005549	Ga0070704_100434669	Ga0070704_1004346692	169
165	3300005564	Ga0070664_100007165	Ga0070664_1000071656	169
166	3300005577	Ga0068857_100342156	Ga0068857_1003421562	169
167	3300005577	Ga0068857_101232419	Ga0068857_1012324191	169
168	3300005617	Ga0068859_100016203	Ga0068859_1000162035	169
169	3300005617	Ga0068859_100371464	Ga0068859_1003714642	169
170	3300005718	Ga0068866_10036029	Ga0068866_100360292	169
171	3300005719	Ga0068861_100061057	Ga0068861_1000610573	169
172	3300005719	Ga0068861_100075563	Ga0068861_1000755632	169
173	3300005719	Ga0068861_100994636	Ga0068861_1009946361	169
174	3300005834	Ga0068851_10007663	Ga0068851_100076634	169
175	3300005840	Ga0068870_10000427	Ga0068870_100004273	169
176	3300005840	Ga0068870_10200923	Ga0068870_102009232	169
177	3300005841	Ga0068863_100097945	Ga0068863_1000979454	169
178	3300005842	Ga0068858_100013400	Ga0068858_1000134003	169
179	3300005842	Ga0068858_100029531	Ga0068858_1000295315	169
180	3300005842	Ga0068858_100089572	Ga0068858_1000895722	169
181	3300005843	Ga0068860_100066024	Ga0068860_1000660244	169
182	3300005843	Ga0068860_100656789	Ga0068860_1006567892	169
183	3300005843	Ga0068860_101368774	Ga0068860_1013687741	169
184	3300005844	Ga0068862_100004495	Ga0068862_1000044956	169
185	3300005844	Ga0068862_100151298	Ga0068862_1001512982	169
186	3300006058	Ga0075432_10038343	Ga0075432_100383432	169
187	3300006237	Ga0097621_100323377	Ga0097621_1003233772	169
188	3300006237	Ga0097621_100589807	Ga0097621_1005898072	169
189	3300006237	Ga0097621_100641548	Ga0097621_1006415482	169
190	3300006358	Ga0068871_100057440	Ga0068871_1000574403	169
191	3300006844	Ga0075428_100000166	Ga0075428_10000016632	169
192	3300006844	Ga0075428_100043662	Ga0075428_1000436622	169
193	3300006844	Ga0075428_100144973	Ga0075428_1001449734	169
194	3300006844	Ga0075428_100425935	Ga0075428_1004259352	169
195	3300006844	Ga0075428_100588399	Ga0075428_1005883992	169
196	3300006846	Ga0075430_100003054	Ga0075430_1000030542	169
197	3300006846	Ga0075430_100007091	Ga0075430_1000070916	169
198	3300006846	Ga0075430_100046423	Ga0075430_1000464233	169
199	3300006846	Ga0075430_100248966	Ga0075430_1002489663	169
200	3300006846	Ga0075430_100430584	Ga0075430_1004305842	169
201	3300006847	Ga0075431_100001063	Ga0075431_1000010639	169
202	3300006847	Ga0075431_100007187	Ga0075431_1000071878	169
203	3300006847	Ga0075431_100091012	Ga0075431_1000910124	169
204	3300006852	Ga0075433_10006662	Ga0075433_100066624	169
205	3300006871	Ga0075434_100011195	Ga0075434_1000111954	169
206	3300006880	Ga0075429_100006130	Ga0075429_1000061305	169
207	3300006880	Ga0075429_100017594	Ga0075429_1000175946	169
208	3300006880	Ga0075429_100022337	Ga0075429_1000223375	169
209	3300006880	Ga0075429_100466060	Ga0075429_1004660602	169
210	3300006881	Ga0068865_100122026	Ga0068865_1001220263	169
211	3300006881	Ga0068865_100567786	Ga0068865_1005677862	169
212	3300006931	Ga0097620_100016204	Ga0097620_1000162045	169
213	3300006931	Ga0097620_100371467	Ga0097620_1003714672	169
214	3300007076	Ga0075435_100056721	Ga0075435_1000567212	169
215	3300009094	Ga0111539_10006794	Ga0111539_100067943	169
216	3300009094	Ga0111539_10181412	Ga0111539_101814123	169
217	3300009147	Ga0114129_10055617	Ga0114129_100556172	169
218	3300009147	Ga0114129_10756408	Ga0114129_107564082	169
219	3300009176	Ga0105242_10002200	Ga0105242_100022003	169
220	3300009177	Ga0105248_10164602	Ga0105248_101646023	169
221	3300009177	Ga0105248_10568904	Ga0105248_105689042	169
222	3300009177	Ga0105248_10636363	Ga0105248_106363633	169
223	3300009177	Ga0105248_10784972	Ga0105248_107849722	169
224	3300009553	Ga0105249_10002282	Ga0105249_100022828	169
225	3300011119	Ga0105246_10008930	Ga0105246_100089304	169
226	3300013102	Ga0157371_10136221	Ga0157371_101362212	169
227	3300013306	Ga0163162_10001129	Ga0163162_100011299	169
228	3300013306	Ga0163162_10334418	Ga0163162_103344182	169
229	3300013308	Ga0157375_10425344	Ga0157375_104253442	169
230	3300014325	Ga0163163_10086930	Ga0163163_100869303	169
231	3300014325	Ga0163163_10385144	Ga0163163_103851442	169
232	3300014325	Ga0163163_11908203	Ga0163163_119082031	169
233	3300014326	Ga0157380_10029839	Ga0157380_100298392	169
234	3300014326	Ga0157380_10344982	Ga0157380_103449822	169
235	3300014326	Ga0157380_10465960	Ga0157380_104659601	169
236	3300014326	Ga0157380_10755515	Ga0157380_107555152	169
237	3300014745	Ga0157377_10260082	Ga0157377_102600822	169
238	3300014745	Ga0157377_10317905	Ga0157377_103179052	169
239	3300014968	Ga0157379_10016196	Ga0157379_100161963	169
240	3300017792	Ga0163161_10001928	Ga0163161_1000192812	169
241	3300017792	Ga0163161_10271877	Ga0163161_102718772	169
242	3300025315	Ga0207697_10001326	Ga0207697_1000132614	169
243	3300025321	Ga0207656_10009654	Ga0207656_100096544	169
244	3300025893	Ga0207682_10006149	Ga0207682_100061494	169
245	3300025893	Ga0207682_10015097	Ga0207682_100150973	169
246	3300025899	Ga0207642_10314247	Ga0207642_103142472	169
247	3300025901	Ga0207688_10000947	Ga0207688_1000094711	169
248	3300025901	Ga0207688_10062722	Ga0207688_100627223	169
249	3300025903	Ga0207680_10711168	Ga0207680_107111681	169
250	3300025907	Ga0207645_10000611	Ga0207645_100006112	169
251	3300025907	Ga0207645_10006074	Ga0207645_100060743	169
252	3300025907	Ga0207645_10219088	Ga0207645_102190883	169
253	3300025908	Ga0207643_10000068	Ga0207643_1000006843	169
254	3300025908	Ga0207643_10062260	Ga0207643_100622603	169
255	3300025908	Ga0207643_10153803	Ga0207643_101538032	169
256	3300025918	Ga0207662_10065342	Ga0207662_100653423	169
257	3300025919	Ga0207657_10189624	Ga0207657_101896243	169
258	3300025923	Ga0207681_10027526	Ga0207681_100275262	169
259	3300025923	Ga0207681_10119372	Ga0207681_101193722	169
260	3300025923	Ga0207681_10122034	Ga0207681_101220342	169
261	3300025924	Ga0207694_10003599	Ga0207694_1000359911	169
262	3300025925	Ga0207650_10752155	Ga0207650_107521552	169
263	3300025926	Ga0207659_10015134	Ga0207659_100151343	169
264	3300025926	Ga0207659_10028375	Ga0207659_100283752	169
265	3300025926	Ga0207659_10134260	Ga0207659_101342602	169
266	3300025927	Ga0207687_10606449	Ga0207687_106064492	169
267	3300025931	Ga0207644_10058758	Ga0207644_100587583	169
268	3300025931	Ga0207644_10159315	Ga0207644_101593152	169
269	3300025932	Ga0207690_10857186	Ga0207690_108571861	169
270	3300025933	Ga0207706_10002047	Ga0207706_100020474	169
271	3300025935	Ga0207709_10134150	Ga0207709_101341503	169
272	3300025936	Ga0207670_10185908	Ga0207670_101859082	169
273	3300025940	Ga0207691_10004937	Ga0207691_100049372	169
274	3300025940	Ga0207691_10082133	Ga0207691_100821333	169
275	3300025940	Ga0207691_10159706	Ga0207691_101597061	169
276	3300025942	Ga0207689_10000219	Ga0207689_1000021929	169
277	3300025942	Ga0207689_10005878	Ga0207689_100058783	169
278	3300025942	Ga0207689_10123222	Ga0207689_101232223	169
279	3300025942	Ga0207689_10279594	Ga0207689_102795942	169
280	3300025942	Ga0207689_10585203	Ga0207689_105852032	169
281	3300025945	Ga0207679_10002803	Ga0207679_100028037	169
282	3300025945	Ga0207679_10544372	Ga0207679_105443722	169
283	3300025945	Ga0207679_11140019	Ga0207679_111400192	169
284	3300025960	Ga0207651_10123456	Ga0207651_101234563	169
285	3300025960	Ga0207651_10162445	Ga0207651_101624452	169
286	3300025960	Ga0207651_10634818	Ga0207651_106348182	169
287	3300025972	Ga0207668_10177622	Ga0207668_101776223	169
288	3300025986	Ga0207658_10019228	Ga0207658_100192284	169
289	3300025986	Ga0207658_10639172	Ga0207658_106391722	169
290	3300026023	Ga0207677_10116487	Ga0207677_101164873	169
291	3300026035	Ga0207703_10042138	Ga0207703_100421384	169
292	3300026035	Ga0207703_10056658	Ga0207703_100566583	169
293	3300026035	Ga0207703_10947016	Ga0207703_109470162	169
294	3300026067	Ga0207678_10009882	Ga0207678_100098827	169
295	3300026067	Ga0207678_10026465	Ga0207678_100264656	169
296	3300026075	Ga0207708_10018007	Ga0207708_100180073	169
297	3300026089	Ga0207648_10000660	Ga0207648_1000066024	169
298	3300026089	Ga0207648_10015486	Ga0207648_100154863	169
299	3300026095	Ga0207676_10122443	Ga0207676_101224433	169
300	3300026116	Ga0207674_10179889	Ga0207674_101798893	169
301	3300026116	Ga0207674_10346065	Ga0207674_103460652	169
302	3300026118	Ga0207675_100004566	Ga0207675_10000456614	169
303	3300026118	Ga0207675_100067041	Ga0207675_1000670413	169
304	3300026121	Ga0207683_10009806	Ga0207683_100098063	169
305	3300026121	Ga0207683_10102149	Ga0207683_101021493	169
306	3300027552	Ga0209982_1017618	Ga0209982_10176182	169
307	3300027907	Ga0207428_10000977	Ga0207428_1000097710	169
308	3300027907	Ga0207428_10022626	Ga0207428_100226263	169
309	3300027907	Ga0207428_10468299	Ga0207428_104682992	169
310	3300028379	Ga0268266_10091960	Ga0268266_100919601	169
311	3300028380	Ga0268265_10020424	Ga0268265_100204245	169
312	3300028380	Ga0268265_10916400	Ga0268265_109164002	169
313	3300028381	Ga0268264_10219545	Ga0268264_102195452	169
314	3300031548	Ga0307408_100528987	Ga0307408_1005289872	169
315	3300031911	Ga0307412_10153180	Ga0307412_101531802	169
316	3300034818	Ga0373950_0031557	Ga0373950_0031557_393_902	169
317	3300035114	Ga0373939_0082462	Ga0373939_0082462_486_995	169
318	3300035121	Ga0373960_0039529	Ga0373960_0039529_415_924	169
319	3300035172	Ga0373955_0139077	Ga0373955_0139077_288_803	169
320	3300035242	Ga0373962_0059841	Ga0373962_0059841_532_1041	169
321	3300035691	Ga0373931_0074434	Ga0373931_0074434_1056_1565	169
322	3300036401	Ga0373937_0017411	Ga0373937_0017411_3373_3888	169
323	3300041406	Ga0439439_0144198	Ga0439439_0144198_52_567	169
324	3300042156	Ga0439446_0075925	Ga0439446_0075925_104_619	169
325	3300044673	Ga0453683_0560654	Ga0453683_0560654_68_589	169
326	3300045051	Ga0451576_0089653	Ga0451576_0089653_1133_1642	169
327	3300046472	Ga0495580_0305448	Ga0495580_0305448_117_632	169
328	3300046476	Ga0495662_0269946	Ga0495662_0269946_13_528	169
329	3300046689	Ga0495613_0010825	Ga0495613_0010825_3219_3734	169
330	3300048916	Ga0496113_0315336	Ga0496113_0315336_463_972	169
331	3300049589	Ga0501073_1035008	Ga0501073_1035008_21_530	169
332	3300049592	Ga0501076_0251206	Ga0501076_0251206_810_1334	169
333	3300050507	nmdc:mga05p37_705840_c1	nmdc:mga05p37_705840_c1_312_830	169
334	3300050508	nmdc:mga09592_144478_c1	nmdc:mga09592_144478_c1_485_994	169
335	3300050508	nmdc:mga09592_34457_c1	nmdc:mga09592_34457_c1_2717_3226	169
336	3300050508	nmdc:mga09592_808526_c1	nmdc:mga09592_808526_c1_26_559	169
337	3300050509	nmdc:mga0qj67_11606_c1	nmdc:mga0qj67_11606_c1_265_798	169
338	3300050509	nmdc:mga0qj67_72093_c1	nmdc:mga0qj67_72093_c1_157_666	169
339	3300050509	nmdc:mga0qj67_815306_c1	nmdc:mga0qj67_815306_c1_100_609	169
340	3300050509	nmdc:mga0qj67_86730_c1	nmdc:mga0qj67_86730_c1_175_693	169
341	3300050510	nmdc:mga06r32_1768_c1	nmdc:mga06r32_1768_c1_15891_16400	169
342	3300050510	nmdc:mga06r32_446114_c1	nmdc:mga06r32_446114_c1_75_584	169
343	3300050511	nmdc:mga08y16_360473_c1	nmdc:mga08y16_360473_c1_274_783	169
344	3300050511	nmdc:mga08y16_386151_c1	nmdc:mga08y16_386151_c1_867_1376	169
345	3300050511	nmdc:mga08y16_44058_c1	nmdc:mga08y16_44058_c1_3583_4101	169
346	3300050512	nmdc:mga0n895_6276_c1	nmdc:mga0n895_6276_c1_4885_5394	169
347	3300050512	nmdc:mga0n895_671829_c1	nmdc:mga0n895_671829_c1_240_755	169
348	3300050513	nmdc:mga0rr50_107185_c1	nmdc:mga0rr50_107185_c1_315_830	169
349	3300050513	nmdc:mga0rr50_44215_c1	nmdc:mga0rr50_44215_c1_97_606	169
350	3300050515	nmdc:mga0a205_1229_c1	nmdc:mga0a205_1229_c1_8620_9129	169
351	3300013105	Ga0157369_10227495	Ga0157369_102274952	173
352	3300002155	JGI24033J26618_1002985	JGI24033J26618_10029852	175
353	3300005290	Ga0065712_10011901	Ga0065712_100119014	175
354	3300005328	Ga0070676_10250029	Ga0070676_102500291	175
355	3300005330	Ga0070690_100128791	Ga0070690_1001287912	175
356	3300005331	Ga0070670_100022864	Ga0070670_1000228644	175
357	3300005333	Ga0070677_10015211	Ga0070677_100152113	175
358	3300005333	Ga0070677_10032824	Ga0070677_100328243	175
359	3300005335	Ga0070666_10011237	Ga0070666_100112376	175
360	3300005340	Ga0070689_100109452	Ga0070689_1001094523	175
361	3300005347	Ga0070668_100428361	Ga0070668_1004283612	175
362	3300005353	Ga0070669_100111824	Ga0070669_1001118242	175
363	3300005354	Ga0070675_100252023	Ga0070675_1002520232	175
364	3300005356	Ga0070674_100000032	Ga0070674_10000003222	175
365	3300005365	Ga0070688_100160971	Ga0070688_1001609713	175
366	3300005366	Ga0070659_100190841	Ga0070659_1001908413	175
367	3300005441	Ga0070700_100078548	Ga0070700_1000785483	175
368	3300005457	Ga0070662_100030484	Ga0070662_1000304844	175
369	3300005459	Ga0068867_100068939	Ga0068867_1000689393	175
370	3300005459	Ga0068867_100069053	Ga0068867_1000690532	175
371	3300005466	Ga0070685_10079263	Ga0070685_100792633	175
372	3300005543	Ga0070672_100035995	Ga0070672_1000359954	175
373	3300005564	Ga0070664_100268023	Ga0070664_1002680232	175
374	3300005577	Ga0068857_100178940	Ga0068857_1001789402	175
375	3300005618	Ga0068864_100725090	Ga0068864_1007250902	175
376	3300005718	Ga0068866_10088735	Ga0068866_100887353	175
377	3300005842	Ga0068858_100796180	Ga0068858_1007961802	175
378	3300006881	Ga0068865_100274929	Ga0068865_1002749292	175
379	3300009094	Ga0111539_10116693	Ga0111539_101166934	175
380	3300009148	Ga0105243_10316625	Ga0105243_103166252	175
381	3300009176	Ga0105242_10320176	Ga0105242_103201762	175
382	3300009177	Ga0105248_10815657	Ga0105248_108156572	175
383	3300013297	Ga0157378_10699366	Ga0157378_106993662	175
384	3300013306	Ga0163162_10208037	Ga0163162_102080373	175
385	3300013308	Ga0157375_10090851	Ga0157375_100908513	175
386	3300014325	Ga0163163_10111093	Ga0163163_101110932	175
387	3300025893	Ga0207682_10003365	Ga0207682_100033657	175
388	3300025893	Ga0207682_10066628	Ga0207682_100666282	175
389	3300025901	Ga0207688_10046958	Ga0207688_100469582	175
390	3300025903	Ga0207680_10031310	Ga0207680_100313102	175
391	3300025907	Ga0207645_10044764	Ga0207645_100447642	175
392	3300025908	Ga0207643_10002646	Ga0207643_100026464	175
393	3300025923	Ga0207681_10253635	Ga0207681_102536352	175
394	3300025925	Ga0207650_10092874	Ga0207650_100928743	175
395	3300025926	Ga0207659_10048077	Ga0207659_100480773	175
396	3300025933	Ga0207706_10007978	Ga0207706_100079784	175
397	3300025935	Ga0207709_10376477	Ga0207709_103764772	175
398	3300025937	Ga0207669_10001787	Ga0207669_100017873	175
399	3300025940	Ga0207691_10014496	Ga0207691_100144964	175
400	3300025940	Ga0207691_10554318	Ga0207691_105543182	175
401	3300025960	Ga0207651_10289959	Ga0207651_102899592	175
402	3300025986	Ga0207658_10285338	Ga0207658_102853382	175
403	3300026035	Ga0207703_10723762	Ga0207703_107237622	175
404	3300026075	Ga0207708_10062064	Ga0207708_100620644	175
405	3300026089	Ga0207648_10090507	Ga0207648_100905073	175
406	3300026095	Ga0207676_10400104	Ga0207676_104001042	175
407	3300026116	Ga0207674_10352083	Ga0207674_103520833	175
408	3300026118	Ga0207675_100040575	Ga0207675_1000405754	175
409	3300027907	Ga0207428_10352922	Ga0207428_103529222	175
410	3300028381	Ga0268264_10499116	Ga0268264_104991162	175
411	3300031731	Ga0307405_11396681	Ga0307405_113966811	175
412	3300032005	Ga0307411_10941140	Ga0307411_109411402	175
413	3300046537	Ga0495598_0105753	Ga0495598_0105753_80_607	175
414	3300059421	Ga0590071_001004	Ga0590071_001004_4531_5064	175
415	3300059421	Ga0590071_043777	Ga0590071_043777_401_934	175
416	3300059423	Ga0590074_005958	Ga0590074_005958_1202_1735	175
417	3300005353	Ga0070669_100272010	Ga0070669_1002720102	176
418	3300005617	Ga0068859_100205677	Ga0068859_1002056772	176
419	3300005840	Ga0068870_10052460	Ga0068870_100524602	176
420	3300005844	Ga0068862_101146599	Ga0068862_1011465992	176
421	3300006931	Ga0097620_100205658	Ga0097620_1002056582	176
422	3300009094	Ga0111539_10904083	Ga0111539_109040831	176
423	3300009551	Ga0105238_10013406	Ga0105238_100134065	176
424	3300025918	Ga0207662_10081195	Ga0207662_100811953	176
425	3300025923	Ga0207681_10235329	Ga0207681_102353293	176
426	3300025931	Ga0207644_10324739	Ga0207644_103247391	176
427	3300025936	Ga0207670_10164159	Ga0207670_101641593	176
428	3300026121	Ga0207683_10069383	Ga0207683_100693834	176
429	3300050515	nmdc:mga0a205_911927_c1	nmdc:mga0a205_911927_c1_35_571	176
430	3300005438	Ga0070701_10110757	Ga0070701_101107572	177
431	3300005438	Ga0070701_10604098	Ga0070701_106040981	177
432	3300005441	Ga0070700_100055302	Ga0070700_1000553022	177
433	3300005444	Ga0070694_100418613	Ga0070694_1004186131	177
434	3300005615	Ga0070702_100093511	Ga0070702_1000935112	177
435	3300009094	Ga0111539_10002366	Ga0111539_1000236610	180
436	3300009098	Ga0105245_10501296	Ga0105245_105012962	180
437	3300013308	Ga0157375_10042456	Ga0157375_100424562	180
438	3300014326	Ga0157380_10026746	Ga0157380_100267463	180
439	3300014745	Ga0157377_10003595	Ga0157377_100035955	180
440	3300014969	Ga0157376_10025552	Ga0157376_100255524	180
441	2162886012	MBSR1b_contig_7035149	MBSR1b_0721.00001760	185
442	3300013296	Ga0157374_10232619	Ga0157374_102326192	185
443	3300042439	Ga0439464_0030429	Ga0439464_0030429_200_757	185
444	3300050508	nmdc:mga09592_21599_c1	nmdc:mga09592_21599_c1_1756_2313	185
445	3300050509	nmdc:mga0qj67_2209_c1	nmdc:mga0qj67_2209_c1_2741_3298	185

Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6n7y-assembly1.cif.gz_F-2	crystal structure of human fpps in complex with an allosteric inhibitor mit-01-102	0.2424	95	167
4rhp-assembly1.cif.gz_B	crystal structure of human coq9 in complex with a phospholipid, northeast structural genomics consortium target hr5043	0.2261	33	184
4gba-assembly2.cif.gz_B	dcnl complex with n-terminally acetylated nedd8 e2 peptide	0.2159	24	169
6hs1-assembly1.cif.gz_B	ethr2 in complex with compound 9 (bdm76060)	0.2127	53	184
4yxx-assembly1.cif.gz_A	computationally designed left-handed alpha/alpha toroid with 6 repeats	0.2067	33	182

ID	Description	Score	Start	End	Superfamily
af_Q8INF0_1_188_3.90.1520.10	Alpha Beta;Alpha-Beta Complex;H-NOX domain;H-NOX domain	0.408	99	173	3.90.1520.10
3p7nB02	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.3763	25	102	1.10.10.10
af_I1MLF3_444_633_1.25.40.10	Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain	0.3559	95	184	1.25.40.10
3p7nB02	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.3378	25	102	1.10.10.10
af_Q10NT7_120_228_1.25.40.10	Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain	0.3056	96	184	1.25.40.10

ID	Description	Score	Start	End
AF-A0A521TC89-F1-model_v4	Uncharacterized protein	0.9672	24	184
AF-A0A1F2U2G6-F1-model_v4	Uncharacterized protein	0.9648	33	180
AF-A0A2W4RWJ5-F1-model_v4	Uncharacterized protein	0.9561	33	175
AF-A0A2V7UHB1-F1-model_v4	Uncharacterized protein	0.9487	74	175
AF-A0A2V8CXT5-F1-model_v4	Uncharacterized protein	0.9472	26	175

Feature Viewer

pLDDT	pTM	Quality
86.99	0.81	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F445502

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map