F445588

General Info

Members Datasets Scaffolds Average Seq Length
445 275 890 351

Family's Representative Sequence

Representative Sequence 3300046679|Ga0495623_0002136|Ga0495623_0002136_8306_9460
Length 384
Sequence MKFAHAQAFVRRQPSLSILSLVRSVIGHVAPIALSYGALEIMLHDLPAIQKNVHWGYFDAALAPALIVESGDFVRAEAITHHAGDAPDLMMDDKVRALYDTIPESDRQPGVHLMTGPIFVKDAKPGDLLEVRYLQMIPRFNYGSNLAAHWGHLFTDFEKERVTIYELDQASNTAHALYAYDYPGKYLVPGKRTEVRDCCRELALEGIRVPVRPHLGTAGVAPDVAGRVSTVPPGAHGGNIDNWRIGAGSTMYYPVAVDGGLFSIGDPHVSQGDGEISGTAIEASLNVMFQIVLRRDFAFPSPLLETPDFWIVHGFDEDLDVATKNASRDMVLLLTEQQGLSRDDAYSLMSVAADFSVTQVVDGRQGIHCKIPRSIFPPKKKPRA

Samples

Sample ID Description Type Environment
1 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
33 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
43 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
48 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
51 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
52 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
79 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
80 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
83 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
84 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
85 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
86 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
87 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
88 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
91 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
94 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
95 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
98 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
99 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
102 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
104 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
107 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
108 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
109 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
110 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
111 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
112 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
113 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
114 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
115 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
116 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
117 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
118 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
122 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
123 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
124 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
125 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
126 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
127 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
130 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
131 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
132 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
133 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
136 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
137 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
138 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
139 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
140 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
141 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
142 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
143 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
144 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
145 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
149 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
150 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
151 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
152 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
153 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
154 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
155 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
156 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
161 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
162 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
172 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
173 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
174 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
175 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
176 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
177 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
178 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
181 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
185 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
186 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
187 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
188 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
189 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
190 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
191 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
192 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
193 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
194 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
195 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
196 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
197 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
198 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
199 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
200 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
201 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
202 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
203 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
204 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
205 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
206 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
207 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
208 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
209 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
210 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
211 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
212 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
213 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
214 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
215 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
216 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
217 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
218 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
219 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
220 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
221 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
222 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
223 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
224 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
225 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
226 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
227 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
228 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
229 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
230 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
231 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
232 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
233 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
234 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
235 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
236 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
237 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
238 2643221583 Caulobacter sp. Root655 Isolate Unclassified
239 2643221584 Caulobacter sp. Root656 Isolate Unclassified
240 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
241 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
242 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
243 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
244 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
245 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
246 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
247 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
248 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
249 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
250 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
251 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
252 2818991435 Caulobacter henricii 536 Isolate Unclassified
253 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
254 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
255 2842733646 Variovorax sp. R-72446 Isolate Unclassified
256 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
257 2849560528 Caulobacter zeae 410 Isolate Unclassified
258 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
259 2851153111 Caulobacter radicis 736 Isolate Unclassified
260 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
261 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
262 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
263 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
264 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
265 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
266 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
267 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
268 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
269 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
270 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
271 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
272 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
273 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
274 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
275 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.76
Metatranscriptomes 0
Isolates 11.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.49
Nodule 1.12
Rhizoplane 2.7
Rhizosphere 55.51
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495623_0002136 3300046679 Bacteria 13201
2 SwRhRL2b_contig_3178000 2162886007 Bacteria 36079
3 JGI24739J22299_10005888 3300001989 Bacteria 4642
4 JGI24735J21928_10002669 3300002067 Bacteria 6165
5 JGI24738J21930_10003179 3300002075 Bacteria 4194
6 JGI25156J39149_1000462 3300002705 Bacteria 24626
7 JGI25165J46597_1000743 3300003214 Bacteria 25157
8 Ga0055533_1000072 3300003756 Bacteria 144571
9 Ga0055527_1000010 3300003760 Bacteria 380677
10 Ga0055535_1000010 3300003761 Bacteria 380677
11 Ga0055542_1000016 3300003762 Bacteria 380677
12 Ga0055529_1000012 3300003763 Bacteria 380677
13 Ga0055537_1005565 3300003773 Bacteria 3360
14 Ga0055528_1012470 3300003790 Bacteria 3293
15 Ga0055531_10001500 3300003794 Bacteria 17140
16 Ga0055531_10001617 3300003794 Bacteria 16338
17 Ga0065165_1000388 3300005262 Bacteria 71380
18 Ga0065704_10000204 3300005289 Bacteria 211587
19 Ga0070682_100117971 3300005337 Bacteria 1777
20 Ga0070669_100003645 3300005353 Bacteria 11103
21 Ga0070667_100091165 3300005367 Bacteria 2620
22 Ga0070665_100001383 3300005548 Bacteria 28589
23 Ga0070665_100063803 3300005548 Bacteria 3694
24 Ga0068864_100000257 3300005618 Bacteria 47415
25 Ga0068863_100000167 3300005841 Bacteria 70943
26 Ga0068858_100000198 3300005842 Bacteria 64645
27 Ga0068858_100202773 3300005842 Bacteria 1876
28 Ga0075368_10009749 3300006042 Bacteria 3461
29 Ga0075363_100013025 3300006048 Bacteria 4019
30 Ga0075364_10002414 3300006051 Bacteria 10469
31 Ga0075367_10020023 3300006178 Bacteria 3720
32 Ga0075369_10004735 3300006186 Bacteria 5049
33 Ga0075366_10017756 3300006195 Bacteria 4100
34 Ga0075366_10091818 3300006195 Bacteria 1819
35 Ga0075370_10009372 3300006353 Bacteria 5079
36 Ga0075370_10080838 3300006353 Bacteria 1868
37 Ga0099795_10033041 3300007788 Bacteria 1794
38 Ga0105250_10010246 3300009092 Bacteria 3908
39 Ga0105240_10184904 3300009093 Bacteria 2455
40 Ga0105247_10124876 3300009101 Bacteria 1671
41 Ga0105248_10058074 3300009177 Bacteria 4344
42 Ga0105248_10072307 3300009177 Bacteria 3876
43 Ga0105238_10036968 3300009551 Bacteria 4965
44 Ga0163162_10007506 3300013306 Bacteria 10617
45 Ga0157375_10016284 3300013308 Bacteria 6672
46 Ga0182008_10000057 3300014497 Bacteria 100700
47 Ga0157379_10009689 3300014968 Bacteria 8386
48 Ga0213872_10027062 3300021361 Bacteria 2633
49 Ga0209674_100011 3300025226 Bacteria 997175
50 Ga0209672_100002 3300025228 Bacteria 1733325
51 Ga0209147_100003 3300025229 Bacteria 1733325
52 Ga0209563_100511 3300025230 Bacteria 13177
53 Ga0207427_100818 3300025231 Bacteria 14041
54 Ga0209258_100042 3300025242 Bacteria 380729
55 Ga0209148_1000006 3300025254 Bacteria 1733325
56 Ga0209759_1000051 3300025256 Bacteria 214016
57 Ga0209233_1000033 3300025261 Bacteria 596094
58 Ga0209233_1000322 3300025261 Bacteria 51917
59 Ga0209565_1000466 3300025263 Bacteria 30502
60 Ga0209455_1000003 3300025272 Bacteria 1471893
61 Ga0209673_1020914 3300025273 Bacteria 2302
62 Ga0209675_1007194 3300025291 Bacteria 4313
63 Ga0209676_1000393 3300025292 Bacteria 79869
64 Ga0209564_1002405 3300025295 Bacteria 14932
65 Ga0209758_1003486 3300025297 Bacteria 14246
66 Ga0209758_1005270 3300025297 Bacteria 10109
67 Ga0209050_1000401 3300025298 Bacteria 81113
68 Ga0209050_1000784 3300025298 Bacteria 45231
69 Ga0209256_1000666 3300025299 Bacteria 46480
70 Ga0209256_1012151 3300025299 Bacteria 3340
71 Ga0209051_1020112 3300025303 Bacteria 2889
72 Ga0209257_1000373 3300025304 Bacteria 90001
73 Ga0209257_1000438 3300025304 Bacteria 79869
74 Ga0207696_1017327 3300025711 Bacteria 2388
75 Ga0207680_10013810 3300025903 Bacteria 4159
76 Ga0207647_10036647 3300025904 Bacteria 3115
77 Ga0207681_10004711 3300025923 Bacteria 8390
78 Ga0207694_10077531 3300025924 Bacteria 2604
79 Ga0207711_10000895 3300025941 Bacteria 28682
80 Ga0207711_10042436 3300025941 Bacteria 3876
81 Ga0207711_10276907 3300025941 Bacteria 1545
82 Ga0207640_10117822 3300025981 Bacteria 1896
83 Ga0207658_10023300 3300025986 Bacteria 4321
84 Ga0207703_10000189 3300026035 Bacteria 72189
85 Ga0207678_10242641 3300026067 Bacteria 1543
86 Ga0207641_10000120 3300026088 Bacteria 116070
87 Ga0207676_10000424 3300026095 Bacteria 35638
88 Ga0207683_10101053 3300026121 Bacteria 2575
89 Ga0207428_10174785 3300027907 Bacteria 1625
90 Ga0268266_10004564 3300028379 Bacteria 13233
91 Ga0265334_10041297 3300028573 Bacteria 1804
92 Ga0307517_10000160 3300028786 Bacteria 108370
93 Ga0307515_10029264 3300028794 Bacteria 9320
94 Ga0265338_10091239 3300028800 Bacteria 2518
95 Ga0307512_10049641 3300030522 Bacteria 3382
96 Ga0265340_10118638 3300031247 Bacteria 1218
97 Ga0265327_10000110 3300031251 Bacteria 181251
98 Ga0307509_10001242 3300031507 Bacteria 43229
99 Ga0307508_10000856 3300031616 Bacteria 35350
100 Ga0307516_10084789 3300031730 Bacteria 3007
101 Ga0307412_10000003 3300031911 Bacteria 659081
102 Ga0307414_10006745 3300032004 Bacteria 6421
103 Ga0307507_10005999 3300033179 Bacteria 19190
104 Ga0307510_10008528 3300033180 Bacteria 12222
105 Ga0395900_0132220 3300037418 Bacteria 2557
106 Ga0436364_0687087 3300037853 Bacteria 3038
107 Ga0436361_0414754 3300039447 Bacteria 8003
108 Ga0439435_0004737 3300042436 Bacteria 2950
109 Ga0466961_0007444 3300044693 Bacteria 6969
110 Ga0466959_0081025 3300045049 Bacteria 2339
111 Ga0466958_0033216 3300045836 Bacteria 3073
112 Ga0495627_000148 3300046453 Bacteria 84235
113 Ga0495627_000185 3300046453 Bacteria 69533
114 Ga0495603_0000860 3300046455 Bacteria 17378
115 Ga0495590_0003165 3300046457 Bacteria 6731
116 Ga0495590_0003378 3300046457 Bacteria 6528
117 Ga0495590_0004547 3300046457 Bacteria 5590
118 Ga0495590_0013534 3300046457 Bacteria 2996
119 Ga0495591_000037 3300046458 Bacteria 158323
120 Ga0495629_0000130 3300046459 Bacteria 65355
121 Ga0495629_0010325 3300046459 Bacteria 6801
122 Ga0495638_0000055 3300046460 Bacteria 196038
123 Ga0495638_0001445 3300046460 Bacteria 21488
124 Ga0495638_0001598 3300046460 Bacteria 20236
125 Ga0495638_0001768 3300046460 Bacteria 18926
126 Ga0495638_0007792 3300046460 Bacteria 7647
127 Ga0495638_0022652 3300046460 Bacteria 4121
128 Ga0495638_0023878 3300046460 Bacteria 3993
129 Ga0495638_0044840 3300046460 Bacteria 2784
130 Ga0495651_0026504 3300046462 Bacteria 4515
131 Ga0495653_0000287 3300046463 Bacteria 40916
132 Ga0495650_0000001 3300046471 Bacteria 1085492
133 Ga0495650_0000017 3300046471 Bacteria 542552
134 Ga0495650_0001117 3300046471 Bacteria 29317
135 Ga0495650_0004957 3300046471 Bacteria 8876
136 Ga0495650_0017389 3300046471 Bacteria 3606
137 Ga0495650_0030791 3300046471 Bacteria 2424
138 Ga0495580_0001717 3300046472 Bacteria 19250
139 Ga0495580_0022178 3300046472 Bacteria 4676
140 Ga0495605_0000871 3300046474 Bacteria 20887
141 Ga0495605_0009231 3300046474 Bacteria 5541
142 Ga0495605_0011049 3300046474 Bacteria 5045
143 Ga0495605_0011829 3300046474 Bacteria 4857
144 Ga0495605_0099692 3300046474 Bacteria 1337
145 Ga0495584_0069176 3300046491 Bacteria 1774
146 Ga0495585_0003904 3300046492 Bacteria 9891
147 Ga0495596_0000071 3300046500 Bacteria 75017
148 Ga0495596_0000886 3300046500 Bacteria 18064
149 Ga0495596_0000908 3300046500 Bacteria 17710
150 Ga0495607_0000335 3300046501 Bacteria 48836
151 Ga0495607_0018271 3300046501 Bacteria 4474
152 Ga0495583_0000029 3300046506 Bacteria 255536
153 Ga0495583_0000055 3300046506 Bacteria 201245
154 Ga0495583_0003872 3300046506 Bacteria 11087
155 Ga0495583_0018978 3300046506 Bacteria 3602
156 Ga0495606_0004419 3300046507 Bacteria 14063
157 Ga0495606_0004595 3300046507 Bacteria 13684
158 Ga0495606_0010219 3300046507 Bacteria 7822
159 Ga0495606_0012628 3300046507 Bacteria 6751
160 Ga0495606_0027470 3300046507 Bacteria 4035
161 Ga0495606_0085555 3300046507 Bacteria 1950
162 Ga0495610_0000034 3300046512 Bacteria 201408
163 Ga0495610_0000176 3300046512 Bacteria 71110
164 Ga0495610_0000239 3300046512 Bacteria 57860
165 Ga0495610_0000426 3300046512 Bacteria 43338
166 Ga0495610_0001395 3300046512 Bacteria 21444
167 Ga0495610_0022536 3300046512 Bacteria 3442
168 Ga0495616_0000464 3300046513 Bacteria 30834
169 Ga0495616_0021213 3300046513 Bacteria 3521
170 Ga0495620_0005689 3300046515 Bacteria 6939
171 Ga0495620_0015529 3300046515 Bacteria 3842
172 Ga0495620_0042472 3300046515 Bacteria 1986
173 Ga0495628_0006685 3300046516 Bacteria 10055
174 Ga0495628_0020455 3300046516 Bacteria 5457
175 Ga0495628_0048881 3300046516 Bacteria 3350
176 Ga0495630_0008763 3300046517 Bacteria 7266
177 Ga0495631_0028855 3300046518 Bacteria 2529
178 Ga0495631_0082820 3300046518 Bacteria 1383
179 Ga0495632_0000869 3300046519 Bacteria 26552
180 Ga0495632_0002061 3300046519 Bacteria 15785
181 Ga0495632_0018821 3300046519 Bacteria 3777
182 Ga0495637_0006746 3300046520 Bacteria 5746
183 Ga0495637_0009436 3300046520 Bacteria 4761
184 Ga0495643_0000039 3300046522 Bacteria 235175
185 Ga0495643_0002715 3300046522 Bacteria 13621
186 Ga0495643_0019197 3300046522 Bacteria 3958
187 Ga0495643_0048662 3300046522 Bacteria 2290
188 Ga0495643_0053869 3300046522 Bacteria 2155
189 Ga0495643_0085174 3300046522 Bacteria 1639
190 Ga0495648_0000029 3300046524 Bacteria 223499
191 Ga0495648_0000892 3300046524 Bacteria 31326
192 Ga0495648_0004028 3300046524 Bacteria 12688
193 Ga0495648_0027907 3300046524 Bacteria 3770
194 Ga0495648_0081601 3300046524 Bacteria 1838
195 Ga0495666_0024470 3300046526 Bacteria 2983
196 Ga0495642_0006094 3300046528 Bacteria 4630
197 Ga0495642_0020693 3300046528 Bacteria 2586
198 Ga0495642_0020815 3300046528 Bacteria 2579
199 Ga0495642_0039312 3300046528 Bacteria 1919
200 Ga0495652_0124833 3300046529 Bacteria 2047
201 Ga0495654_0000012 3300046530 Bacteria 328997
202 Ga0495609_0066661 3300046538 Bacteria 1586
203 Ga0495597_0000044 3300046542 Bacteria 106714
204 Ga0495597_0002203 3300046542 Bacteria 12785
205 Ga0495597_0039832 3300046542 Bacteria 2102
206 Ga0495597_0055221 3300046542 Bacteria 1742
207 Ga0495622_0002843 3300046557 Bacteria 8257
208 Ga0495668_0006669 3300046616 Bacteria 7518
209 Ga0495668_0008445 3300046616 Bacteria 6435
210 Ga0495625_0000011 3300046660 Bacteria 377120
211 Ga0495625_0000721 3300046660 Bacteria 46512
212 Ga0495625_0006967 3300046660 Bacteria 9968
213 Ga0495625_0051928 3300046660 Bacteria 2937
214 Ga0495625_0071887 3300046660 Bacteria 2427
215 Ga0495625_0087520 3300046660 Bacteria 2159
216 Ga0495625_0123718 3300046660 Bacteria 1757
217 Ga0495661_0032883 3300046665 Bacteria 3275
218 Ga0495623_0060478 3300046679 Bacteria 2377
219 Ga0495646_0120999 3300046680 Bacteria 1481
220 Ga0495669_0009548 3300046684 Bacteria 4093
221 Ga0495613_0049695 3300046689 Bacteria 3094
222 Ga0495624_0004212 3300046690 Bacteria 10562
223 Ga0495624_0096249 3300046690 Bacteria 1824
224 Ga0495670_0003503 3300046691 Bacteria 7704
225 Ga0495671_0150716 3300046692 Bacteria 1132
226 Ga0495649_0001137 3300046694 Bacteria 20710
227 Ga0495649_0006512 3300046694 Bacteria 7266
228 Ga0495649_0040049 3300046694 Bacteria 2567
229 Ga0495649_0161362 3300046694 Bacteria 1175
230 Ga0495589_0008013 3300046794 Bacteria 5527
231 Ga0495589_0029133 3300046794 Bacteria 2783
232 Ga0495660_0000505 3300046810 Bacteria 32144
233 Ga0495660_0002223 3300046810 Bacteria 12490
234 Ga0495581_0107127 3300047315 Bacteria 1625
235 Ga0495604_0002993 3300047317 Bacteria 13529
236 Ga0495604_0088986 3300047317 Bacteria 2296
237 Ga0495674_0016323 3300047319 Bacteria 6923
238 Ga0495674_0019690 3300047319 Bacteria 6259
239 Ga0495674_0091187 3300047319 Bacteria 2603
240 Ga0495674_0125167 3300047319 Bacteria 2169
241 Ga0495672_0000032 3300047320 Bacteria 295356
242 Ga0495672_0000665 3300047320 Bacteria 38253
243 Ga0495672_0001928 3300047320 Bacteria 19617
244 Ga0495672_0020891 3300047320 Bacteria 4281
245 Ga0495672_0055234 3300047320 Bacteria 2318
246 Ga0495676_0214931 3300047321 Bacteria 1328
247 Ga0495683_0009624 3300047323 Bacteria 5144
248 Ga0495683_0009897 3300047323 Bacteria 5064
249 Ga0495683_0013242 3300047323 Bacteria 4319
250 Ga0495683_0040851 3300047323 Bacteria 2342
251 Ga0495683_0089878 3300047323 Bacteria 1489
252 Ga0495687_026904 3300047443 Bacteria 2699
253 Ga0495675_0006935 3300047444 Bacteria 6960
254 Ga0495675_0015147 3300047444 Bacteria 4874
255 Ga0495679_000048 3300047446 Bacteria 127785
256 Ga0495685_026278 3300047447 Bacteria 2003
257 Ga0495673_0000056 3300047469 Bacteria 245918
258 Ga0495673_0000990 3300047469 Bacteria 25377
259 Ga0495673_0001625 3300047469 Bacteria 17407
260 Ga0495673_0006011 3300047469 Bacteria 7215
261 Ga0495673_0017964 3300047469 Bacteria 3577
262 Ga0495673_0026312 3300047469 Bacteria 2783
263 Ga0495681_0000037 3300047470 Bacteria 122686
264 Ga0495686_0000119 3300047472 Bacteria 165244
265 Ga0495686_0001011 3300047472 Bacteria 34120
266 Ga0495686_0001667 3300047472 Bacteria 23087
267 Ga0495686_0028432 3300047472 Bacteria 3642
268 Ga0495686_0139185 3300047472 Bacteria 1433
269 Ga0495593_0013707 3300047673 Bacteria 4617
270 Ga0495602_0193064 3300048088 Bacteria 1559
271 Ga0495614_0018147 3300048089 Bacteria 3049
272 Ga0495615_0000043 3300048090 Bacteria 41928
273 Ga0495626_0002741 3300048091 Bacteria 11858
274 Ga0495626_0008781 3300048091 Bacteria 5500
275 Ga0495626_0014410 3300048091 Bacteria 4079
276 Ga0496102_0091763 3300048905 Bacteria 2812
277 Ga0496102_0164854 3300048905 Bacteria 2085
278 Ga0496104_0078515 3300048907 Bacteria 3145
279 Ga0496104_0121070 3300048907 Bacteria 2512
280 Ga0496105_0056936 3300048908 Bacteria 3227
281 Ga0496106_0066925 3300048909 Bacteria 2737
282 Ga0496107_0000858 3300048910 Bacteria 17848
283 Ga0496112_0072511 3300048915 Bacteria 3404
284 Ga0496113_0012824 3300048916 Bacteria 5649
285 Ga0496115_0166660 3300048918 Bacteria 1822
286 Ga0496116_0000149 3300048919 Bacteria 141841
287 Ga0496116_0002419 3300048919 Bacteria 19667
288 Ga0496116_0031724 3300048919 Bacteria 3777
289 Ga0496117_0005292 3300048920 Bacteria 13667
290 Ga0496117_0012649 3300048920 Bacteria 7416
291 Ga0496117_0019307 3300048920 Bacteria 5605
292 Ga0496117_0039978 3300048920 Bacteria 3456
293 Ga0496118_0005278 3300048921 Bacteria 14750
294 Ga0496118_0067520 3300048921 Bacteria 2602
295 Ga0496118_0073360 3300048921 Bacteria 2452
296 Ga0496118_0147099 3300048921 Bacteria 1482
297 Ga0496121_0000152 3300048924 Bacteria 150767
298 Ga0496121_0000625 3300048924 Bacteria 65948
299 Ga0496121_0000929 3300048924 Bacteria 52983
300 Ga0496121_0007918 3300048924 Bacteria 12707
301 Ga0496121_0172153 3300048924 Bacteria 1571
302 Ga0496122_0000080 3300048925 Bacteria 212397
303 Ga0496122_0003138 3300048925 Bacteria 22134
304 Ga0496122_0012284 3300048925 Bacteria 8555
305 Ga0496123_0000072 3300048926 Bacteria 198524
306 Ga0496123_0000650 3300048926 Bacteria 57830
307 Ga0496123_0002495 3300048926 Bacteria 22695
308 Ga0496124_0005279 3300048927 Bacteria 14616
309 Ga0496124_0006138 3300048927 Bacteria 13184
310 Ga0496124_0006233 3300048927 Bacteria 13066
311 Ga0496124_0013965 3300048927 Bacteria 7800
312 Ga0496124_0036184 3300048927 Bacteria 4310
313 Ga0496125_0009683 3300048928 Bacteria 9842
314 Ga0496125_0038722 3300048928 Bacteria 4119
315 Ga0496125_0088273 3300048928 Bacteria 2338
316 Ga0496126_0000261 3300048929 Bacteria 112027
317 Ga0496126_0000511 3300048929 Bacteria 75804
318 Ga0496126_0002285 3300048929 Bacteria 26409
319 Ga0496126_0002516 3300048929 Bacteria 24557
320 Ga0496126_0005876 3300048929 Bacteria 13843
321 Ga0496126_0032405 3300048929 Bacteria 4924
322 Ga0496126_0040556 3300048929 Bacteria 4315
323 Ga0495678_000191 3300049459 Bacteria 71862
324 Ga0495678_011288 3300049459 Bacteria 4285
325 Ga0495678_023386 3300049459 Bacteria 2686
326 Ga0495682_0023630 3300049460 Bacteria 2294
327 Ga0501034_0000128 3300049571 Bacteria 140568
328 Ga0501047_0304413 3300049581 Bacteria 1436
329 Ga0501238_000746 3300049671 Bacteria 3651
330 Ga0501238_010261 3300049671 Bacteria 1250
331 nmdc:mga00v17_2018_c1 3300050491 Bacteria 10467
332 nmdc:mga0k408_45332_c1 3300050493 Bacteria 2537
333 nmdc:mga0k408_95776_c1 3300050493 Bacteria 1747
334 nmdc:mga06z11_41973_c1 3300050494 Bacteria 2292
335 nmdc:mga04h51_72925_c1 3300050495 Bacteria 1203
336 nmdc:mga07m45_11412_c1 3300050496 Bacteria 4667
337 nmdc:mga0sz30_6367_c1 3300050516 Bacteria 4383
338 Ga0500635_0000601 3300053080 Bacteria 9482
339 Ga0500578_0000008 3300053086 Bacteria 223557
340 Ga0500643_000021 3300053087 Bacteria 284326
341 Ga0500643_014668 3300053087 Bacteria 2713
342 Ga0500643_021890 3300053087 Bacteria 2067
343 Ga0500644_0000028 3300053088 Bacteria 92405
344 Ga0500644_0003068 3300053088 Bacteria 4139
345 Ga0500647_0043958 3300053091 Bacteria 2144
346 Ga0500651_0004902 3300053093 Bacteria 7567
347 Ga0500641_0038057 3300053096 Bacteria 1931
348 Ga0500554_001021 3300053102 Bacteria 5448
349 Ga0500555_000125 3300053103 Bacteria 36635
350 Ga0500556_0001064 3300053104 Bacteria 14095
351 Ga0500562_003931 3300053108 Bacteria 3748
352 Ga0500562_004349 3300053108 Bacteria 3586
353 Ga0500569_002051 3300053109 Bacteria 3918
354 Ga0500594_0000270 3300053118 Bacteria 12028
355 Ga0500594_0012617 3300053118 Bacteria 1995
356 Ga0500595_004535 3300053119 Bacteria 6211
357 Ga0500595_011334 3300053119 Bacteria 3495
358 Ga0500608_000008 3300053122 Bacteria 97962
359 Ga0500614_002773 3300053123 Bacteria 3863
360 Ga0500614_023837 3300053123 Bacteria 1441
361 Ga0500618_000024 3300053125 Bacteria 152149
362 Ga0500642_0006451 3300053130 Bacteria 3863
363 Ga0500642_0031348 3300053130 Bacteria 2221
364 Ga0500655_000038 3300053133 Bacteria 37284
365 Ga0500658_0003074 3300053134 Bacteria 6380
366 Ga0500658_0022212 3300053134 Bacteria 2409
367 Ga0500559_0000015 3300053136 Bacteria 158494
368 Ga0500559_0001460 3300053136 Bacteria 13407
369 Ga0500559_0002029 3300053136 Bacteria 10835
370 Ga0500559_0004723 3300053136 Bacteria 6407
371 Ga0500559_0006673 3300053136 Bacteria 5189
372 Ga0500564_000007 3300053138 Bacteria 84097
373 Ga0500573_0021746 3300053140 Bacteria 3680
374 Ga0500588_0002020 3300053146 Bacteria 4028
375 Ga0500590_000463 3300053148 Bacteria 13814
376 Ga0500590_017625 3300053148 Bacteria 3691
377 Ga0500616_0024693 3300053153 Bacteria 3337
378 Ga0500619_024263 3300053154 Bacteria 1782
379 Ga0500622_0000201 3300053156 Bacteria 63318
380 Ga0500622_0002175 3300053156 Bacteria 14529
381 Ga0500622_0009972 3300053156 Bacteria 5239
382 Ga0500622_0041303 3300053156 Bacteria 2401
383 Ga0500624_000098 3300053157 Bacteria 42544
384 Ga0500624_000137 3300053157 Bacteria 31147
385 Ga0500627_0008829 3300053158 Bacteria 3600
386 Ga0500636_0002712 3300053177 Bacteria 9846
387 Ga0500636_0019989 3300053177 Bacteria 3961
388 Ga0500636_0130114 3300053177 Bacteria 1403
389 Ga0500637_0000055 3300053178 Bacteria 42526
390 Ga0500637_0036429 3300053178 Bacteria 2762
391 Ga0500570_000021 3300053724 Bacteria 41025
392 Ga0500645_003955 3300053730 Bacteria 5836
393 Ga0500645_009073 3300053730 Bacteria 3358
394 Ga0500645_042068 3300053730 Bacteria 1349
395 Ga0500596_000025 3300053735 Bacteria 20147
396 2509132448 2508501125 Bacteria 7208311
397 2511124419 2510917020 Bacteria 5657507
398 2511127070 2510917021 Bacteria 5705459
399 2513953551 2513237150 Bacteria 6553639
400 2514052339 2513237166 Bacteria 10373764
401 2563056610 2562617112 Bacteria 10918404
402 2585148585 2582581279 Bacteria 4980720
403 2585153583 2582581280 Bacteria 5994497
404 2585197387 2582581293 Bacteria 5907401
405 2587916515 2585428106 Bacteria 5179711
406 2600201100 2599185354 Bacteria 4398675
407 2643780195 2643221552 Bacteria 5708754
408 2643926081 2643221583 Bacteria 5218014
409 2643928607 2643221584 Bacteria 5511711
410 2713481382 2711768613 Bacteria 11048459
411 2738709556 2738541275 Bacteria 4830863
412 2738821421 2738541296 Bacteria 7285013
413 2738833904 2738541298 Bacteria 7286732
414 2738847981 2738541301 Bacteria 4834102
415 2738863710 2738541304 Bacteria 4833665
416 2738875107 2738541306 Bacteria 7284992
417 2739187061 2738543002 Bacteria 7284546
418 2739221705 2738543008 Bacteria 7282815
419 2739296228 2738543022 Bacteria 4835059
420 2739357906 2738543033 Bacteria 4833336
421 2792460336 2791355048 Bacteria 5832535
422 2819536708 2818991435 Bacteria 5433759
423 2819550992 2818991438 Bacteria 5793701
424 2819645869 2818991454 Bacteria 5563326
425 2842738536 2842733646 Bacteria 5716726
426 2843745023 2843744320 Bacteria 5659202
427 2849564184 2849560528 Bacteria 5393480
428 2849575524 2849573788 Bacteria 5421256
429 2851155313 2851153111 Bacteria 5542585
430 2884963342 2884960567 Bacteria 5437054
431 2885270901 2885270888 Bacteria 9831543
432 2898334111 2898329390 Bacteria 5168154
433 2904435880 2904434214 Bacteria 6230908
434 2904485993 2904483920 Bacteria 7545285
435 2919527338 2919527303 Bacteria 7718827
436 2928101111 2928100450 Bacteria 4837635
437 2928510112 2928503688 Bacteria 7268108
438 2928960479 2928959182 Bacteria 4725774
439 2945936466 2945934425 Bacteria 7444609
440 2990709628 2990703756 Bacteria 7715990
441 3000865845 3000865235 Bacteria 3106258
442 642425305 641736151 Bacteria 7477263
443 642596879 642555112 Bacteria 8676562
444 644750370 644736347 Bacteria 6476522
445 8054304495 8054302542 Bacteria 5698134
446 Ga0495623_0002136
447 SwRhRL2b_contig_3178000
448 JGI24739J22299_10005888
449 JGI24735J21928_10002669
450 JGI24738J21930_10003179
451 JGI25156J39149_1000462
452 JGI25165J46597_1000743
453 Ga0055533_1000072
454 Ga0055527_1000010
455 Ga0055535_1000010
456 Ga0055542_1000016
457 Ga0055529_1000012
458 Ga0055537_1005565
459 Ga0055528_1012470
460 Ga0055531_10001500
461 Ga0055531_10001617
462 Ga0065165_1000388
463 Ga0065704_10000204
464 Ga0070682_100117971
465 Ga0070669_100003645
466 Ga0070667_100091165
467 Ga0070665_100001383
468 Ga0070665_100063803
469 Ga0068864_100000257
470 Ga0068863_100000167
471 Ga0068858_100000198
472 Ga0068858_100202773
473 Ga0075368_10009749
474 Ga0075363_100013025
475 Ga0075364_10002414
476 Ga0075367_10020023
477 Ga0075369_10004735
478 Ga0075366_10017756
479 Ga0075366_10091818
480 Ga0075370_10009372
481 Ga0075370_10080838
482 Ga0099795_10033041
483 Ga0105250_10010246
484 Ga0105240_10184904
485 Ga0105247_10124876
486 Ga0105248_10058074
487 Ga0105248_10072307
488 Ga0105238_10036968
489 Ga0163162_10007506
490 Ga0157375_10016284
491 Ga0182008_10000057
492 Ga0157379_10009689
493 Ga0213872_10027062
494 Ga0209674_100011
495 Ga0209672_100002
496 Ga0209147_100003
497 Ga0209563_100511
498 Ga0207427_100818
499 Ga0209258_100042
500 Ga0209148_1000006
501 Ga0209759_1000051
502 Ga0209233_1000033
503 Ga0209233_1000322
504 Ga0209565_1000466
505 Ga0209455_1000003
506 Ga0209673_1020914
507 Ga0209675_1007194
508 Ga0209676_1000393
509 Ga0209564_1002405
510 Ga0209758_1003486
511 Ga0209758_1005270
512 Ga0209050_1000401
513 Ga0209050_1000784
514 Ga0209256_1000666
515 Ga0209256_1012151
516 Ga0209051_1020112
517 Ga0209257_1000373
518 Ga0209257_1000438
519 Ga0207696_1017327
520 Ga0207680_10013810
521 Ga0207647_10036647
522 Ga0207681_10004711
523 Ga0207694_10077531
524 Ga0207711_10000895
525 Ga0207711_10042436
526 Ga0207711_10276907
527 Ga0207640_10117822
528 Ga0207658_10023300
529 Ga0207703_10000189
530 Ga0207678_10242641
531 Ga0207641_10000120
532 Ga0207676_10000424
533 Ga0207683_10101053
534 Ga0207428_10174785
535 Ga0268266_10004564
536 Ga0265334_10041297
537 Ga0307517_10000160
538 Ga0307515_10029264
539 Ga0265338_10091239
540 Ga0307512_10049641
541 Ga0265340_10118638
542 Ga0265327_10000110
543 Ga0307509_10001242
544 Ga0307508_10000856
545 Ga0307516_10084789
546 Ga0307412_10000003
547 Ga0307414_10006745
548 Ga0307507_10005999
549 Ga0307510_10008528
550 Ga0395900_0132220
551 Ga0436364_0687087
552 Ga0436361_0414754
553 Ga0439435_0004737
554 Ga0466961_0007444
555 Ga0466959_0081025
556 Ga0466958_0033216
557 Ga0495627_000148
558 Ga0495627_000185
559 Ga0495603_0000860
560 Ga0495590_0003165
561 Ga0495590_0003378
562 Ga0495590_0004547
563 Ga0495590_0013534
564 Ga0495591_000037
565 Ga0495629_0000130
566 Ga0495629_0010325
567 Ga0495638_0000055
568 Ga0495638_0001445
569 Ga0495638_0001598
570 Ga0495638_0001768
571 Ga0495638_0007792
572 Ga0495638_0022652
573 Ga0495638_0023878
574 Ga0495638_0044840
575 Ga0495651_0026504
576 Ga0495653_0000287
577 Ga0495650_0000001
578 Ga0495650_0000017
579 Ga0495650_0001117
580 Ga0495650_0004957
581 Ga0495650_0017389
582 Ga0495650_0030791
583 Ga0495580_0001717
584 Ga0495580_0022178
585 Ga0495605_0000871
586 Ga0495605_0009231
587 Ga0495605_0011049
588 Ga0495605_0011829
589 Ga0495605_0099692
590 Ga0495584_0069176
591 Ga0495585_0003904
592 Ga0495596_0000071
593 Ga0495596_0000886
594 Ga0495596_0000908
595 Ga0495607_0000335
596 Ga0495607_0018271
597 Ga0495583_0000029
598 Ga0495583_0000055
599 Ga0495583_0003872
600 Ga0495583_0018978
601 Ga0495606_0004419
602 Ga0495606_0004595
603 Ga0495606_0010219
604 Ga0495606_0012628
605 Ga0495606_0027470
606 Ga0495606_0085555
607 Ga0495610_0000034
608 Ga0495610_0000176
609 Ga0495610_0000239
610 Ga0495610_0000426
611 Ga0495610_0001395
612 Ga0495610_0022536
613 Ga0495616_0000464
614 Ga0495616_0021213
615 Ga0495620_0005689
616 Ga0495620_0015529
617 Ga0495620_0042472
618 Ga0495628_0006685
619 Ga0495628_0020455
620 Ga0495628_0048881
621 Ga0495630_0008763
622 Ga0495631_0028855
623 Ga0495631_0082820
624 Ga0495632_0000869
625 Ga0495632_0002061
626 Ga0495632_0018821
627 Ga0495637_0006746
628 Ga0495637_0009436
629 Ga0495643_0000039
630 Ga0495643_0002715
631 Ga0495643_0019197
632 Ga0495643_0048662
633 Ga0495643_0053869
634 Ga0495643_0085174
635 Ga0495648_0000029
636 Ga0495648_0000892
637 Ga0495648_0004028
638 Ga0495648_0027907
639 Ga0495648_0081601
640 Ga0495666_0024470
641 Ga0495642_0006094
642 Ga0495642_0020693
643 Ga0495642_0020815
644 Ga0495642_0039312
645 Ga0495652_0124833
646 Ga0495654_0000012
647 Ga0495609_0066661
648 Ga0495597_0000044
649 Ga0495597_0002203
650 Ga0495597_0039832
651 Ga0495597_0055221
652 Ga0495622_0002843
653 Ga0495668_0006669
654 Ga0495668_0008445
655 Ga0495625_0000011
656 Ga0495625_0000721
657 Ga0495625_0006967
658 Ga0495625_0051928
659 Ga0495625_0071887
660 Ga0495625_0087520
661 Ga0495625_0123718
662 Ga0495661_0032883
663 Ga0495623_0060478
664 Ga0495646_0120999
665 Ga0495669_0009548
666 Ga0495613_0049695
667 Ga0495624_0004212
668 Ga0495624_0096249
669 Ga0495670_0003503
670 Ga0495671_0150716
671 Ga0495649_0001137
672 Ga0495649_0006512
673 Ga0495649_0040049
674 Ga0495649_0161362
675 Ga0495589_0008013
676 Ga0495589_0029133
677 Ga0495660_0000505
678 Ga0495660_0002223
679 Ga0495581_0107127
680 Ga0495604_0002993
681 Ga0495604_0088986
682 Ga0495674_0016323
683 Ga0495674_0019690
684 Ga0495674_0091187
685 Ga0495674_0125167
686 Ga0495672_0000032
687 Ga0495672_0000665
688 Ga0495672_0001928
689 Ga0495672_0020891
690 Ga0495672_0055234
691 Ga0495676_0214931
692 Ga0495683_0009624
693 Ga0495683_0009897
694 Ga0495683_0013242
695 Ga0495683_0040851
696 Ga0495683_0089878
697 Ga0495687_026904
698 Ga0495675_0006935
699 Ga0495675_0015147
700 Ga0495679_000048
701 Ga0495685_026278
702 Ga0495673_0000056
703 Ga0495673_0000990
704 Ga0495673_0001625
705 Ga0495673_0006011
706 Ga0495673_0017964
707 Ga0495673_0026312
708 Ga0495681_0000037
709 Ga0495686_0000119
710 Ga0495686_0001011
711 Ga0495686_0001667
712 Ga0495686_0028432
713 Ga0495686_0139185
714 Ga0495593_0013707
715 Ga0495602_0193064
716 Ga0495614_0018147
717 Ga0495615_0000043
718 Ga0495626_0002741
719 Ga0495626_0008781
720 Ga0495626_0014410
721 Ga0496102_0091763
722 Ga0496102_0164854
723 Ga0496104_0078515
724 Ga0496104_0121070
725 Ga0496105_0056936
726 Ga0496106_0066925
727 Ga0496107_0000858
728 Ga0496112_0072511
729 Ga0496113_0012824
730 Ga0496115_0166660
731 Ga0496116_0000149
732 Ga0496116_0002419
733 Ga0496116_0031724
734 Ga0496117_0005292
735 Ga0496117_0012649
736 Ga0496117_0019307
737 Ga0496117_0039978
738 Ga0496118_0005278
739 Ga0496118_0067520
740 Ga0496118_0073360
741 Ga0496118_0147099
742 Ga0496121_0000152
743 Ga0496121_0000625
744 Ga0496121_0000929
745 Ga0496121_0007918
746 Ga0496121_0172153
747 Ga0496122_0000080
748 Ga0496122_0003138
749 Ga0496122_0012284
750 Ga0496123_0000072
751 Ga0496123_0000650
752 Ga0496123_0002495
753 Ga0496124_0005279
754 Ga0496124_0006138
755 Ga0496124_0006233
756 Ga0496124_0013965
757 Ga0496124_0036184
758 Ga0496125_0009683
759 Ga0496125_0038722
760 Ga0496125_0088273
761 Ga0496126_0000261
762 Ga0496126_0000511
763 Ga0496126_0002285
764 Ga0496126_0002516
765 Ga0496126_0005876
766 Ga0496126_0032405
767 Ga0496126_0040556
768 Ga0495678_000191
769 Ga0495678_011288
770 Ga0495678_023386
771 Ga0495682_0023630
772 Ga0501034_0000128
773 Ga0501047_0304413
774 Ga0501238_000746
775 Ga0501238_010261
776 nmdc:mga00v17_2018_c1
777 nmdc:mga0k408_45332_c1
778 nmdc:mga0k408_95776_c1
779 nmdc:mga06z11_41973_c1
780 nmdc:mga04h51_72925_c1
781 nmdc:mga07m45_11412_c1
782 nmdc:mga0sz30_6367_c1
783 Ga0500635_0000601
784 Ga0500578_0000008
785 Ga0500643_000021
786 Ga0500643_014668
787 Ga0500643_021890
788 Ga0500644_0000028
789 Ga0500644_0003068
790 Ga0500647_0043958
791 Ga0500651_0004902
792 Ga0500641_0038057
793 Ga0500554_001021
794 Ga0500555_000125
795 Ga0500556_0001064
796 Ga0500562_003931
797 Ga0500562_004349
798 Ga0500569_002051
799 Ga0500594_0000270
800 Ga0500594_0012617
801 Ga0500595_004535
802 Ga0500595_011334
803 Ga0500608_000008
804 Ga0500614_002773
805 Ga0500614_023837
806 Ga0500618_000024
807 Ga0500642_0006451
808 Ga0500642_0031348
809 Ga0500655_000038
810 Ga0500658_0003074
811 Ga0500658_0022212
812 Ga0500559_0000015
813 Ga0500559_0001460
814 Ga0500559_0002029
815 Ga0500559_0004723
816 Ga0500559_0006673
817 Ga0500564_000007
818 Ga0500573_0021746
819 Ga0500588_0002020
820 Ga0500590_000463
821 Ga0500590_017625
822 Ga0500616_0024693
823 Ga0500619_024263
824 Ga0500622_0000201
825 Ga0500622_0002175
826 Ga0500622_0009972
827 Ga0500622_0041303
828 Ga0500624_000098
829 Ga0500624_000137
830 Ga0500627_0008829
831 Ga0500636_0002712
832 Ga0500636_0019989
833 Ga0500636_0130114
834 Ga0500637_0000055
835 Ga0500637_0036429
836 Ga0500570_000021
837 Ga0500645_003955
838 Ga0500645_009073
839 Ga0500645_042068
840 Ga0500596_000025
841 2509132448
842 2511124419
843 2511127070
844 2513953551
845 2514052339
846 2563056610
847 2585148585
848 2585153583
849 2585197387
850 2587916515
851 2600201100
852 2643780195
853 2643926081
854 2643928607
855 2713481382
856 2738709556
857 2738821421
858 2738833904
859 2738847981
860 2738863710
861 2738875107
862 2739187061
863 2739221705
864 2739296228
865 2739357906
866 2792460336
867 2819536708
868 2819550992
869 2819645869
870 2842738536
871 2843745023
872 2849564184
873 2849575524
874 2851155313
875 2884963342
876 2885270901
877 2898334111
878 2904435880
879 2904485993
880 2919527338
881 2928101111
882 2928510112
883 2928960479
884 2945936466
885 2990709628
886 3000865845
887 642425305
888 642596879
889 644750370
890 8054304495

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03069

FmdA_AmdA

Acetamidase/Formamidase family

224

377

0.88

PF03069

FmdA_AmdA

Acetamidase/Formamidase family

46

226

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f4l-assembly1.cif.gz_A crystal structure of a putative acetamidase (tm0119) from thermotoga maritima msb8 at 2.50 a resolution 0.9139 21 355
2f4l-assembly1.cif.gz_B crystal structure of a putative acetamidase (tm0119) from thermotoga maritima msb8 at 2.50 a resolution 0.9125 20 355
2f4l-assembly2.cif.gz_D crystal structure of a putative acetamidase (tm0119) from thermotoga maritima msb8 at 2.50 a resolution 0.9106 21 355
2f4l-assembly1.cif.gz_A crystal structure of a putative acetamidase (tm0119) from thermotoga maritima msb8 at 2.50 a resolution 0.9076 21 355
2f4l-assembly2.cif.gz_D crystal structure of a putative acetamidase (tm0119) from thermotoga maritima msb8 at 2.50 a resolution 0.9075 21 355
ID Description Score Start End Superfamily
2f4lB01 Mainly Beta;Sandwich;Jelly Rolls;Acetamidase/Formamidase-like domains 0.9154 21 274 2.60.120.580
2f4lB01 Mainly Beta;Sandwich;Jelly Rolls;Acetamidase/Formamidase-like domains 0.9033 21 274 2.60.120.580
af_Q2FUZ8_472_626_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.856 296 329 3.40.50.80
af_A4IDQ0_1283_1476_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.8453 296 329 3.40.50.80
2f4lD03 Alpha Beta;Roll;Endonuclease I-creI;Acetamidase/Formamidase-like domains 0.8399 274 355 3.10.28.20
ID Description Score Start End GO Terms
AF-A0A3M6Q2I3-F1-model_v4 deleted 0.9817 12 357
AF-A0A259P8W8-F1-model_v4 Formamidase 0.9796 20 273 GO:0016811
AF-A0A519F4L9-F1-model_v4 Formamidase 0.9772 20 358 GO:0016811
AF-A0A2T2X964-F1-model_v4 Formamidase 0.9745 20 355 GO:0016811
AF-A0A5E4WXM7-F1-model_v4 Formamidase 0.9731 20 359 GO:0016811

Map