F445551

General Info

Members Datasets Scaffolds Average Seq Length
445 284 411 161

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_1506593|Ga0436363_1506593_17_598
Length 193
Sequence MVDARGMPSTGWTAMNTHDFSVKTAGGGTQDLHQYAGQVLLIVNVASECGFTPQYEGLELLYRERAERGLQVLGFPCNQFGAQEPGSDAEIQQFCAATYDVTFPVFGKIDVNGADADPLYAYLRAEAPGEFGPAHGRLYEHVRSSRPAALDTDEIKWNFTKFLVDRDGNVAGRYEPTVTPEQLRPDVDALLAG

Samples

Sample ID Description Type Environment
1 2527291627 Frankia casuarinae Thr Isolate Nodule
2 2527291629 Frankia sp. BMG5.23 Isolate Nodule
3 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
4 2554235283 Bacillus safensis VK Isolate Rhizosphere
5 2576861822 Frankia sp. CeD Isolate Nodule
6 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
7 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
8 2643221556 Massilia sp. Root1485 Isolate Unclassified
9 2643221684 Massilia sp. Root133 Isolate Unclassified
10 2643221735 Bacillus sp. Root920 Isolate Unclassified
11 2684623036 Frankia sp. CgIM4 Isolate Nodule
12 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
13 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
14 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
15 2710264753 Frankia sp. KB5 Isolate Nodule
16 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
17 2773857924 Frankia sp. CgIS1 Isolate Nodule
18 2811994870 Bacillus sp. JB4 Isolate Unclassified
19 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
20 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
21 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
22 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
23 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
24 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
25 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
26 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
27 2919726948 Bacillus pumilus 4489 Isolate Unclassified
28 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
29 2952252522 Salinicola sp. DM10 Isolate Unclassified
30 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
31 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
32 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
33 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
34 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
35 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
36 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
37 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
55 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
56 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
57 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
58 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
59 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
60 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
61 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
66 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
123 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
179 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
180 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
181 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
182 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
183 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
184 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
185 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
186 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
187 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
188 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
189 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
190 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
191 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
198 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
199 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
200 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
206 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
209 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
210 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
211 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
212 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
213 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
214 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
215 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
216 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
217 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
218 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
219 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
220 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
221 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
222 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
223 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
224 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
225 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
226 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
227 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
228 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
229 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
230 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
231 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
232 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
233 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
234 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
235 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
236 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
244 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
245 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
246 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
247 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
262 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
263 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
264 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
265 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
266 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
267 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
276 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
277 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
278 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
279 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
280 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
281 637000116 Frankia casuarinae CcI3 Isolate Nodule
282 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
283 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
284 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.91
Metatranscriptomes 0.45
Isolates 7.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.92
Nodule 2.02
Rhizoplane 2.25
Rhizosphere 85.17
Stem 0
Stem Tuber 0
Unclassified 7.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000006 3300003187 Bacteria 419711
2 JGI25151J46595_10000029 3300003187 Bacteria 205878
3 rootL2_10272610 3300003322 Unclassified 2225
4 Ga0006562J51391_1000076 3300003578 Bacteria 11790
5 Ga0055542_1034910 3300003762 Bacteria 620
6 Ga0055541_1003883 3300003841 Bacteria 2764
7 Ga0065707_10088189 3300005295 Bacteria 4740
8 Ga0065707_10279805 3300005295 Bacteria 1050
9 Ga0070676_10041738 3300005328 Bacteria 2661
10 Ga0070676_10231890 3300005328 Bacteria 1224
11 Ga0070676_10250228 3300005328 Bacteria 1182
12 Ga0070670_100000633 3300005331 Bacteria 27394
13 Ga0070670_100021365 3300005331 Bacteria 5569
14 Ga0070670_100046948 3300005331 Bacteria 3716
15 Ga0068869_101227640 3300005334 Bacteria 659
16 Ga0070680_100207749 3300005336 Bacteria 1651
17 Ga0070680_100331949 3300005336 Bacteria 1292
18 Ga0068868_100173648 3300005338 Bacteria 1785
19 Ga0068868_100536855 3300005338 Bacteria 1029
20 Ga0068868_100633301 3300005338 Bacteria 950
21 Ga0070689_100351933 3300005340 Bacteria 1236
22 Ga0070687_100896281 3300005343 Bacteria 635
23 Ga0070661_100143482 3300005344 Bacteria 1801
24 Ga0070668_101579711 3300005347 Bacteria 601
25 Ga0070669_100056850 3300005353 Bacteria 2869
26 Ga0070669_100091496 3300005353 Bacteria 2281
27 Ga0070669_100467221 3300005353 Bacteria 1042
28 Ga0070675_100009668 3300005354 Bacteria 7508
29 Ga0070675_100096616 3300005354 Bacteria 2482
30 Ga0070675_100176676 3300005354 Bacteria 1844
31 Ga0070671_100053048 3300005355 Bacteria 3371
32 Ga0070674_100014239 3300005356 Bacteria 4940
33 Ga0070674_100104121 3300005356 Bacteria 2073
34 Ga0070673_100032289 3300005364 Bacteria 3940
35 Ga0070673_100154233 3300005364 Bacteria 1948
36 Ga0070673_100184321 3300005364 Bacteria 1788
37 Ga0070688_100044833 3300005365 Bacteria 2730
38 Ga0070659_101541272 3300005366 Bacteria 593
39 Ga0070667_100027974 3300005367 Bacteria 4692
40 Ga0070667_100143677 3300005367 Bacteria 2091
41 Ga0070667_100236235 3300005367 Bacteria 1631
42 Ga0070709_10405341 3300005434 Bacteria 1019
43 Ga0070714_100016152 3300005435 Bacteria 6022
44 Ga0070714_101094034 3300005435 Bacteria 777
45 Ga0070713_100000045 3300005436 Bacteria 77398
46 Ga0070701_10358443 3300005438 Bacteria 913
47 Ga0070711_100734869 3300005439 Bacteria 833
48 Ga0070705_100013781 3300005440 Bacteria 4142
49 Ga0070705_100469087 3300005440 Bacteria 948
50 Ga0070700_100025797 3300005441 Bacteria 3464
51 Ga0070700_101190325 3300005441 Bacteria 636
52 Ga0070708_100563773 3300005445 Bacteria 1074
53 Ga0070678_100023293 3300005456 Bacteria 4124
54 Ga0070678_100043459 3300005456 Bacteria 3201
55 Ga0070678_100476771 3300005456 Bacteria 1097
56 Ga0070681_10010693 3300005458 Bacteria 9070
57 Ga0070681_10037655 3300005458 Bacteria 4852
58 Ga0070681_10188442 3300005458 Bacteria 1982
59 Ga0068867_100126517 3300005459 Bacteria 1981
60 Ga0068867_100128466 3300005459 Bacteria 1967
61 Ga0068867_100174658 3300005459 Bacteria 1704
62 Ga0068867_100298373 3300005459 Bacteria 1327
63 Ga0068867_100928434 3300005459 Bacteria 785
64 Ga0070706_100144572 3300005467 Bacteria 2221
65 Ga0070698_100012282 3300005471 Bacteria 9069
66 Ga0070679_100025287 3300005530 Bacteria 5825
67 Ga0068853_100007284 3300005539 Bacteria 8857
68 Ga0070672_100005876 3300005543 Bacteria 8184
69 Ga0070672_101248129 3300005543 Bacteria 663
70 Ga0070695_100423280 3300005545 Bacteria 1014
71 Ga0070665_100172464 3300005548 Bacteria 2164
72 Ga0070665_100188944 3300005548 Bacteria 2061
73 Ga0070704_100055851 3300005549 Bacteria 2801
74 Ga0070704_100225993 3300005549 Bacteria 1524
75 Ga0068855_100017081 3300005563 Bacteria 8729
76 Ga0068855_100096410 3300005563 Bacteria 3408
77 Ga0068857_100042836 3300005577 Bacteria 4016
78 Ga0068854_100263813 3300005578 Bacteria 1380
79 Ga0068854_100447288 3300005578 Bacteria 1078
80 Ga0068854_100865004 3300005578 Bacteria 792
81 Ga0068856_100053067 3300005614 Bacteria 3998
82 Ga0070702_100152035 3300005615 Bacteria 1487
83 Ga0068852_100114232 3300005616 Bacteria 2460
84 Ga0068859_100087064 3300005617 Bacteria 3171
85 Ga0068859_100187070 3300005617 Bacteria 2155
86 Ga0068864_100002031 3300005618 Bacteria 16705
87 Ga0068864_100062329 3300005618 Bacteria 3231
88 Ga0068864_100103026 3300005618 Bacteria 2533
89 Ga0068864_100117343 3300005618 Bacteria 2376
90 Ga0068861_100046051 3300005719 Bacteria 3287
91 Ga0068861_100124016 3300005719 Bacteria 2087
92 Ga0068861_100237839 3300005719 Bacteria 1548
93 Ga0068861_100333782 3300005719 Bacteria 1324
94 Ga0068870_10005217 3300005840 Bacteria 5656
95 Ga0068863_100001012 3300005841 Bacteria 28130
96 Ga0068863_100008918 3300005841 Bacteria 9793
97 Ga0068863_100104465 3300005841 Bacteria 2695
98 Ga0068863_100319161 3300005841 Bacteria 1509
99 Ga0068863_101194934 3300005841 Bacteria 766
100 Ga0068858_100612373 3300005842 Bacteria 1057
101 Ga0068860_100062604 3300005843 Bacteria 3535
102 Ga0068860_100072296 3300005843 Bacteria 3278
103 Ga0068860_100731918 3300005843 Bacteria 1000
104 Ga0068862_100175695 3300005844 Bacteria 1920
105 Ga0068862_101142204 3300005844 Bacteria 775
106 Ga0081455_10109569 3300005937 Bacteria 2197
107 Ga0081539_10064776 3300005985 Bacteria 1987
108 Ga0081539_10330468 3300005985 Bacteria 646
109 Ga0070717_10036549 3300006028 Bacteria 3984
110 Ga0097621_100515590 3300006237 Bacteria 1085
111 Ga0097621_100860618 3300006237 Bacteria 842
112 Ga0068871_100016629 3300006358 Bacteria 5548
113 Ga0068871_100121598 3300006358 Bacteria 2206
114 Ga0068871_100164489 3300006358 Bacteria 1899
115 Ga0068871_100397430 3300006358 Bacteria 1227
116 Ga0068871_100511966 3300006358 Bacteria 1083
117 Ga0075431_101369443 3300006847 Bacteria 668
118 Ga0075434_100903872 3300006871 Bacteria 898
119 Ga0075434_101739915 3300006871 Bacteria 631
120 Ga0068865_100094776 3300006881 Bacteria 2173
121 Ga0097620_100087062 3300006931 Bacteria 3171
122 Ga0097620_100187065 3300006931 Bacteria 2155
123 Ga0075435_101227297 3300007076 Bacteria 656
124 Ga0105240_10568731 3300009093 Bacteria 1252
125 Ga0105240_10654527 3300009093 Bacteria 1151
126 Ga0105240_10715323 3300009093 Bacteria 1092
127 Ga0105240_11285348 3300009093 Bacteria 772
128 Ga0105240_11307642 3300009093 Bacteria 764
129 Ga0111539_10002361 3300009094 Bacteria 25098
130 Ga0111539_10120010 3300009094 Bacteria 3081
131 Ga0111539_10490759 3300009094 Bacteria 1430
132 Ga0105245_10945178 3300009098 Bacteria 905
133 Ga0105243_10343714 3300009148 Bacteria 1368
134 Ga0105241_10006078 3300009174 Bacteria 8901
135 Ga0105241_10626151 3300009174 Bacteria 975
136 Ga0105242_10026291 3300009176 Bacteria 4612
137 Ga0105248_10382145 3300009177 Bacteria 1585
138 Ga0105248_11015314 3300009177 Bacteria 937
139 Ga0105248_11489789 3300009177 Bacteria 766
140 Ga0105237_10009802 3300009545 Bacteria 10241
141 Ga0105238_10255328 3300009551 Bacteria 1732
142 Ga0105249_10016107 3300009553 Bacteria 6627
143 Ga0105249_10132706 3300009553 Bacteria 2379
144 Ga0105239_10030609 3300010375 Bacteria 5919
145 Ga0105239_11075160 3300010375 Bacteria 926
146 Ga0157371_10485684 3300013102 Bacteria 911
147 Ga0157369_10319333 3300013105 Bacteria 1614
148 Ga0157369_10430164 3300013105 Bacteria 1368
149 Ga0157378_10138105 3300013297 Bacteria 2261
150 Ga0157378_10288327 3300013297 Bacteria 1585
151 Ga0157378_10431960 3300013297 Bacteria 1303
152 Ga0157378_10473348 3300013297 Bacteria 1247
153 Ga0163162_10112783 3300013306 Bacteria 2817
154 Ga0163162_10118774 3300013306 Bacteria 2746
155 Ga0163162_10734288 3300013306 Bacteria 1107
156 Ga0163162_11910899 3300013306 Bacteria 679
157 Ga0157372_10067969 3300013307 Bacteria 4006
158 Ga0157372_10115781 3300013307 Bacteria 3073
159 Ga0157372_10126206 3300013307 Bacteria 2942
160 Ga0157372_10157926 3300013307 Bacteria 2620
161 Ga0157375_10070799 3300013308 Bacteria 3499
162 Ga0157375_10184129 3300013308 Bacteria 2241
163 Ga0163163_10001413 3300014325 Bacteria 20296
164 Ga0163163_10163511 3300014325 Bacteria 2272
165 Ga0163163_10268054 3300014325 Bacteria 1759
166 Ga0163163_10557404 3300014325 Bacteria 1208
167 Ga0157380_10001571 3300014326 Bacteria 15007
168 Ga0157380_10021704 3300014326 Bacteria 4820
169 Ga0157380_10424795 3300014326 Bacteria 1269
170 Ga0157380_10443879 3300014326 Bacteria 1244
171 Ga0157380_11588595 3300014326 Bacteria 709
172 Ga0157379_11609750 3300014968 Bacteria 634
173 Ga0157376_10692347 3300014969 Bacteria 1023
174 Ga0163161_10204617 3300017792 Bacteria 1522
175 Ga0163161_10299371 3300017792 Bacteria 1266
176 Ga0197907_11406288 3300020069 Bacteria 1167
177 Ga0209566_100097 3300025225 Bacteria 135294
178 Ga0209674_100543 3300025226 Bacteria 15143
179 Ga0209437_101063 3300025233 Bacteria 8973
180 Ga0209148_1002298 3300025254 Bacteria 6853
181 Ga0209025_1000001 3300025294 Bacteria 1888151
182 Ga0209025_1034540 3300025294 Bacteria 2305
183 Ga0209257_1065535 3300025304 Bacteria 974
184 Ga0207697_10191487 3300025315 Bacteria 898
185 Ga0207682_10494048 3300025893 Bacteria 580
186 Ga0207688_10500009 3300025901 Bacteria 761
187 Ga0207645_10141155 3300025907 Bacteria 1570
188 Ga0207645_10172803 3300025907 Bacteria 1417
189 Ga0207645_10199051 3300025907 Bacteria 1318
190 Ga0207645_10214783 3300025907 Bacteria 1267
191 Ga0207643_10004486 3300025908 Bacteria 7504
192 Ga0207684_10202259 3300025910 Bacteria 1713
193 Ga0207684_10406346 3300025910 Bacteria 1170
194 Ga0207654_10012943 3300025911 Bacteria 4281
195 Ga0207654_10188277 3300025911 Bacteria 1351
196 Ga0207707_10009698 3300025912 Bacteria 8353
197 Ga0207707_10075573 3300025912 Bacteria 2939
198 Ga0207695_10678802 3300025913 Bacteria 911
199 Ga0207695_11045732 3300025913 Bacteria 696
200 Ga0207671_10023358 3300025914 Bacteria 4663
201 Ga0207663_10431676 3300025916 Bacteria 1013
202 Ga0207660_10080808 3300025917 Bacteria 2388
203 Ga0207660_10102863 3300025917 Bacteria 2136
204 Ga0207649_10086652 3300025920 Bacteria 2041
205 Ga0207649_10143289 3300025920 Bacteria 1638
206 Ga0207652_10047401 3300025921 Bacteria 3671
207 Ga0207652_10743565 3300025921 Bacteria 873
208 Ga0207681_10028950 3300025923 Bacteria 3592
209 Ga0207681_10083890 3300025923 Bacteria 2257
210 Ga0207681_10655725 3300025923 Bacteria 870
211 Ga0207681_11199809 3300025923 Bacteria 637
212 Ga0207694_10270939 3300025924 Bacteria 1393
213 Ga0207650_10086610 3300025925 Bacteria 2385
214 Ga0207650_10813199 3300025925 Bacteria 792
215 Ga0207659_10077891 3300025926 Bacteria 2441
216 Ga0207659_10123433 3300025926 Bacteria 1988
217 Ga0207659_10264317 3300025926 Bacteria 1401
218 Ga0207700_10000051 3300025928 Bacteria 77057
219 Ga0207700_10376502 3300025928 Bacteria 1241
220 Ga0207664_10068058 3300025929 Bacteria 2859
221 Ga0207664_10868639 3300025929 Bacteria 810
222 Ga0207706_10139384 3300025933 Bacteria 2133
223 Ga0207686_10106072 3300025934 Bacteria 1886
224 Ga0207686_10299746 3300025934 Bacteria 1193
225 Ga0207709_10493954 3300025935 Bacteria 954
226 Ga0207709_10509978 3300025935 Bacteria 940
227 Ga0207670_10244250 3300025936 Bacteria 1384
228 Ga0207670_10885068 3300025936 Bacteria 747
229 Ga0207704_10117220 3300025938 Bacteria 1814
230 Ga0207704_10504916 3300025938 Bacteria 975
231 Ga0207691_10012296 3300025940 Bacteria 8205
232 Ga0207691_10014212 3300025940 Bacteria 7594
233 Ga0207691_10518937 3300025940 Bacteria 1011
234 Ga0207711_10167852 3300025941 Bacteria 1990
235 Ga0207711_10341557 3300025941 Bacteria 1386
236 Ga0207689_10036842 3300025942 Bacteria 4060
237 Ga0207689_10737894 3300025942 Bacteria 831
238 Ga0207661_10752633 3300025944 Bacteria 897
239 Ga0207661_11206532 3300025944 Bacteria 696
240 Ga0207679_10551857 3300025945 Bacteria 1034
241 Ga0207667_10309631 3300025949 Bacteria 1613
242 Ga0207667_10538616 3300025949 Bacteria 1182
243 Ga0207651_10131786 3300025960 Bacteria 1915
244 Ga0207651_10723920 3300025960 Bacteria 878
245 Ga0207668_10029450 3300025972 Bacteria 3598
246 Ga0207668_10394265 3300025972 Bacteria 1169
247 Ga0207640_10821683 3300025981 Bacteria 807
248 Ga0207658_10182954 3300025986 Bacteria 1736
249 Ga0207658_10192107 3300025986 Bacteria 1698
250 Ga0207658_10242552 3300025986 Bacteria 1527
251 Ga0207658_11150474 3300025986 Bacteria 709
252 Ga0207658_11377547 3300025986 Bacteria 645
253 Ga0207677_11122058 3300026023 Bacteria 717
254 Ga0207703_10089849 3300026035 Bacteria 2580
255 Ga0207703_11074454 3300026035 Bacteria 773
256 Ga0207639_10259024 3300026041 Bacteria 1520
257 Ga0207678_10147917 3300026067 Bacteria 2005
258 Ga0207678_10602221 3300026067 Bacteria 963
259 Ga0207708_10045422 3300026075 Bacteria 3347
260 Ga0207708_11081730 3300026075 Bacteria 699
261 Ga0207708_11644881 3300026075 Bacteria 564
262 Ga0207702_10111423 3300026078 Bacteria 2434
263 Ga0207702_11029014 3300026078 Bacteria 817
264 Ga0207641_10005610 3300026088 Bacteria 10692
265 Ga0207641_10085398 3300026088 Bacteria 2750
266 Ga0207641_10143529 3300026088 Bacteria 2157
267 Ga0207641_10404199 3300026088 Bacteria 1312
268 Ga0207648_10009263 3300026089 Bacteria 9460
269 Ga0207648_10051051 3300026089 Bacteria 3615
270 Ga0207648_10182186 3300026089 Bacteria 1859
271 Ga0207676_10002437 3300026095 Bacteria 13254
272 Ga0207676_10034416 3300026095 Bacteria 3836
273 Ga0207676_10092438 3300026095 Bacteria 2488
274 Ga0207676_10401216 3300026095 Bacteria 1281
275 Ga0207674_10164680 3300026116 Bacteria 2171
276 Ga0207674_10331778 3300026116 Bacteria 1471
277 Ga0207675_100095184 3300026118 Bacteria 2802
278 Ga0207675_100192232 3300026118 Bacteria 1958
279 Ga0207675_100263295 3300026118 Bacteria 1672
280 Ga0207683_10012858 3300026121 Bacteria 7144
281 Ga0207683_10624582 3300026121 Bacteria 998
282 Ga0207698_10459585 3300026142 Bacteria 1231
283 Ga0209371_1018366 3300027312 Bacteria 1780
284 Ga0268266_10113711 3300028379 Bacteria 2401
285 Ga0268266_10197211 3300028379 Bacteria 1841
286 Ga0268265_10004352 3300028380 Bacteria 9845
287 Ga0268264_10012751 3300028381 Bacteria 6916
288 Ga0268264_10056579 3300028381 Bacteria 3279
289 Ga0268256_1020515 3300030500 Bacteria 1780
290 Ga0265330_10000827 3300031235 Bacteria 19446
291 Ga0265332_10000742 3300031238 Bacteria 20271
292 Ga0265328_10012018 3300031239 Bacteria 3451
293 Ga0265325_10041900 3300031241 Bacteria 2397
294 Ga0265329_10005556 3300031242 Bacteria 5082
295 Ga0265339_10028530 3300031249 Bacteria 3173
296 Ga0265331_10002179 3300031250 Bacteria 13453
297 Ga0265327_10009377 3300031251 Bacteria 7074
298 Ga0265316_10064175 3300031344 Bacteria 2845
299 Ga0265316_10070219 3300031344 Bacteria 2702
300 Ga0265316_10080213 3300031344 Bacteria 2503
301 Ga0307513_10417852 3300031456 Bacteria 1072
302 Ga0265314_10022716 3300031711 Bacteria 4801
303 Ga0265342_10157017 3300031712 Bacteria 1259
304 Ga0307516_10829939 3300031730 Bacteria 587
305 Ga0307405_10115391 3300031731 Bacteria 1827
306 Ga0307406_10071628 3300031901 Bacteria 2272
307 Ga0307407_10023269 3300031903 Bacteria 3231
308 Ga0307409_100011583 3300031995 Bacteria 5572
309 Ga0307416_100025486 3300032002 Bacteria 4335
310 Ga0307414_10485575 3300032004 Bacteria 1090
311 Ga0307507_10259877 3300033179 Bacteria 1110
312 Ga0373956_0527605 3300035119 Bacteria 563
313 Ga0373955_0590795 3300035172 Bacteria 680
314 Ga0373931_0089533 3300035691 Bacteria 1712
315 Ga0373931_0380560 3300035691 Bacteria 890
316 Ga0373935_0490568 3300035692 Bacteria 891
317 Ga0373933_0490409 3300035724 Bacteria 805
318 Ga0373937_1101322 3300036401 Bacteria 743
319 Ga0373937_1911185 3300036401 Bacteria 540
320 Ga0436364_0332482 3300037853 Bacteria 859
321 Ga0395901_0028975 3300038443 Bacteria 5696
322 Ga0436363_1506593 3300039450 Bacteria 622
323 Ga0451853_2291002 3300041512 Bacteria 1043
324 Ga0450888_019531 3300042126 Bacteria 855
325 Ga0450896_010144 3300042133 Bacteria 1319
326 Ga0450904_000138 3300042139 Bacteria 16194
327 Ga0450905_024983 3300042142 Bacteria 898
328 Ga0451577_0181790 3300042876 Bacteria 1896
329 Ga0466957_0006206 3300044842 Bacteria 6747
330 Ga0495592_0000711 3300046454 Bacteria 23301
331 Ga0495590_0007746 3300046457 Bacteria 4125
332 Ga0495590_0052594 3300046457 Bacteria 1422
333 Ga0495638_0014199 3300046460 Bacteria 5391
334 Ga0495605_0030391 3300046474 Bacteria 2770
335 Ga0495606_0237749 3300046507 Bacteria 1017
336 Ga0495628_0001663 3300046516 Bacteria 20314
337 Ga0495632_0000103 3300046519 Bacteria 86898
338 Ga0495648_0015427 3300046524 Bacteria 5549
339 Ga0495663_0000676 3300046525 Bacteria 11748
340 Ga0495652_0035467 3300046529 Bacteria 4342
341 Ga0495621_0026356 3300046539 Bacteria 1960
342 Ga0495621_0052806 3300046539 Bacteria 1457
343 Ga0495645_0001291 3300046543 Bacteria 17090
344 Ga0495668_0053478 3300046616 Bacteria 2232
345 Ga0495625_0414006 3300046660 Bacteria 840
346 Ga0495659_0166912 3300046664 Bacteria 891
347 Ga0495599_0015563 3300046678 Bacteria 4721
348 Ga0495670_0223169 3300046691 Bacteria 1001
349 Ga0495671_0331078 3300046692 Bacteria 731
350 Ga0495672_0001118 3300047320 Bacteria 27190
351 Ga0495684_0315946 3300047471 Bacteria 1118
352 Ga0495686_0000240 3300047472 Bacteria 99258
353 Ga0495626_0362398 3300048091 Bacteria 564
354 Ga0496102_0000582 3300048905 Bacteria 38683
355 Ga0496102_0017162 3300048905 Bacteria 6338
356 Ga0496103_0036390 3300048906 Bacteria 3015
357 Ga0496103_0455487 3300048906 Bacteria 820
358 Ga0496104_0524747 3300048907 Bacteria 1095
359 Ga0496109_0270261 3300048912 Bacteria 1602
360 Ga0496109_0814291 3300048912 Bacteria 872
361 Ga0496112_0076271 3300048915 Bacteria 3316
362 Ga0496113_0554466 3300048916 Bacteria 922
363 Ga0496116_0194818 3300048919 Bacteria 1068
364 Ga0496118_0035347 3300048921 Bacteria 4059
365 Ga0496118_0212984 3300048921 Bacteria 1132
366 Ga0496121_0021889 3300048924 Bacteria 6239
367 Ga0496121_0727392 3300048924 Bacteria 593
368 Ga0496124_0034658 3300048927 Bacteria 4426
369 Ga0496124_0355707 3300048927 Bacteria 1034
370 Ga0496125_0064861 3300048928 Bacteria 2898
371 Ga0496125_0620011 3300048928 Bacteria 587
372 Ga0496126_0758921 3300048929 Bacteria 748
373 Ga0496126_0760304 3300048929 Bacteria 747
374 Ga0501031_0000284 3300049568 Bacteria 28782
375 Ga0501032_0081895 3300049569 Bacteria 2147
376 Ga0501033_0381640 3300049570 Bacteria 984
377 Ga0501036_0000192 3300049572 Bacteria 40581
378 Ga0501037_0000320 3300049573 Bacteria 40774
379 Ga0501038_0001648 3300049574 Bacteria 20798
380 Ga0501039_0995157 3300049575 Bacteria 651
381 Ga0501042_0050146 3300049578 Bacteria 2977
382 Ga0501043_0004616 3300049579 Bacteria 11173
383 Ga0501046_0000647 3300049580 Bacteria 34013
384 Ga0501047_0008114 3300049581 Bacteria 9907
385 Ga0501048_0000386 3300049582 Bacteria 30662
386 Ga0501067_0222016 3300049583 Bacteria 1052
387 Ga0501067_0560218 3300049583 Bacteria 640
388 Ga0501067_0625666 3300049583 Bacteria 604
389 Ga0501068_0272911 3300049584 Bacteria 1080
390 Ga0501069_0090788 3300049585 Bacteria 1727
391 Ga0501070_0000968 3300049586 Bacteria 25770
392 Ga0501073_0006881 3300049589 Bacteria 8460
393 Ga0501074_0069286 3300049590 Bacteria 2536
394 Ga0501075_1231596 3300049591 Bacteria 568
395 Ga0501080_0000167 3300049742 Bacteria 47734
396 Ga0501080_0050400 3300049742 Bacteria 3875
397 Ga0501083_0019368 3300049744 Bacteria 4741
398 Ga0501083_0104786 3300049744 Bacteria 1863
399 Ga0501035_0210054 3300049822 Bacteria 1665
400 Ga0501044_0515349 3300049823 Bacteria 1096
401 nmdc:mga06r32_1249635_c1 3300050510 Bacteria 688
402 nmdc:mga08y16_243344_c1 3300050511 Bacteria 1859
403 nmdc:mga08y16_6369_c1 3300050511 Bacteria 12378
404 nmdc:mga0n895_1944191_c1 3300050512 Bacteria 547
405 nmdc:mga0n895_652540_c1 3300050512 Bacteria 1051
406 nmdc:mga0rr50_1346790_c1 3300050513 Bacteria 605
407 Ga0495601_0041477 3300053077 Bacteria 2885
408 Ga0495619_0343999 3300053085 Bacteria 1032
409 Ga0500592_007189 3300053116 Bacteria 1772
410 Ga0500596_032669 3300053735 Bacteria 811
411 Ga0501084_0000986 3300054114 Bacteria 22070

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026121 Ga0207683_10624582 Ga0207683_106245821 142
2 3300035119 Ga0373956_0527605 Ga0373956_0527605_31_504 154
3 3300035172 Ga0373955_0590795 Ga0373955_0590795_36_509 154
4 3300046524 Ga0495648_0015427 Ga0495648_0015427_433_969 154
5 3300048929 Ga0496126_0760304 Ga0496126_0760304_102_638 154
6 iso_pu_bacteria 2738541308 2738890033 154
7 iso_pu_bacteria 2527291627 2528205141 155
8 iso_pu_bacteria 2527291629 2528216449 155
9 iso_pu_bacteria 2546825537 2546950509 155
10 iso_pu_bacteria 2576861822 2579750459 155
11 iso_pu_bacteria 2622736605 2623498429 155
12 iso_pu_bacteria 2684623036 2686543703 155
13 iso_pu_bacteria 2687453743 2689993218 155
14 iso_pu_bacteria 2710264753 2710604339 155
15 iso_pu_bacteria 2773857924 2774866424 155
16 iso_pu_bacteria 2895880812 2895886116 155
17 iso_pu_bacteria 2898907183 2898907827 155
18 iso_pu_bacteria 637000116 637878393 155
19 iso_pu_bacteria 8055157932 8055161103 155
20 3300020069 Ga0197907_11406288 Ga0197907_114062882 156
21 iso_pu_bacteria 2554235283 2555467360 156
22 iso_pu_bacteria 2593339238 2595448635 156
23 iso_pu_bacteria 2643221556 2643797020 156
24 iso_pu_bacteria 2643221684 2644469876 156
25 iso_pu_bacteria 2643221735 2644740537 156
26 iso_pu_bacteria 2684623153 2686997190 156
27 iso_pu_bacteria 2687453109 2687498496 156
28 iso_pu_bacteria 2811994870 2812316378 156
29 iso_pu_bacteria 2818991440 2819564515 156
30 iso_pu_bacteria 2818991468 2819723451 156
31 iso_pu_bacteria 2823526263 2823528358 156
32 iso_pu_bacteria 2904463128 2904465159 156
33 iso_pu_bacteria 2908665501 2908668436 156
34 iso_pu_bacteria 2919093281 2919096205 156
35 iso_pu_bacteria 2919726948 2919728068 156
36 iso_pu_bacteria 2952252522 2952253569 156
37 iso_pu_bacteria 2954773129 2954774127 156
38 iso_pu_bacteria 8047673197 8047676704 156
39 3300003841 Ga0055541_1003883 Ga0055541_10038833 158
40 3300005295 Ga0065707_10088189 Ga0065707_100881893 158
41 3300005328 Ga0070676_10041738 Ga0070676_100417382 158
42 3300005328 Ga0070676_10231890 Ga0070676_102318902 158
43 3300005328 Ga0070676_10250228 Ga0070676_102502282 158
44 3300005331 Ga0070670_100000633 Ga0070670_1000006338 158
45 3300005331 Ga0070670_100021365 Ga0070670_1000213652 158
46 3300005331 Ga0070670_100046948 Ga0070670_1000469482 158
47 3300005334 Ga0068869_101227640 Ga0068869_1012276402 158
48 3300005336 Ga0070680_100207749 Ga0070680_1002077491 158
49 3300005336 Ga0070680_100331949 Ga0070680_1003319492 158
50 3300005338 Ga0068868_100173648 Ga0068868_1001736481 158
51 3300005338 Ga0068868_100536855 Ga0068868_1005368552 158
52 3300005338 Ga0068868_100633301 Ga0068868_1006333011 158
53 3300005343 Ga0070687_100896281 Ga0070687_1008962811 158
54 3300005344 Ga0070661_100143482 Ga0070661_1001434823 158
55 3300005347 Ga0070668_101579711 Ga0070668_1015797111 158
56 3300005353 Ga0070669_100056850 Ga0070669_1000568502 158
57 3300005353 Ga0070669_100091496 Ga0070669_1000914962 158
58 3300005354 Ga0070675_100009668 Ga0070675_1000096682 158
59 3300005354 Ga0070675_100096616 Ga0070675_1000966162 158
60 3300005354 Ga0070675_100176676 Ga0070675_1001766761 158
61 3300005355 Ga0070671_100053048 Ga0070671_1000530482 158
62 3300005356 Ga0070674_100014239 Ga0070674_1000142395 158
63 3300005356 Ga0070674_100104121 Ga0070674_1001041212 158
64 3300005364 Ga0070673_100032289 Ga0070673_1000322892 158
65 3300005364 Ga0070673_100154233 Ga0070673_1001542332 158
66 3300005364 Ga0070673_100184321 Ga0070673_1001843212 158
67 3300005365 Ga0070688_100044833 Ga0070688_1000448332 158
68 3300005366 Ga0070659_101541272 Ga0070659_1015412721 158
69 3300005367 Ga0070667_100027974 Ga0070667_1000279745 158
70 3300005367 Ga0070667_100143677 Ga0070667_1001436772 158
71 3300005367 Ga0070667_100236235 Ga0070667_1002362352 158
72 3300005434 Ga0070709_10405341 Ga0070709_104053412 158
73 3300005435 Ga0070714_100016152 Ga0070714_1000161525 158
74 3300005435 Ga0070714_101094034 Ga0070714_1010940342 158
75 3300005436 Ga0070713_100000045 Ga0070713_10000004536 158
76 3300005438 Ga0070701_10358443 Ga0070701_103584432 158
77 3300005439 Ga0070711_100734869 Ga0070711_1007348692 158
78 3300005440 Ga0070705_100013781 Ga0070705_1000137812 158
79 3300005441 Ga0070700_100025797 Ga0070700_1000257972 158
80 3300005445 Ga0070708_100563773 Ga0070708_1005637732 158
81 3300005456 Ga0070678_100023293 Ga0070678_1000232933 158
82 3300005456 Ga0070678_100043459 Ga0070678_1000434593 158
83 3300005456 Ga0070678_100476771 Ga0070678_1004767712 158
84 3300005458 Ga0070681_10010693 Ga0070681_100106934 158
85 3300005458 Ga0070681_10188442 Ga0070681_101884422 158
86 3300005459 Ga0068867_100126517 Ga0068867_1001265171 158
87 3300005459 Ga0068867_100128466 Ga0068867_1001284662 158
88 3300005459 Ga0068867_100174658 Ga0068867_1001746582 158
89 3300005459 Ga0068867_100298373 Ga0068867_1002983732 158
90 3300005459 Ga0068867_100928434 Ga0068867_1009284342 158
91 3300005467 Ga0070706_100144572 Ga0070706_1001445722 158
92 3300005530 Ga0070679_100025287 Ga0070679_1000252874 158
93 3300005543 Ga0070672_100005876 Ga0070672_1000058765 158
94 3300005543 Ga0070672_101248129 Ga0070672_1012481292 158
95 3300005545 Ga0070695_100423280 Ga0070695_1004232801 158
96 3300005548 Ga0070665_100172464 Ga0070665_1001724642 158
97 3300005548 Ga0070665_100188944 Ga0070665_1001889442 158
98 3300005563 Ga0068855_100017081 Ga0068855_1000170815 158
99 3300005563 Ga0068855_100096410 Ga0068855_1000964102 158
100 3300005578 Ga0068854_100263813 Ga0068854_1002638132 158
101 3300005578 Ga0068854_100865004 Ga0068854_1008650042 158
102 3300005614 Ga0068856_100053067 Ga0068856_1000530672 158
103 3300005615 Ga0070702_100152035 Ga0070702_1001520352 158
104 3300005616 Ga0068852_100114232 Ga0068852_1001142322 158
105 3300005617 Ga0068859_100087064 Ga0068859_1000870642 158
106 3300005617 Ga0068859_100187070 Ga0068859_1001870702 158
107 3300005618 Ga0068864_100002031 Ga0068864_10000203112 158
108 3300005618 Ga0068864_100062329 Ga0068864_1000623293 158
109 3300005618 Ga0068864_100103026 Ga0068864_1001030262 158
110 3300005618 Ga0068864_100117343 Ga0068864_1001173432 158
111 3300005719 Ga0068861_100046051 Ga0068861_1000460512 158
112 3300005719 Ga0068861_100124016 Ga0068861_1001240162 158
113 3300005719 Ga0068861_100237839 Ga0068861_1002378392 158
114 3300005719 Ga0068861_100333782 Ga0068861_1003337822 158
115 3300005840 Ga0068870_10005217 Ga0068870_100052173 158
116 3300005841 Ga0068863_100001012 Ga0068863_10000101218 158
117 3300005841 Ga0068863_100008918 Ga0068863_1000089183 158
118 3300005841 Ga0068863_100104465 Ga0068863_1001044652 158
119 3300005841 Ga0068863_100319161 Ga0068863_1003191612 158
120 3300005841 Ga0068863_101194934 Ga0068863_1011949342 158
121 3300005842 Ga0068858_100612373 Ga0068858_1006123732 158
122 3300005843 Ga0068860_100062604 Ga0068860_1000626042 158
123 3300005843 Ga0068860_100072296 Ga0068860_1000722962 158
124 3300005843 Ga0068860_100731918 Ga0068860_1007319182 158
125 3300005844 Ga0068862_100175695 Ga0068862_1001756952 158
126 3300005937 Ga0081455_10109569 Ga0081455_101095693 158
127 3300005985 Ga0081539_10064776 Ga0081539_100647762 158
128 3300005985 Ga0081539_10330468 Ga0081539_103304681 158
129 3300006237 Ga0097621_100515590 Ga0097621_1005155902 158
130 3300006237 Ga0097621_100860618 Ga0097621_1008606182 158
131 3300006358 Ga0068871_100016629 Ga0068871_1000166293 158
132 3300006358 Ga0068871_100164489 Ga0068871_1001644892 158
133 3300006358 Ga0068871_100397430 Ga0068871_1003974302 158
134 3300006871 Ga0075434_100903872 Ga0075434_1009038722 158
135 3300006871 Ga0075434_101739915 Ga0075434_1017399151 158
136 3300006881 Ga0068865_100094776 Ga0068865_1000947762 158
137 3300006931 Ga0097620_100087062 Ga0097620_1000870622 158
138 3300006931 Ga0097620_100187065 Ga0097620_1001870652 158
139 3300007076 Ga0075435_101227297 Ga0075435_1012272971 158
140 3300009093 Ga0105240_10568731 Ga0105240_105687312 158
141 3300009093 Ga0105240_11285348 Ga0105240_112853482 158
142 3300009093 Ga0105240_11307642 Ga0105240_113076421 158
143 3300009148 Ga0105243_10343714 Ga0105243_103437142 158
144 3300009174 Ga0105241_10626151 Ga0105241_106261512 158
145 3300009176 Ga0105242_10026291 Ga0105242_100262913 158
146 3300009177 Ga0105248_10382145 Ga0105248_103821452 158
147 3300009177 Ga0105248_11015314 Ga0105248_110153141 158
148 3300009177 Ga0105248_11489789 Ga0105248_114897892 158
149 3300009553 Ga0105249_10016107 Ga0105249_100161072 158
150 3300009553 Ga0105249_10132706 Ga0105249_101327061 158
151 3300010375 Ga0105239_11075160 Ga0105239_110751601 158
152 3300013102 Ga0157371_10485684 Ga0157371_104856841 158
153 3300013297 Ga0157378_10138105 Ga0157378_101381052 158
154 3300013297 Ga0157378_10288327 Ga0157378_102883272 158
155 3300013297 Ga0157378_10431960 Ga0157378_104319602 158
156 3300013297 Ga0157378_10473348 Ga0157378_104733482 158
157 3300013306 Ga0163162_10112783 Ga0163162_101127832 158
158 3300013306 Ga0163162_10118774 Ga0163162_101187742 158
159 3300013306 Ga0163162_10734288 Ga0163162_107342882 158
160 3300013306 Ga0163162_11910899 Ga0163162_119108991 158
161 3300013307 Ga0157372_10067969 Ga0157372_100679693 158
162 3300013307 Ga0157372_10115781 Ga0157372_101157812 158
163 3300013308 Ga0157375_10070799 Ga0157375_100707993 158
164 3300013308 Ga0157375_10184129 Ga0157375_101841292 158
165 3300014325 Ga0163163_10001413 Ga0163163_1000141311 158
166 3300014325 Ga0163163_10163511 Ga0163163_101635112 158
167 3300014325 Ga0163163_10268054 Ga0163163_102680542 158
168 3300014325 Ga0163163_10557404 Ga0163163_105574042 158
169 3300014326 Ga0157380_10001571 Ga0157380_100015714 158
170 3300014326 Ga0157380_10424795 Ga0157380_104247952 158
171 3300014326 Ga0157380_10443879 Ga0157380_104438792 158
172 3300014968 Ga0157379_11609750 Ga0157379_116097501 158
173 3300014969 Ga0157376_10692347 Ga0157376_106923472 158
174 3300017792 Ga0163161_10204617 Ga0163161_102046172 158
175 3300017792 Ga0163161_10299371 Ga0163161_102993712 158
176 3300025225 Ga0209566_100097 Ga0209566_10009728 158
177 3300025315 Ga0207697_10191487 Ga0207697_101914872 158
178 3300025893 Ga0207682_10494048 Ga0207682_104940481 158
179 3300025901 Ga0207688_10500009 Ga0207688_105000091 158
180 3300025907 Ga0207645_10141155 Ga0207645_101411552 158
181 3300025907 Ga0207645_10172803 Ga0207645_101728032 158
182 3300025907 Ga0207645_10199051 Ga0207645_101990512 158
183 3300025907 Ga0207645_10214783 Ga0207645_102147832 158
184 3300025908 Ga0207643_10004486 Ga0207643_100044863 158
185 3300025910 Ga0207684_10406346 Ga0207684_104063462 158
186 3300025911 Ga0207654_10188277 Ga0207654_101882772 158
187 3300025912 Ga0207707_10009698 Ga0207707_100096986 158
188 3300025913 Ga0207695_10678802 Ga0207695_106788022 158
189 3300025913 Ga0207695_11045732 Ga0207695_110457321 158
190 3300025916 Ga0207663_10431676 Ga0207663_104316762 158
191 3300025917 Ga0207660_10080808 Ga0207660_100808081 158
192 3300025917 Ga0207660_10102863 Ga0207660_101028633 158
193 3300025920 Ga0207649_10086652 Ga0207649_100866522 158
194 3300025920 Ga0207649_10143289 Ga0207649_101432892 158
195 3300025921 Ga0207652_10047401 Ga0207652_100474014 158
196 3300025921 Ga0207652_10743565 Ga0207652_107435651 158
197 3300025923 Ga0207681_10028950 Ga0207681_100289502 158
198 3300025923 Ga0207681_10083890 Ga0207681_100838902 158
199 3300025923 Ga0207681_10655725 Ga0207681_106557252 158
200 3300025923 Ga0207681_11199809 Ga0207681_111998091 158
201 3300025925 Ga0207650_10086610 Ga0207650_100866102 158
202 3300025925 Ga0207650_10813199 Ga0207650_108131992 158
203 3300025926 Ga0207659_10077891 Ga0207659_100778912 158
204 3300025926 Ga0207659_10123433 Ga0207659_101234332 158
205 3300025926 Ga0207659_10264317 Ga0207659_102643172 158
206 3300025928 Ga0207700_10000051 Ga0207700_1000005135 158
207 3300025928 Ga0207700_10376502 Ga0207700_103765021 158
208 3300025929 Ga0207664_10068058 Ga0207664_100680582 158
209 3300025929 Ga0207664_10868639 Ga0207664_108686392 158
210 3300025933 Ga0207706_10139384 Ga0207706_101393842 158
211 3300025934 Ga0207686_10106072 Ga0207686_101060722 158
212 3300025934 Ga0207686_10299746 Ga0207686_102997462 158
213 3300025935 Ga0207709_10493954 Ga0207709_104939542 158
214 3300025935 Ga0207709_10509978 Ga0207709_105099781 158
215 3300025936 Ga0207670_10244250 Ga0207670_102442502 158
216 3300025938 Ga0207704_10117220 Ga0207704_101172202 158
217 3300025938 Ga0207704_10504916 Ga0207704_105049162 158
218 3300025940 Ga0207691_10012296 Ga0207691_100122962 158
219 3300025940 Ga0207691_10014212 Ga0207691_100142123 158
220 3300025940 Ga0207691_10518937 Ga0207691_105189371 158
221 3300025941 Ga0207711_10167852 Ga0207711_101678522 158
222 3300025941 Ga0207711_10341557 Ga0207711_103415572 158
223 3300025942 Ga0207689_10036842 Ga0207689_100368422 158
224 3300025942 Ga0207689_10737894 Ga0207689_107378942 158
225 3300025944 Ga0207661_11206532 Ga0207661_112065321 158
226 3300025945 Ga0207679_10551857 Ga0207679_105518572 158
227 3300025949 Ga0207667_10309631 Ga0207667_103096312 158
228 3300025949 Ga0207667_10538616 Ga0207667_105386162 158
229 3300025960 Ga0207651_10131786 Ga0207651_101317862 158
230 3300025960 Ga0207651_10723920 Ga0207651_107239201 158
231 3300025972 Ga0207668_10029450 Ga0207668_100294502 158
232 3300025972 Ga0207668_10394265 Ga0207668_103942652 158
233 3300025981 Ga0207640_10821683 Ga0207640_108216832 158
234 3300025986 Ga0207658_10182954 Ga0207658_101829541 158
235 3300025986 Ga0207658_10192107 Ga0207658_101921072 158
236 3300025986 Ga0207658_10242552 Ga0207658_102425521 158
237 3300025986 Ga0207658_11150474 Ga0207658_111504742 158
238 3300025986 Ga0207658_11377547 Ga0207658_113775472 158
239 3300026023 Ga0207677_11122058 Ga0207677_111220582 158
240 3300026035 Ga0207703_10089849 Ga0207703_100898492 158
241 3300026035 Ga0207703_11074454 Ga0207703_110744542 158
242 3300026067 Ga0207678_10147917 Ga0207678_101479171 158
243 3300026067 Ga0207678_10602221 Ga0207678_106022212 158
244 3300026075 Ga0207708_10045422 Ga0207708_100454222 158
245 3300026075 Ga0207708_11644881 Ga0207708_116448811 158
246 3300026078 Ga0207702_10111423 Ga0207702_101114232 158
247 3300026078 Ga0207702_11029014 Ga0207702_110290141 158
248 3300026088 Ga0207641_10005610 Ga0207641_100056102 158
249 3300026088 Ga0207641_10085398 Ga0207641_100853982 158
250 3300026088 Ga0207641_10143529 Ga0207641_101435292 158
251 3300026088 Ga0207641_10404199 Ga0207641_104041992 158
252 3300026089 Ga0207648_10009263 Ga0207648_100092632 158
253 3300026089 Ga0207648_10051051 Ga0207648_100510512 158
254 3300026089 Ga0207648_10182186 Ga0207648_101821861 158
255 3300026095 Ga0207676_10002437 Ga0207676_100024377 158
256 3300026095 Ga0207676_10034416 Ga0207676_100344162 158
257 3300026095 Ga0207676_10092438 Ga0207676_100924382 158
258 3300026095 Ga0207676_10401216 Ga0207676_104012162 158
259 3300026116 Ga0207674_10331778 Ga0207674_103317782 158
260 3300026118 Ga0207675_100095184 Ga0207675_1000951842 158
261 3300026118 Ga0207675_100192232 Ga0207675_1001922322 158
262 3300026118 Ga0207675_100263295 Ga0207675_1002632952 158
263 3300026121 Ga0207683_10012858 Ga0207683_100128582 158
264 3300026142 Ga0207698_10459585 Ga0207698_104595851 158
265 3300028379 Ga0268266_10113711 Ga0268266_101137112 158
266 3300028379 Ga0268266_10197211 Ga0268266_101972112 158
267 3300028380 Ga0268265_10004352 Ga0268265_100043522 158
268 3300028381 Ga0268264_10012751 Ga0268264_100127513 158
269 3300028381 Ga0268264_10056579 Ga0268264_100565792 158
270 3300031235 Ga0265330_10000827 Ga0265330_1000082716 158
271 3300031238 Ga0265332_10000742 Ga0265332_100007428 158
272 3300031239 Ga0265328_10012018 Ga0265328_100120182 158
273 3300031241 Ga0265325_10041900 Ga0265325_100419002 158
274 3300031242 Ga0265329_10005556 Ga0265329_100055562 158
275 3300031249 Ga0265339_10028530 Ga0265339_100285303 158
276 3300031250 Ga0265331_10002179 Ga0265331_100021794 158
277 3300031251 Ga0265327_10009377 Ga0265327_100093772 158
278 3300031344 Ga0265316_10064175 Ga0265316_100641752 158
279 3300031344 Ga0265316_10070219 Ga0265316_100702191 158
280 3300031344 Ga0265316_10080213 Ga0265316_100802132 158
281 3300031456 Ga0307513_10417852 Ga0307513_104178522 158
282 3300031711 Ga0265314_10022716 Ga0265314_100227162 158
283 3300031712 Ga0265342_10157017 Ga0265342_101570172 158
284 3300031731 Ga0307405_10115391 Ga0307405_101153912 158
285 3300031901 Ga0307406_10071628 Ga0307406_100716282 158
286 3300031995 Ga0307409_100011583 Ga0307409_1000115834 158
287 3300032002 Ga0307416_100025486 Ga0307416_1000254863 158
288 3300032004 Ga0307414_10485575 Ga0307414_104855752 158
289 3300035691 Ga0373931_0380560 Ga0373931_0380560_276_782 158
290 3300035692 Ga0373935_0490568 Ga0373935_0490568_72_551 158
291 3300035724 Ga0373933_0490409 Ga0373933_0490409_70_549 158
292 3300036401 Ga0373937_1101322 Ga0373937_1101322_107_586 158
293 3300036401 Ga0373937_1911185 Ga0373937_1911185_46_525 158
294 3300041512 Ga0451853_2291002 Ga0451853_2291002_18_497 158
295 3300042126 Ga0450888_019531 Ga0450888_019531_265_744 158
296 3300042133 Ga0450896_010144 Ga0450896_010144_825_1304 158
297 3300046525 Ga0495663_0000676 Ga0495663_0000676_9802_10281 158
298 3300046539 Ga0495621_0026356 Ga0495621_0026356_1187_1666 158
299 3300046539 Ga0495621_0052806 Ga0495621_0052806_854_1333 158
300 3300046616 Ga0495668_0053478 Ga0495668_0053478_903_1382 158
301 3300046664 Ga0495659_0166912 Ga0495659_0166912_384_863 158
302 3300046691 Ga0495670_0223169 Ga0495670_0223169_88_567 158
303 3300047471 Ga0495684_0315946 Ga0495684_0315946_40_519 158
304 3300048905 Ga0496102_0000582 Ga0496102_0000582_15026_15502 158
305 3300048906 Ga0496103_0455487 Ga0496103_0455487_15_491 158
306 3300048907 Ga0496104_0524747 Ga0496104_0524747_552_1085 158
307 3300048912 Ga0496109_0270261 Ga0496109_0270261_1050_1529 158
308 3300048912 Ga0496109_0814291 Ga0496109_0814291_173_706 158
309 3300048915 Ga0496112_0076271 Ga0496112_0076271_1245_1814 158
310 3300048916 Ga0496113_0554466 Ga0496113_0554466_89_568 158
311 3300048921 Ga0496118_0035347 Ga0496118_0035347_1065_1544 158
312 3300048928 Ga0496125_0064861 Ga0496125_0064861_1009_1488 158
313 3300049568 Ga0501031_0000284 Ga0501031_0000284_9917_10396 158
314 3300049569 Ga0501032_0081895 Ga0501032_0081895_1186_1665 158
315 3300049570 Ga0501033_0381640 Ga0501033_0381640_494_973 158
316 3300049572 Ga0501036_0000192 Ga0501036_0000192_29233_29712 158
317 3300049573 Ga0501037_0000320 Ga0501037_0000320_22722_23201 158
318 3300049574 Ga0501038_0001648 Ga0501038_0001648_10400_10879 158
319 3300049575 Ga0501039_0995157 Ga0501039_0995157_26_505 158
320 3300049578 Ga0501042_0050146 Ga0501042_0050146_102_581 158
321 3300049579 Ga0501043_0004616 Ga0501043_0004616_10474_10953 158
322 3300049580 Ga0501046_0000647 Ga0501046_0000647_15941_16420 158
323 3300049581 Ga0501047_0008114 Ga0501047_0008114_8947_9426 158
324 3300049582 Ga0501048_0000386 Ga0501048_0000386_10091_10570 158
325 3300049583 Ga0501067_0222016 Ga0501067_0222016_431_910 158
326 3300049583 Ga0501067_0560218 Ga0501067_0560218_130_609 158
327 3300049583 Ga0501067_0625666 Ga0501067_0625666_97_576 158
328 3300049584 Ga0501068_0272911 Ga0501068_0272911_487_966 158
329 3300049585 Ga0501069_0090788 Ga0501069_0090788_180_659 158
330 3300049586 Ga0501070_0000968 Ga0501070_0000968_15372_15851 158
331 3300049589 Ga0501073_0006881 Ga0501073_0006881_6278_6757 158
332 3300049590 Ga0501074_0069286 Ga0501074_0069286_634_1113 158
333 3300049742 Ga0501080_0000167 Ga0501080_0000167_38335_38814 158
334 3300049742 Ga0501080_0050400 Ga0501080_0050400_3211_3690 158
335 3300049744 Ga0501083_0019368 Ga0501083_0019368_3224_3703 158
336 3300049744 Ga0501083_0104786 Ga0501083_0104786_580_1059 158
337 3300049822 Ga0501035_0210054 Ga0501035_0210054_103_582 158
338 3300050512 nmdc:mga0n895_1944191_c1 nmdc:mga0n895_1944191_c1_16_495 158
339 3300050512 nmdc:mga0n895_652540_c1 nmdc:mga0n895_652540_c1_139_618 158
340 3300050513 nmdc:mga0rr50_1346790_c1 nmdc:mga0rr50_1346790_c1_58_537 158
341 3300053085 Ga0495619_0343999 Ga0495619_0343999_93_572 158
342 3300053116 Ga0500592_007189 Ga0500592_007189_307_786 158
343 3300054114 Ga0501084_0000986 Ga0501084_0000986_16579_17058 158
344 iso_pu_bacteria 8001522603 8001523034 158
345 3300003322 rootL2_10272610 rootL2_102726102 159
346 3300003762 Ga0055542_1034910 Ga0055542_10349101 159
347 3300005295 Ga0065707_10279805 Ga0065707_102798051 159
348 3300005340 Ga0070689_100351933 Ga0070689_1003519333 159
349 3300005353 Ga0070669_100467221 Ga0070669_1004672211 159
350 3300005440 Ga0070705_100469087 Ga0070705_1004690872 159
351 3300005441 Ga0070700_101190325 Ga0070700_1011903251 159
352 3300005458 Ga0070681_10037655 Ga0070681_100376551 159
353 3300005539 Ga0068853_100007284 Ga0068853_10000728411 159
354 3300005549 Ga0070704_100055851 Ga0070704_1000558512 159
355 3300005549 Ga0070704_100225993 Ga0070704_1002259933 159
356 3300005577 Ga0068857_100042836 Ga0068857_1000428366 159
357 3300005578 Ga0068854_100447288 Ga0068854_1004472882 159
358 3300005844 Ga0068862_101142204 Ga0068862_1011422041 159
359 3300006358 Ga0068871_100121598 Ga0068871_1001215981 159
360 3300006358 Ga0068871_100511966 Ga0068871_1005119662 159
361 3300009093 Ga0105240_10654527 Ga0105240_106545272 159
362 3300009094 Ga0111539_10002361 Ga0111539_1000236112 159
363 3300009094 Ga0111539_10120010 Ga0111539_101200102 159
364 3300009094 Ga0111539_10490759 Ga0111539_104907591 159
365 3300009098 Ga0105245_10945178 Ga0105245_109451781 159
366 3300009174 Ga0105241_10006078 Ga0105241_100060789 159
367 3300009545 Ga0105237_10009802 Ga0105237_100098028 159
368 3300009551 Ga0105238_10255328 Ga0105238_102553284 159
369 3300010375 Ga0105239_10030609 Ga0105239_100306098 159
370 3300013105 Ga0157369_10430164 Ga0157369_104301642 159
371 3300013307 Ga0157372_10157926 Ga0157372_101579265 159
372 3300014326 Ga0157380_10021704 Ga0157380_100217045 159
373 3300014326 Ga0157380_11588595 Ga0157380_115885952 159
374 3300025226 Ga0209674_100543 Ga0209674_10054314 159
375 3300025233 Ga0209437_101063 Ga0209437_1010632 159
376 3300025254 Ga0209148_1002298 Ga0209148_10022987 159
377 3300025304 Ga0209257_1065535 Ga0209257_10655351 159
378 3300025911 Ga0207654_10012943 Ga0207654_100129434 159
379 3300025912 Ga0207707_10075573 Ga0207707_100755734 159
380 3300025914 Ga0207671_10023358 Ga0207671_100233588 159
381 3300025924 Ga0207694_10270939 Ga0207694_102709393 159
382 3300025936 Ga0207670_10885068 Ga0207670_108850681 159
383 3300025944 Ga0207661_10752633 Ga0207661_107526331 159
384 3300026041 Ga0207639_10259024 Ga0207639_102590241 159
385 3300026075 Ga0207708_11081730 Ga0207708_110817302 159
386 3300026116 Ga0207674_10164680 Ga0207674_101646803 159
387 3300027312 Ga0209371_1018366 Ga0209371_10183661 159
388 3300030500 Ga0268256_1020515 Ga0268256_10205151 159
389 3300031730 Ga0307516_10829939 Ga0307516_108299391 159
390 3300033179 Ga0307507_10259877 Ga0307507_102598772 159
391 3300042142 Ga0450905_024983 Ga0450905_024983_366_857 159
392 3300046457 Ga0495590_0007746 Ga0495590_0007746_3133_3612 159
393 3300046457 Ga0495590_0052594 Ga0495590_0052594_430_909 159
394 3300046507 Ga0495606_0237749 Ga0495606_0237749_95_574 159
395 3300046692 Ga0495671_0331078 Ga0495671_0331078_143_625 159
396 3300048905 Ga0496102_0017162 Ga0496102_0017162_5429_5965 159
397 3300048906 Ga0496103_0036390 Ga0496103_0036390_290_826 159
398 3300048921 Ga0496118_0212984 Ga0496118_0212984_165_701 159
399 3300048924 Ga0496121_0021889 Ga0496121_0021889_1944_2480 159
400 3300048927 Ga0496124_0355707 Ga0496124_0355707_515_1009 159
401 3300048929 Ga0496126_0758921 Ga0496126_0758921_97_630 159
402 3300049591 Ga0501075_1231596 Ga0501075_1231596_43_528 159
403 3300049823 Ga0501044_0515349 Ga0501044_0515349_497_976 159
404 3300050511 nmdc:mga08y16_243344_c1 nmdc:mga08y16_243344_c1_1249_1755 159
405 3300050511 nmdc:mga08y16_6369_c1 nmdc:mga08y16_6369_c1_8243_8767 159
406 3300053735 Ga0500596_032669 Ga0500596_032669_12_491 159
407 iso_pu_bacteria 2932398195 2932400944 159
408 3300003187 JGI25151J46595_10000006 JGI25151J46595_1000000685 160
409 3300003187 JGI25151J46595_10000029 JGI25151J46595_10000029121 160
410 3300003578 Ga0006562J51391_1000076 Ga0006562J51391_10000763 160
411 3300005471 Ga0070698_100012282 Ga0070698_10001228210 160
412 3300006028 Ga0070717_10036549 Ga0070717_100365495 160
413 3300006847 Ga0075431_101369443 Ga0075431_1013694431 160
414 3300009093 Ga0105240_10715323 Ga0105240_107153232 160
415 3300013105 Ga0157369_10319333 Ga0157369_103193332 160
416 3300013307 Ga0157372_10126206 Ga0157372_101262062 160
417 3300025294 Ga0209025_1000001 Ga0209025_1000001909 160
418 3300025294 Ga0209025_1034540 Ga0209025_10345401 160
419 3300025910 Ga0207684_10202259 Ga0207684_102022593 160
420 3300031903 Ga0307407_10023269 Ga0307407_100232694 160
421 3300035691 Ga0373931_0089533 Ga0373931_0089533_929_1420 160
422 3300037853 Ga0436364_0332482 Ga0436364_0332482_150_689 160
423 3300038443 Ga0395901_0028975 Ga0395901_0028975_1432_2010 160
424 3300039450 Ga0436363_1506593 Ga0436363_1506593_17_598 160
425 3300042139 Ga0450904_000138 Ga0450904_000138_9378_9860 160
426 3300042876 Ga0451577_0181790 Ga0451577_0181790_525_1013 160
427 3300044842 Ga0466957_0006206 Ga0466957_0006206_5136_5618 160
428 3300046454 Ga0495592_0000711 Ga0495592_0000711_7118_7603 160
429 3300046460 Ga0495638_0014199 Ga0495638_0014199_843_1328 160
430 3300046474 Ga0495605_0030391 Ga0495605_0030391_397_897 160
431 3300046516 Ga0495628_0001663 Ga0495628_0001663_3371_3856 160
432 3300046519 Ga0495632_0000103 Ga0495632_0000103_24630_25112 160
433 3300046529 Ga0495652_0035467 Ga0495652_0035467_2766_3251 160
434 3300046543 Ga0495645_0001291 Ga0495645_0001291_3238_3723 160
435 3300046660 Ga0495625_0414006 Ga0495625_0414006_303_788 160
436 3300046678 Ga0495599_0015563 Ga0495599_0015563_661_1146 160
437 3300047320 Ga0495672_0001118 Ga0495672_0001118_19823_20305 160
438 3300047472 Ga0495686_0000240 Ga0495686_0000240_13525_14007 160
439 3300048091 Ga0495626_0362398 Ga0495626_0362398_68_553 160
440 3300048919 Ga0496116_0194818 Ga0496116_0194818_111_593 160
441 3300048924 Ga0496121_0727392 Ga0496121_0727392_63_545 160
442 3300048927 Ga0496124_0034658 Ga0496124_0034658_1130_1696 160
443 3300048928 Ga0496125_0620011 Ga0496125_0620011_10_492 160
444 3300050510 nmdc:mga06r32_1249635_c1 nmdc:mga06r32_1249635_c1_67_558 160
445 3300053077 Ga0495601_0041477 Ga0495601_0041477_966_1451 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00255

GSHPx

Glutathione peroxidase

17

124

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2v1m-assembly1.cif.gz_A crystal structure of schistosoma mansoni glutathione peroxidase 0.9571 1 160
2wgr-assembly1.cif.gz_A combining crystallography and molecular dynamics: the case of schistosoma mansoni phospholipid glutathione peroxidase 0.9544 1 160
2v1m-assembly1.cif.gz_A crystal structure of schistosoma mansoni glutathione peroxidase 0.9512 1 160
2wgr-assembly1.cif.gz_A combining crystallography and molecular dynamics: the case of schistosoma mansoni phospholipid glutathione peroxidase 0.9487 1 160
2vup-assembly1.cif.gz_A crystal structure of a type ii tryparedoxin-dependant peroxidase from trypanosoma brucei 0.9479 1 160
ID Description Score Start End Superfamily
af_Q2FUZ6_1_164_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9635 2 160 3.40.30.10
af_O59858_1_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9536 1 157 3.40.30.10
af_A8WFK6_20_197_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9462 1 160 3.40.30.10
af_Q2FUZ6_1_164_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9459 2 160 3.40.30.10
af_Q59WD3_4_171_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9425 3 160 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A0X8KD42-F1-model_v4 deleted 0.9726 1 160
AF-A0A840RKJ5-F1-model_v4 Glutathione peroxidase 0.9713 1 157 GO:0004601
GO:0034599
AF-E4PRE9-F1-model_v4 Glutathione peroxidase 0.971 1 157 GO:0004601
GO:0034599
AF-A0A0C2V2C8-F1-model_v4 Glutathione peroxidase 0.9704 1 158 GO:0004601
GO:0034599
AF-A0A378Z982-F1-model_v4 deleted 0.9702 1 157

Feature Viewer

pLDDT pTM Quality
87.41 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map