F445545

General Info

Members Datasets Scaffolds Average Seq Length
445 310 890 151

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0102631|Ga0395900_0102631_2390_2839
Length 143
Sequence MKKTKQVKVKIVNKSNNDLPAYETKGAAGMDVKAHLDAPFEIPSGYSSIIPTGLYVEIQLRARSGLAAKNLIALTNGLGTLDEDFRGEIKVMLINHGNVPFVVDPGMRIGQMVLNKIDKIEWVPTDELSATERGEGGLGSTGA

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
93 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
94 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
95 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
96 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
97 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
98 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
152 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
158 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
159 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
160 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
161 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
162 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
163 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
164 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
165 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
166 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
167 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
173 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
174 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
175 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
176 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
177 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
178 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
179 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
180 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
181 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
182 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
183 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
184 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
185 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
186 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
187 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
188 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
194 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
195 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
196 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
197 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
198 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
199 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
206 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
211 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
216 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
230 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
231 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
232 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
233 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
234 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
235 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
236 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
237 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
238 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
239 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
240 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
241 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
242 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
243 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
244 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
245 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
246 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
247 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
248 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
249 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
250 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
251 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
252 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
253 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
254 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
255 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
256 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
257 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
258 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
259 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
260 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
261 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
262 2738541293 Rhizobium sp. GV031 Isolate Unclassified
263 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
264 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
265 2791355256 Rhizobium sp. M10 Isolate Nodule
266 2791355263 Rhizobium chutanense C5 Isolate Nodule
267 2791355267 Rhizobium sp. L18 Isolate Nodule
268 2802429634 Rhizobium anhuiense S10 Isolate Nodule
269 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
270 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
271 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
272 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
273 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
274 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
275 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
276 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
277 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
278 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
279 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
280 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
281 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
282 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
283 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
284 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
285 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
286 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
287 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
288 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
289 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
290 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
291 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
292 2996887358 Rhizobium sp. R711 Isolate Nodule
293 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
294 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
295 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
296 8005258706 Rhizobium sp. R693 Isolate Nodule
297 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
298 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
299 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
300 8005321885 Rhizobium sp. R72 Isolate Nodule
301 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
302 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
303 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
304 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
305 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
306 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
307 8024501048 Rhizobium sp. H4 Isolate Nodule
308 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
309 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
310 8056382006 Rhizobium croatiense 13T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.6
Metatranscriptomes 0.22
Isolates 16.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.63
Nodule 8.31
Rhizoplane 1.57
Rhizosphere 60.9
Stem 0
Stem Tuber 0
Unclassified 10.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0102631 3300037418 Bacteria 2938
2 ARcpr5yngRDRAFT_c012833 3300000043 Bacteria 705
3 JGI25162J39368_1000493 3300002737 Bacteria 29984
4 JGI25152J39213_1000743 3300002773 Bacteria 16653
5 JGI25152J39213_1001460 3300002773 Bacteria 10132
6 JGI25152J39213_1003337 3300002773 Bacteria 5524
7 JGI25152J39213_1029496 3300002773 Bacteria 862
8 JGI25150J39212_1000133 3300002774 Bacteria 41648
9 JGI25151J46595_10000407 3300003187 Bacteria 44348
10 JGI25151J46595_10002323 3300003187 Bacteria 11598
11 JGI25165J46597_1000796 3300003214 Bacteria 23932
12 JGI25153J46596_10002013 3300003215 Bacteria 11994
13 JGI25153J46596_10075020 3300003215 Bacteria 862
14 rootH1_10034300 3300003316 Bacteria 1935
15 rootL2_10050649 3300003322 Bacteria 5550
16 rootH1_10200700 3300003323 Bacteria 2835
17 JGI25160J50197_1009478 3300003354 Bacteria 3606
18 Ga0055526_1040511 3300003771 Bacteria 1173
19 Ga0055524_1023458 3300003775 Bacteria 1985
20 Ga0055528_1002689 3300003790 Bacteria 9379
21 Ga0055540_1007243 3300003792 Bacteria 4233
22 Ga0055540_1029678 3300003792 Bacteria 1278
23 Ga0055531_10001575 3300003794 Bacteria 16679
24 Ga0055531_10026640 3300003794 Bacteria 2054
25 Ga0065714_10212312 3300005288 Bacteria 800
26 Ga0065704_10010082 3300005289 Bacteria 1848
27 Ga0065704_10207556 3300005289 Bacteria 1121
28 Ga0065712_10005542 3300005290 Bacteria 5301
29 Ga0065712_10087624 3300005290 Unclassified 2563
30 Ga0065712_10210418 3300005290 Bacteria 1075
31 Ga0065715_10270355 3300005293 Bacteria 1100
32 Ga0070690_100525417 3300005330 Unclassified 889
33 Ga0070670_100000091 3300005331 Bacteria 85664
34 Ga0070670_100687087 3300005331 Bacteria 920
35 Ga0068869_100035136 3300005334 Bacteria 3551
36 Ga0070660_101519868 3300005339 Unclassified 569
37 Ga0070689_100016482 3300005340 Bacteria 5408
38 Ga0070687_100008500 3300005343 Bacteria 4355
39 Ga0070687_100407069 3300005343 Bacteria 894
40 Ga0070668_100086074 3300005347 Bacteria 2471
41 Ga0070668_100141330 3300005347 Unclassified 1940
42 Ga0070669_100076873 3300005353 Bacteria 2479
43 Ga0070675_100021615 3300005354 Bacteria 5141
44 Ga0070671_100003867 3300005355 Bacteria 11774
45 Ga0070671_100733719 3300005355 Bacteria 858
46 Ga0070671_101525909 3300005355 Bacteria 591
47 Ga0070673_100009066 3300005364 Bacteria 6660
48 Ga0070673_100075464 3300005364 Bacteria 2719
49 Ga0070688_100176276 3300005365 Bacteria 1479
50 Ga0070667_100335421 3300005367 Unclassified 1367
51 Ga0070701_10021279 3300005438 Bacteria 3092
52 Ga0070700_100318903 3300005441 Bacteria 1141
53 Ga0070708_100369019 3300005445 Bacteria 1353
54 Ga0070663_100994012 3300005455 Bacteria 729
55 Ga0070678_101342420 3300005456 Bacteria 666
56 Ga0068867_100161210 3300005459 Bacteria 1768
57 Ga0070685_10020526 3300005466 Bacteria 3575
58 Ga0070685_10235800 3300005466 Bacteria 1205
59 Ga0070685_10865866 3300005466 Bacteria 670
60 Ga0070707_100156642 3300005468 Bacteria 2219
61 Ga0070698_100002644 3300005471 Bacteria 19745
62 Ga0070698_100003140 3300005471 Bacteria 18206
63 Ga0068853_100044976 3300005539 Bacteria 3781
64 Ga0068853_100404857 3300005539 Bacteria 1278
65 Ga0068853_100591248 3300005539 Bacteria 1054
66 Ga0070672_100014892 3300005543 Bacteria 5521
67 Ga0070672_100148999 3300005543 Bacteria 1935
68 Ga0070686_100512501 3300005544 Bacteria 932
69 Ga0070702_100441276 3300005615 Unclassified 942
70 Ga0068859_100042974 3300005617 Bacteria 4541
71 Ga0068859_100636903 3300005617 Bacteria 1158
72 Ga0068859_100639075 3300005617 Bacteria 1156
73 Ga0068864_100024227 3300005618 Bacteria 5104
74 Ga0068864_100456673 3300005618 Bacteria 1222
75 Ga0068861_100017009 3300005719 Bacteria 5157
76 Ga0068861_100405084 3300005719 Bacteria 1211
77 Ga0068870_10214115 3300005840 Unclassified 1175
78 Ga0068863_100247361 3300005841 Bacteria 1722
79 Ga0068858_101820291 3300005842 Bacteria 602
80 Ga0068860_100236918 3300005843 Bacteria 1774
81 Ga0068862_100049946 3300005844 Bacteria 3573
82 Ga0081539_10025497 3300005985 Bacteria 3806
83 Ga0075365_10108567 3300006038 Bacteria 1905
84 Ga0070716_100370555 3300006173 Bacteria 1020
85 Ga0075367_10289293 3300006178 Bacteria 1031
86 Ga0075369_10048984 3300006186 Bacteria 1824
87 Ga0097621_100009542 3300006237 Bacteria 7050
88 Ga0097621_100042351 3300006237 Bacteria 3667
89 Ga0097621_100760325 3300006237 Unclassified 896
90 Ga0097621_101285676 3300006237 Bacteria 691
91 Ga0075370_10226503 3300006353 Bacteria 1106
92 Ga0068871_100036503 3300006358 Bacteria 3913
93 Ga0068871_100037537 3300006358 Bacteria 3864
94 Ga0068871_100101223 3300006358 Bacteria 2415
95 Ga0068871_100628534 3300006358 Bacteria 978
96 Ga0075428_100075397 3300006844 Unclassified 3683
97 Ga0075428_100097080 3300006844 Bacteria 3212
98 Ga0075430_100012472 3300006846 Bacteria 7233
99 Ga0075430_100664657 3300006846 Bacteria 859
100 Ga0075431_100426267 3300006847 Unclassified 1325
101 Ga0075429_100284717 3300006880 Unclassified 1447
102 Ga0075429_100526572 3300006880 Unclassified 1036
103 Ga0068865_100028133 3300006881 Bacteria 3721
104 Ga0068865_100342342 3300006881 Unclassified 1209
105 Ga0075436_100163806 3300006914 Bacteria 1568
106 Ga0097620_100042973 3300006931 Bacteria 4541
107 Ga0097620_100636897 3300006931 Bacteria 1158
108 Ga0097620_100639095 3300006931 Bacteria 1156
109 Ga0105251_10027975 3300009011 Bacteria 2852
110 Ga0105250_10063384 3300009092 Bacteria 1488
111 Ga0111539_10170553 3300009094 Unclassified 2542
112 Ga0111539_10189744 3300009094 Bacteria 2398
113 Ga0111539_10239779 3300009094 Bacteria 2111
114 Ga0111539_10277408 3300009094 Bacteria 1951
115 Ga0114129_10229757 3300009147 Bacteria 2499
116 Ga0114129_10578147 3300009147 Unclassified 1458
117 Ga0105243_10474893 3300009148 Unclassified 1179
118 Ga0105242_10042423 3300009176 Bacteria 3674
119 Ga0105242_10205131 3300009176 Bacteria 1753
120 Ga0105248_10042219 3300009177 Bacteria 5114
121 Ga0105249_10003042 3300009553 Bacteria 14469
122 Ga0105249_10026771 3300009553 Bacteria 5200
123 Ga0105249_10270229 3300009553 Bacteria 1693
124 Ga0105249_10434395 3300009553 Bacteria 1349
125 Ga0123341_1000036 3300009765 Bacteria 61619
126 Ga0105246_10020008 3300011119 Bacteria 4290
127 Ga0105246_10113927 3300011119 Bacteria 1991
128 Ga0157369_10839758 3300013105 Bacteria 943
129 Ga0157374_10318967 3300013296 Unclassified 1540
130 Ga0157374_11127496 3300013296 Bacteria 805
131 Ga0163162_10469779 3300013306 Unclassified 1389
132 Ga0157375_10189326 3300013308 Bacteria 2212
133 Ga0157375_10344866 3300013308 Unclassified 1655
134 Ga0157375_10356031 3300013308 Unclassified 1630
135 Ga0157375_10389020 3300013308 Unclassified 1561
136 Ga0157375_10773537 3300013308 Unclassified 1110
137 Ga0163163_10619528 3300014325 Bacteria 1146
138 Ga0163163_10658835 3300014325 Bacteria 1110
139 Ga0157380_10311099 3300014326 Unclassified 1456
140 Ga0157377_10133660 3300014745 Bacteria 1518
141 Ga0157379_10182220 3300014968 Unclassified 1897
142 Ga0157376_11969324 3300014969 Bacteria 622
143 Ga0163161_10027259 3300017792 Unclassified 4052
144 Ga0163161_10377924 3300017792 Unclassified 1132
145 Ga0163161_10434062 3300017792 Bacteria 1059
146 Ga0209760_103230 3300025207 Bacteria 1459
147 Ga0209436_100113 3300025208 Bacteria 39873
148 Ga0209437_100056 3300025233 Bacteria 363071
149 Ga0207425_1000667 3300025245 Bacteria 18861
150 Ga0207425_1004807 3300025245 Bacteria 3972
151 Ga0209646_1015114 3300025246 Bacteria 1155
152 Ga0209129_1000066 3300025258 Bacteria 226820
153 Ga0209129_1000308 3300025258 Bacteria 44371
154 Ga0209129_1002211 3300025258 Bacteria 9762
155 Ga0209129_1002705 3300025258 Bacteria 8319
156 Ga0209233_1000071 3300025261 Bacteria 363290
157 Ga0209673_1000988 3300025273 Bacteria 34774
158 Ga0209673_1004038 3300025273 Bacteria 8126
159 Ga0209673_1006953 3300025273 Bacteria 5340
160 Ga0209673_1018093 3300025273 Bacteria 2575
161 Ga0209673_1047099 3300025273 Bacteria 1171
162 Ga0209130_1000002 3300025284 Bacteria 722648
163 Ga0209130_1018986 3300025284 Bacteria 1604
164 Ga0209676_1003075 3300025292 Bacteria 10755
165 Ga0209025_1000557 3300025294 Bacteria 69226
166 Ga0209025_1000919 3300025294 Bacteria 45324
167 Ga0209025_1005917 3300025294 Bacteria 9753
168 Ga0209564_1000683 3300025295 Bacteria 50090
169 Ga0209564_1006727 3300025295 Bacteria 6111
170 Ga0209564_1052634 3300025295 Bacteria 977
171 Ga0209758_1000170 3300025297 Bacteria 149476
172 Ga0209758_1000788 3300025297 Bacteria 45324
173 Ga0209758_1001755 3300025297 Bacteria 24062
174 Ga0209050_1006027 3300025298 Bacteria 7343
175 Ga0209050_1015290 3300025298 Bacteria 3234
176 Ga0209256_1002512 3300025299 Bacteria 14748
177 Ga0209256_1003658 3300025299 Bacteria 10515
178 Ga0209256_1018650 3300025299 Bacteria 2242
179 Ga0209256_1037320 3300025299 Bacteria 1267
180 Ga0207426_1000013 3300025302 Bacteria 721897
181 Ga0207426_1004630 3300025302 Bacteria 6616
182 Ga0209051_1000228 3300025303 Bacteria 94166
183 Ga0209051_1001851 3300025303 Bacteria 16666
184 Ga0209257_1000940 3300025304 Bacteria 40225
185 Ga0209257_1004192 3300025304 Bacteria 11433
186 Ga0207697_10228950 3300025315 Bacteria 821
187 Ga0207713_1063648 3300025735 Bacteria 1392
188 Ga0207682_10015427 3300025893 Bacteria 2973
189 Ga0207642_10345929 3300025899 Unclassified 876
190 Ga0207685_10015439 3300025905 Unclassified 2419
191 Ga0207643_10002549 3300025908 Bacteria 9869
192 Ga0207662_10007225 3300025918 Bacteria 6041
193 Ga0207650_10000723 3300025925 Bacteria 25614
194 Ga0207650_10167270 3300025925 Bacteria 1745
195 Ga0207659_10090572 3300025926 Bacteria 2283
196 Ga0207644_11040420 3300025931 Bacteria 688
197 Ga0207686_10012010 3300025934 Bacteria 4755
198 Ga0207670_10244561 3300025936 Unclassified 1384
199 Ga0207704_10039803 3300025938 Bacteria 2741
200 Ga0207691_10014368 3300025940 Bacteria 7548
201 Ga0207691_10057710 3300025940 Bacteria 3532
202 Ga0207711_10244857 3300025941 Bacteria 1645
203 Ga0207689_10051080 3300025942 Bacteria 3408
204 Ga0207651_10023670 3300025960 Bacteria 3784
205 Ga0207651_10374285 3300025960 Bacteria 1205
206 Ga0207651_10377649 3300025960 Bacteria 1200
207 Ga0207712_10001318 3300025961 Bacteria 17023
208 Ga0207712_10129870 3300025961 Unclassified 1918
209 Ga0207712_11392963 3300025961 Bacteria 627
210 Ga0207668_10045656 3300025972 Bacteria 2989
211 Ga0207658_10061485 3300025986 Bacteria 2807
212 Ga0207677_10137204 3300026023 Bacteria 1867
213 Ga0207677_10848027 3300026023 Bacteria 821
214 Ga0207703_11591626 3300026035 Bacteria 629
215 Ga0207639_10031985 3300026041 Bacteria 3870
216 Ga0207639_10246829 3300026041 Bacteria 1555
217 Ga0207678_10135501 3300026067 Bacteria 2101
218 Ga0207708_10018473 3300026075 Bacteria 5251
219 Ga0207708_10731088 3300026075 Bacteria 848
220 Ga0207641_10006210 3300026088 Bacteria 10104
221 Ga0207641_11354276 3300026088 Bacteria 712
222 Ga0207648_10142193 3300026089 Unclassified 2115
223 Ga0207676_10265672 3300026095 Bacteria 1551
224 Ga0207675_100002556 3300026118 Bacteria 18017
225 Ga0207675_100213523 3300026118 Bacteria 1857
226 Ga0207675_100461063 3300026118 Unclassified 1261
227 Ga0207683_10353293 3300026121 Bacteria 1349
228 Ga0207683_11063094 3300026121 Bacteria 751
229 Ga0207698_10355931 3300026142 Bacteria 1384
230 Ga0207698_10652002 3300026142 Bacteria 1043
231 Ga0209371_1003365 3300027312 Bacteria 7854
232 Ga0207428_10198520 3300027907 Bacteria 1510
233 Ga0268265_11968891 3300028380 Bacteria 591
234 Ga0268264_10163122 3300028381 Bacteria 2010
235 Ga0268256_1005480 3300030500 Bacteria 4966
236 Ga0307513_10021365 3300031456 Bacteria 7644
237 Ga0316576_10078615 3300031727 Bacteria 2444
238 Ga0307405_10006404 3300031731 Bacteria 5787
239 Ga0307406_10019481 3300031901 Bacteria 3982
240 Ga0307406_10417652 3300031901 Bacteria 1068
241 Ga0307412_10000589 3300031911 Bacteria 21521
242 Ga0307409_102128061 3300031995 Unclassified 591
243 Ga0316580_10107265 3300032139 Bacteria 855
244 Ga0316592_1024348 3300033524 Unclassified 1302
245 Ga0373937_0492368 3300036401 Unclassified 1165
246 Ga0395898_0000028 3300037466 Bacteria 371232
247 Ga0395901_0139199 3300038443 Viruses 2551
248 Ga0436365_1199595 3300039437 Unclassified 798
249 Ga0451800_0795368 3300041459 Bacteria 2013
250 Ga0451807_0570714 3300041486 Bacteria 2418
251 Ga0451853_2515088 3300041512 Unclassified 757
252 Ga0439441_002959 3300042001 Bacteria 2449
253 Ga0439445_0074300 3300042004 Bacteria 944
254 Ga0439432_027876 3300042006 Bacteria 1842
255 Ga0439451_110944 3300042009 Bacteria 556
256 Ga0439452_037566 3300042010 Bacteria 1154
257 Ga0439435_0159488 3300042436 Unclassified 728
258 Ga0466982_0350875 3300044672 Bacteria 819
259 Ga0453683_0321928 3300044673 Bacteria 991
260 Ga0466963_0920907 3300044694 Bacteria 616
261 Ga0453684_1186846 3300044712 Bacteria 802
262 Ga0466957_0041680 3300044842 Bacteria 2776
263 Ga0466967_1445472 3300045976 Bacteria 685
264 Ga0495617_015653 3300046452 Bacteria 2568
265 Ga0495603_0247747 3300046455 Bacteria 1026
266 Ga0495603_0531523 3300046455 Bacteria 673
267 Ga0495638_0000715 3300046460 Bacteria 35779
268 Ga0495605_0005877 3300046474 Bacteria 7090
269 Ga0495585_0113050 3300046492 Bacteria 1442
270 Ga0495607_0386757 3300046501 Bacteria 639
271 Ga0495583_0012179 3300046506 Bacteria 4887
272 Ga0495583_0033781 3300046506 Bacteria 2457
273 Ga0495606_0000430 3300046507 Bacteria 69872
274 Ga0495606_0002081 3300046507 Bacteria 24424
275 Ga0495606_0174407 3300046507 Bacteria 1245
276 Ga0495606_0232989 3300046507 Bacteria 1031
277 Ga0495616_0056584 3300046513 Bacteria 1936
278 Ga0495616_0384930 3300046513 Bacteria 579
279 Ga0495620_0120949 3300046515 Bacteria 1032
280 Ga0495631_0066835 3300046518 Bacteria 1555
281 Ga0495631_0170162 3300046518 Bacteria 934
282 Ga0495644_0282825 3300046523 Bacteria 647
283 Ga0495648_0205993 3300046524 Bacteria 981
284 Ga0495598_0159748 3300046537 Unclassified 792
285 Ga0495609_0049774 3300046538 Bacteria 1869
286 Ga0495621_0107338 3300046539 Bacteria 1068
287 Ga0495621_0274818 3300046539 Bacteria 693
288 Ga0495656_0019496 3300046615 Bacteria 2618
289 Ga0495668_0019238 3300046616 Bacteria 3939
290 Ga0495611_0010065 3300046648 Bacteria 4002
291 Ga0495625_0007104 3300046660 Bacteria 9836
292 Ga0495625_0235612 3300046660 Bacteria 1194
293 Ga0495635_0309421 3300046663 Bacteria 1059
294 Ga0495588_0030843 3300046674 Bacteria 2696
295 Ga0495670_0035823 3300046691 Bacteria 2472
296 Ga0495670_0619882 3300046691 Bacteria 589
297 Ga0495589_0082033 3300046794 Bacteria 1568
298 Ga0495636_0476202 3300047318 Bacteria 602
299 Ga0495672_0037884 3300047320 Bacteria 2947
300 Ga0495672_0039036 3300047320 Bacteria 2891
301 Ga0495687_032665 3300047443 Bacteria 2372
302 Ga0495673_0027165 3300047469 Bacteria 2727
303 Ga0495686_0000654 3300047472 Bacteria 47357
304 Ga0495686_0280020 3300047472 Bacteria 927
305 Ga0495686_0579970 3300047472 Bacteria 583
306 Ga0496104_0926676 3300048907 Bacteria 776
307 Ga0496106_0000433 3300048909 Bacteria 29790
308 Ga0496108_0992120 3300048911 Bacteria 718
309 Ga0496113_0364277 3300048916 Bacteria 1160
310 Ga0496116_0005611 3300048919 Bacteria 11560
311 Ga0496116_0007758 3300048919 Bacteria 9437
312 Ga0496116_0041719 3300048919 Bacteria 3145
313 Ga0496116_0107746 3300048919 Bacteria 1646
314 Ga0496117_0012488 3300048920 Bacteria 7478
315 Ga0496117_0055440 3300048920 Bacteria 2770
316 Ga0496118_0034464 3300048921 Bacteria 4129
317 Ga0496118_0096440 3300048921 Bacteria 2015
318 Ga0496119_0029949 3300048922 Bacteria 3678
319 Ga0496121_0018799 3300048924 Bacteria 6942
320 Ga0496121_0025035 3300048924 Bacteria 5682
321 Ga0496121_0035083 3300048924 Bacteria 4500
322 Ga0496121_0084008 3300048924 Bacteria 2512
323 Ga0496121_0108488 3300048924 Bacteria 2123
324 Ga0496121_0311682 3300048924 Bacteria 1063
325 Ga0496122_0015727 3300048925 Bacteria 7213
326 Ga0496122_0028207 3300048925 Bacteria 4773
327 Ga0496122_0029357 3300048925 Bacteria 4640
328 Ga0496122_0053153 3300048925 Bacteria 3057
329 Ga0496122_0128861 3300048925 Bacteria 1613
330 Ga0496122_0445088 3300048925 Bacteria 644
331 Ga0496122_0485907 3300048925 Bacteria 603
332 Ga0496123_0024920 3300048926 Bacteria 4527
333 Ga0496123_0024968 3300048926 Bacteria 4521
334 Ga0496123_0035301 3300048926 Bacteria 3565
335 Ga0496123_0185107 3300048926 Bacteria 1083
336 Ga0496123_0231200 3300048926 Bacteria 925
337 Ga0496124_0001760 3300048927 Bacteria 30205
338 Ga0496124_0012287 3300048927 Bacteria 8458
339 Ga0496124_0075122 3300048927 Bacteria 2792
340 Ga0496124_0124711 3300048927 Bacteria 2053
341 Ga0496125_0011400 3300048928 Bacteria 8894
342 Ga0496126_0163605 3300048929 Bacteria 1900
343 Ga0496126_0439028 3300048929 Bacteria 1052
344 Ga0495678_035967 3300049459 Bacteria 2025
345 Ga0501032_0159936 3300049569 Bacteria 1479
346 Ga0501046_0114988 3300049580 Bacteria 2052
347 Ga0501073_0231180 3300049589 Bacteria 1277
348 Ga0501080_0287454 3300049742 Unclassified 1494
349 Ga0501083_0094863 3300049744 Bacteria 1969
350 nmdc:mga07m45_437947_c1 3300050496 Bacteria 758
351 nmdc:mga05p37_864904_c1 3300050507 Unclassified 980
352 nmdc:mga09592_33908_c1 3300050508 Bacteria 4266
353 nmdc:mga09592_373328_c1 3300050508 Unclassified 1234
354 nmdc:mga0qj67_11771_c1 3300050509 Bacteria 6566
355 nmdc:mga06r32_457326_c1 3300050510 Unclassified 1256
356 nmdc:mga06r32_490459_c1 3300050510 Unclassified 1206
357 nmdc:mga08y16_21862_c1 3300050511 Bacteria 6750
358 nmdc:mga08y16_296429_c1 3300050511 Bacteria 1667
359 nmdc:mga08y16_499380_c1 3300050511 Unclassified 1236
360 nmdc:mga08y16_727411_c1 3300050511 Bacteria 990
361 nmdc:mga0n895_154866_c1 3300050512 Bacteria 2322
362 nmdc:mga08x19_287881_c1 3300050514 Bacteria 1139
363 nmdc:mga0sz30_44902_c1 3300050516 Bacteria 1862
364 Ga0500578_0233315 3300053086 Bacteria 1114
365 Ga0500557_009536 3300053105 Bacteria 2383
366 Ga0500594_0102092 3300053118 Bacteria 883
367 Ga0500642_0280755 3300053130 Bacteria 757
368 Ga0500652_146319 3300053131 Bacteria 982
369 Ga0500658_0384950 3300053134 Bacteria 642
370 Ga0500568_0001000 3300053139 Bacteria 19361
371 Ga0500568_0002609 3300053139 Bacteria 10481
372 Ga0500604_0123654 3300053151 Bacteria 866
373 Ga0500616_0000903 3300053153 Bacteria 32556
374 2511185756 2510917028 Bacteria 6185411
375 2513595384 2513237088 Bacteria 6927906
376 2513866511 2513237138 Bacteria 7368160
377 2513911380 2513237144 Bacteria 7530820
378 2513924422 2513237146 Bacteria 7166346
379 2585201141 2582581294 Bacteria 6626667
380 2585223395 2582581298 Bacteria 7315509
381 2585232413 2582581299 Bacteria 6518058
382 2585256271 2582581304 Bacteria 5831370
383 2585279934 2582581308 Bacteria 7413247
384 2585326291 2582581315 Bacteria 7318924
385 2585398950 2582581867 Bacteria 7184437
386 2585533812 2585427527 Bacteria 7273426
387 2585546009 2585427529 Bacteria 7395659
388 2585553405 2585427530 Bacteria 7383882
389 2585818929 2585427590 Bacteria 6824633
390 2585843849 2585427594 Bacteria 6180594
391 2585900482 2585427608 Bacteria 6544331
392 2599419616 2599185170 Bacteria 7295545
393 2616309428 2615840626 Bacteria 7921970
394 2616556239 2615840698 Bacteria 7319877
395 2617380562 2617270742 Bacteria 6808054
396 2671113976 2667528174 Bacteria 6435400
397 2738800924 2738541293 Bacteria 7065685
398 2778173857 2775507266 Bacteria 7392367
399 2793283539 2791355253 Bacteria 5171699
400 2793296748 2791355256 Bacteria 6798008
401 2793341180 2791355263 Bacteria 6872478
402 2793365475 2791355267 Bacteria 7222458
403 2806051372 2802429634 Bacteria 7083200
404 2806059361 2802429635 Bacteria 7650140
405 2819608718 2818991448 Bacteria 6772224
406 2819640825 2818991453 Bacteria 7181617
407 2838029607 2838029111 Bacteria 6603031
408 2838039849 2838035591 Bacteria 7166484
409 2841868969 2841864319 Bacteria 6742987
410 2842367541 2842363717 Bacteria 6844742
411 2842475963 2842475841 Bacteria 6603183
412 2842486046 2842482326 Bacteria 7212537
413 2842494689 2842489311 Bacteria 6620893
414 2842499847 2842495871 Bacteria 6820686
415 2842503135 2842502639 Bacteria 6604161
416 2842513001 2842509118 Bacteria 6850950
417 2852388101 2852387548 Bacteria 8025568
418 2854900687 2854896431 Bacteria 5869725
419 2854919617 2854916844 Bacteria 5725939
420 2891051075 2891048133 Bacteria 4447501
421 2899805669 2899803654 Bacteria 5577784
422 2919101725 2919100787 Bacteria 7710546
423 2919172356 2919171160 Bacteria 6499771
424 2919408483 2919408235 Bacteria 6149349
425 2923556322 2923556063 Bacteria 6793593
426 2933018779 2933016740 Bacteria 6355406
427 2996888126 2996887358 Bacteria 5795980
428 3005410769 3005409236 Bacteria 7188837
429 3005423131 3005416602 Bacteria 7064308
430 3005450224 3005445848 Bacteria 6906074
431 8005261322 8005258706 Bacteria 6184835
432 8005291507 8005289223 Bacteria 6634003
433 8005305615 8005301065 Bacteria 6614431
434 8005315458 8005314921 Bacteria 7072929
435 8005322653 8005321885 Bacteria 5795980
436 8005484634 8005484373 Bacteria 6297373
437 8005543378 8005542996 Bacteria 7077758
438 8005649326 8005645114 Bacteria 6950293
439 8005685436 8005682033 Bacteria 6726518
440 8005692632 8005688590 Bacteria 6610080
441 8024491722 8024486573 Bacteria 6540512
442 8024506464 8024501048 Bacteria 6427847
443 8046769608 8046767195 Bacteria 7547379
444 8056376066 8056375014 Bacteria 7006639
445 8056384191 8056382006 Bacteria 6408074
446 Ga0395900_0102631
447 ARcpr5yngRDRAFT_c012833
448 JGI25162J39368_1000493
449 JGI25152J39213_1000743
450 JGI25152J39213_1001460
451 JGI25152J39213_1003337
452 JGI25152J39213_1029496
453 JGI25150J39212_1000133
454 JGI25151J46595_10000407
455 JGI25151J46595_10002323
456 JGI25165J46597_1000796
457 JGI25153J46596_10002013
458 JGI25153J46596_10075020
459 rootH1_10034300
460 rootL2_10050649
461 rootH1_10200700
462 JGI25160J50197_1009478
463 Ga0055526_1040511
464 Ga0055524_1023458
465 Ga0055528_1002689
466 Ga0055540_1007243
467 Ga0055540_1029678
468 Ga0055531_10001575
469 Ga0055531_10026640
470 Ga0065714_10212312
471 Ga0065704_10010082
472 Ga0065704_10207556
473 Ga0065712_10005542
474 Ga0065712_10087624
475 Ga0065712_10210418
476 Ga0065715_10270355
477 Ga0070690_100525417
478 Ga0070670_100000091
479 Ga0070670_100687087
480 Ga0068869_100035136
481 Ga0070660_101519868
482 Ga0070689_100016482
483 Ga0070687_100008500
484 Ga0070687_100407069
485 Ga0070668_100086074
486 Ga0070668_100141330
487 Ga0070669_100076873
488 Ga0070675_100021615
489 Ga0070671_100003867
490 Ga0070671_100733719
491 Ga0070671_101525909
492 Ga0070673_100009066
493 Ga0070673_100075464
494 Ga0070688_100176276
495 Ga0070667_100335421
496 Ga0070701_10021279
497 Ga0070700_100318903
498 Ga0070708_100369019
499 Ga0070663_100994012
500 Ga0070678_101342420
501 Ga0068867_100161210
502 Ga0070685_10020526
503 Ga0070685_10235800
504 Ga0070685_10865866
505 Ga0070707_100156642
506 Ga0070698_100002644
507 Ga0070698_100003140
508 Ga0068853_100044976
509 Ga0068853_100404857
510 Ga0068853_100591248
511 Ga0070672_100014892
512 Ga0070672_100148999
513 Ga0070686_100512501
514 Ga0070702_100441276
515 Ga0068859_100042974
516 Ga0068859_100636903
517 Ga0068859_100639075
518 Ga0068864_100024227
519 Ga0068864_100456673
520 Ga0068861_100017009
521 Ga0068861_100405084
522 Ga0068870_10214115
523 Ga0068863_100247361
524 Ga0068858_101820291
525 Ga0068860_100236918
526 Ga0068862_100049946
527 Ga0081539_10025497
528 Ga0075365_10108567
529 Ga0070716_100370555
530 Ga0075367_10289293
531 Ga0075369_10048984
532 Ga0097621_100009542
533 Ga0097621_100042351
534 Ga0097621_100760325
535 Ga0097621_101285676
536 Ga0075370_10226503
537 Ga0068871_100036503
538 Ga0068871_100037537
539 Ga0068871_100101223
540 Ga0068871_100628534
541 Ga0075428_100075397
542 Ga0075428_100097080
543 Ga0075430_100012472
544 Ga0075430_100664657
545 Ga0075431_100426267
546 Ga0075429_100284717
547 Ga0075429_100526572
548 Ga0068865_100028133
549 Ga0068865_100342342
550 Ga0075436_100163806
551 Ga0097620_100042973
552 Ga0097620_100636897
553 Ga0097620_100639095
554 Ga0105251_10027975
555 Ga0105250_10063384
556 Ga0111539_10170553
557 Ga0111539_10189744
558 Ga0111539_10239779
559 Ga0111539_10277408
560 Ga0114129_10229757
561 Ga0114129_10578147
562 Ga0105243_10474893
563 Ga0105242_10042423
564 Ga0105242_10205131
565 Ga0105248_10042219
566 Ga0105249_10003042
567 Ga0105249_10026771
568 Ga0105249_10270229
569 Ga0105249_10434395
570 Ga0123341_1000036
571 Ga0105246_10020008
572 Ga0105246_10113927
573 Ga0157369_10839758
574 Ga0157374_10318967
575 Ga0157374_11127496
576 Ga0163162_10469779
577 Ga0157375_10189326
578 Ga0157375_10344866
579 Ga0157375_10356031
580 Ga0157375_10389020
581 Ga0157375_10773537
582 Ga0163163_10619528
583 Ga0163163_10658835
584 Ga0157380_10311099
585 Ga0157377_10133660
586 Ga0157379_10182220
587 Ga0157376_11969324
588 Ga0163161_10027259
589 Ga0163161_10377924
590 Ga0163161_10434062
591 Ga0209760_103230
592 Ga0209436_100113
593 Ga0209437_100056
594 Ga0207425_1000667
595 Ga0207425_1004807
596 Ga0209646_1015114
597 Ga0209129_1000066
598 Ga0209129_1000308
599 Ga0209129_1002211
600 Ga0209129_1002705
601 Ga0209233_1000071
602 Ga0209673_1000988
603 Ga0209673_1004038
604 Ga0209673_1006953
605 Ga0209673_1018093
606 Ga0209673_1047099
607 Ga0209130_1000002
608 Ga0209130_1018986
609 Ga0209676_1003075
610 Ga0209025_1000557
611 Ga0209025_1000919
612 Ga0209025_1005917
613 Ga0209564_1000683
614 Ga0209564_1006727
615 Ga0209564_1052634
616 Ga0209758_1000170
617 Ga0209758_1000788
618 Ga0209758_1001755
619 Ga0209050_1006027
620 Ga0209050_1015290
621 Ga0209256_1002512
622 Ga0209256_1003658
623 Ga0209256_1018650
624 Ga0209256_1037320
625 Ga0207426_1000013
626 Ga0207426_1004630
627 Ga0209051_1000228
628 Ga0209051_1001851
629 Ga0209257_1000940
630 Ga0209257_1004192
631 Ga0207697_10228950
632 Ga0207713_1063648
633 Ga0207682_10015427
634 Ga0207642_10345929
635 Ga0207685_10015439
636 Ga0207643_10002549
637 Ga0207662_10007225
638 Ga0207650_10000723
639 Ga0207650_10167270
640 Ga0207659_10090572
641 Ga0207644_11040420
642 Ga0207686_10012010
643 Ga0207670_10244561
644 Ga0207704_10039803
645 Ga0207691_10014368
646 Ga0207691_10057710
647 Ga0207711_10244857
648 Ga0207689_10051080
649 Ga0207651_10023670
650 Ga0207651_10374285
651 Ga0207651_10377649
652 Ga0207712_10001318
653 Ga0207712_10129870
654 Ga0207712_11392963
655 Ga0207668_10045656
656 Ga0207658_10061485
657 Ga0207677_10137204
658 Ga0207677_10848027
659 Ga0207703_11591626
660 Ga0207639_10031985
661 Ga0207639_10246829
662 Ga0207678_10135501
663 Ga0207708_10018473
664 Ga0207708_10731088
665 Ga0207641_10006210
666 Ga0207641_11354276
667 Ga0207648_10142193
668 Ga0207676_10265672
669 Ga0207675_100002556
670 Ga0207675_100213523
671 Ga0207675_100461063
672 Ga0207683_10353293
673 Ga0207683_11063094
674 Ga0207698_10355931
675 Ga0207698_10652002
676 Ga0209371_1003365
677 Ga0207428_10198520
678 Ga0268265_11968891
679 Ga0268264_10163122
680 Ga0268256_1005480
681 Ga0307513_10021365
682 Ga0316576_10078615
683 Ga0307405_10006404
684 Ga0307406_10019481
685 Ga0307406_10417652
686 Ga0307412_10000589
687 Ga0307409_102128061
688 Ga0316580_10107265
689 Ga0316592_1024348
690 Ga0373937_0492368
691 Ga0395898_0000028
692 Ga0395901_0139199
693 Ga0436365_1199595
694 Ga0451800_0795368
695 Ga0451807_0570714
696 Ga0451853_2515088
697 Ga0439441_002959
698 Ga0439445_0074300
699 Ga0439432_027876
700 Ga0439451_110944
701 Ga0439452_037566
702 Ga0439435_0159488
703 Ga0466982_0350875
704 Ga0453683_0321928
705 Ga0466963_0920907
706 Ga0453684_1186846
707 Ga0466957_0041680
708 Ga0466967_1445472
709 Ga0495617_015653
710 Ga0495603_0247747
711 Ga0495603_0531523
712 Ga0495638_0000715
713 Ga0495605_0005877
714 Ga0495585_0113050
715 Ga0495607_0386757
716 Ga0495583_0012179
717 Ga0495583_0033781
718 Ga0495606_0000430
719 Ga0495606_0002081
720 Ga0495606_0174407
721 Ga0495606_0232989
722 Ga0495616_0056584
723 Ga0495616_0384930
724 Ga0495620_0120949
725 Ga0495631_0066835
726 Ga0495631_0170162
727 Ga0495644_0282825
728 Ga0495648_0205993
729 Ga0495598_0159748
730 Ga0495609_0049774
731 Ga0495621_0107338
732 Ga0495621_0274818
733 Ga0495656_0019496
734 Ga0495668_0019238
735 Ga0495611_0010065
736 Ga0495625_0007104
737 Ga0495625_0235612
738 Ga0495635_0309421
739 Ga0495588_0030843
740 Ga0495670_0035823
741 Ga0495670_0619882
742 Ga0495589_0082033
743 Ga0495636_0476202
744 Ga0495672_0037884
745 Ga0495672_0039036
746 Ga0495687_032665
747 Ga0495673_0027165
748 Ga0495686_0000654
749 Ga0495686_0280020
750 Ga0495686_0579970
751 Ga0496104_0926676
752 Ga0496106_0000433
753 Ga0496108_0992120
754 Ga0496113_0364277
755 Ga0496116_0005611
756 Ga0496116_0007758
757 Ga0496116_0041719
758 Ga0496116_0107746
759 Ga0496117_0012488
760 Ga0496117_0055440
761 Ga0496118_0034464
762 Ga0496118_0096440
763 Ga0496119_0029949
764 Ga0496121_0018799
765 Ga0496121_0025035
766 Ga0496121_0035083
767 Ga0496121_0084008
768 Ga0496121_0108488
769 Ga0496121_0311682
770 Ga0496122_0015727
771 Ga0496122_0028207
772 Ga0496122_0029357
773 Ga0496122_0053153
774 Ga0496122_0128861
775 Ga0496122_0445088
776 Ga0496122_0485907
777 Ga0496123_0024920
778 Ga0496123_0024968
779 Ga0496123_0035301
780 Ga0496123_0185107
781 Ga0496123_0231200
782 Ga0496124_0001760
783 Ga0496124_0012287
784 Ga0496124_0075122
785 Ga0496124_0124711
786 Ga0496125_0011400
787 Ga0496126_0163605
788 Ga0496126_0439028
789 Ga0495678_035967
790 Ga0501032_0159936
791 Ga0501046_0114988
792 Ga0501073_0231180
793 Ga0501080_0287454
794 Ga0501083_0094863
795 nmdc:mga07m45_437947_c1
796 nmdc:mga05p37_864904_c1
797 nmdc:mga09592_33908_c1
798 nmdc:mga09592_373328_c1
799 nmdc:mga0qj67_11771_c1
800 nmdc:mga06r32_457326_c1
801 nmdc:mga06r32_490459_c1
802 nmdc:mga08y16_21862_c1
803 nmdc:mga08y16_296429_c1
804 nmdc:mga08y16_499380_c1
805 nmdc:mga08y16_727411_c1
806 nmdc:mga0n895_154866_c1
807 nmdc:mga08x19_287881_c1
808 nmdc:mga0sz30_44902_c1
809 Ga0500578_0233315
810 Ga0500557_009536
811 Ga0500594_0102092
812 Ga0500642_0280755
813 Ga0500652_146319
814 Ga0500658_0384950
815 Ga0500568_0001000
816 Ga0500568_0002609
817 Ga0500604_0123654
818 Ga0500616_0000903
819 2511185756
820 2513595384
821 2513866511
822 2513911380
823 2513924422
824 2585201141
825 2585223395
826 2585232413
827 2585256271
828 2585279934
829 2585326291
830 2585398950
831 2585533812
832 2585546009
833 2585553405
834 2585818929
835 2585843849
836 2585900482
837 2599419616
838 2616309428
839 2616556239
840 2617380562
841 2671113976
842 2738800924
843 2778173857
844 2793283539
845 2793296748
846 2793341180
847 2793365475
848 2806051372
849 2806059361
850 2819608718
851 2819640825
852 2838029607
853 2838039849
854 2841868969
855 2842367541
856 2842475963
857 2842486046
858 2842494689
859 2842499847
860 2842503135
861 2842513001
862 2852388101
863 2854900687
864 2854919617
865 2891051075
866 2899805669
867 2919101725
868 2919172356
869 2919408483
870 2923556322
871 2933018779
872 2996888126
873 3005410769
874 3005423131
875 3005450224
876 8005261322
877 8005291507
878 8005305615
879 8005315458
880 8005322653
881 8005484634
882 8005543378
883 8005649326
884 8005685436
885 8005692632
886 8024491722
887 8024506464
888 8046769608
889 8056376066
890 8056384191

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00692

dUTPase

dUTPase

15

142

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7n56-assembly3.cif.gz_K crystal structure of deoxyuridine 5'-triphosphate nucleotidohydrolase from rickettsia prowazekii str. madrid e 0.9538 1 132
3mbq-assembly1.cif.gz_B crystal structure of deoxyuridine 5-triphosphate nucleotidohydrolase from brucella melitensis, orthorhombic crystal form 0.9533 5 129
4lhr-assembly1.cif.gz_A crystal structure of a deoxyuridine 5'-triphosphate nucleotidohydrolase from burkholderia thailandensis 0.9457 3 131
3tqz-assembly1.cif.gz_A structure of a deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) from coxiella burnetii 0.9373 5 133
3h6d-assembly1.cif.gz_A structure of the mycobacterium tuberculosis dutpase d28n mutant 0.9363 2 130
ID Description Score Start End Superfamily
3mbqA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9415 5 132 2.70.40.10
1snfC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9302 3 131 2.70.40.10
1snfC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9233 3 131 2.70.40.10
2p9oA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9187 5 133 2.70.40.10
1sjnC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9171 3 140 2.70.40.10
ID Description Score Start End GO Terms
AF-A0A656KD48-F1-model_v4 deleted 0.9871 28 120
AF-A0A359GZM5-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9783 4 128 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A7X9CIF6-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9774 4 116 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-F8DS81-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9772 3 126 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A2N2ZBS2-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9716 4 135 GO:0000287
GO:0004170
GO:0006226
GO:0046081

Map