F445599

General Info

Members Datasets Scaffolds Average Seq Length
445 253 890 221

Family's Representative Sequence

Representative Sequence 3300048920|Ga0496117_0072393|Ga0496117_0072393_1329_2090
Length 253
Sequence MSAKITALHRRPSRPTRMDRRRDLAIKEGMMKLFIGNKAYSSWSLRGWLACKLSGLPFEEVVVPLYDQAWEKRREGDEFAPSSGKVPILWDGDDIVVWDSLAIVEYLNEKSDGDRIWPSDPAARAMARSMAAEMHSSFAALRREHSMNIRQIYAPAPPSTEVEQDIARIMELWAQARARHGGDGEFLFGAFSAADVMFAPVVTRFITYQLPVARFAQAYMHAIIAHPWMQEWIGGAQAEDWIIDKFELPPQTV

Samples

Sample ID Description Type Environment
1 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
92 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
94 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
151 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
152 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
153 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
154 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
155 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
167 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
168 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
169 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
170 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
171 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
172 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
173 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
174 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
175 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
176 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
177 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
178 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
179 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
182 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
185 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
186 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
187 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
188 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
197 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
198 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
199 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
202 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
203 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
204 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
205 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
206 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
207 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
220 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
224 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
225 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
226 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
229 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
230 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
231 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
232 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
233 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
234 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
235 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
236 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
237 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
238 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
239 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
240 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
241 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
242 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
243 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
244 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
245 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
246 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
247 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
248 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
249 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
250 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
251 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
252 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
253 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.3
Metatranscriptomes 0
Isolates 2.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.91
Nodule 0
Rhizoplane 1.8
Rhizosphere 74.83
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496117_0072393 3300048920 Bacteria 2304
2 JGI24736J21556_1001619 3300001904 Bacteria 4084
3 JGI24736J21556_1003382 3300001904 Bacteria 2771
4 JGI24741J21665_1000001 3300001915 Bacteria 68427
5 JGI24740J21852_10001522 3300001979 Bacteria 10655
6 JGI24739J22299_10000851 3300001989 Bacteria 11234
7 JGI24739J22299_10003297 3300001989 Bacteria 6151
8 JGI24739J22299_10012988 3300001989 Bacteria 3048
9 JGI24739J22299_10078374 3300001989 Bacteria 1018
10 JGI24737J22298_10000719 3300001990 Bacteria 11649
11 JGI24737J22298_10001952 3300001990 Bacteria 7378
12 JGI24737J22298_10048962 3300001990 Bacteria 1286
13 JGI24743J22301_10049196 3300001991 Bacteria 857
14 JGI24735J21928_10004239 3300002067 Bacteria 4837
15 JGI24735J21928_10005935 3300002067 Bacteria 4034
16 JGI24735J21928_10011300 3300002067 Bacteria 2834
17 JGI24735J21928_10012995 3300002067 Bacteria 2624
18 JGI24735J21928_10018808 3300002067 Bacteria 2128
19 JGI24735J21928_10021137 3300002067 Bacteria 1989
20 JGI24735J21928_10029317 3300002067 Bacteria 1639
21 JGI24738J21930_10001250 3300002075 Bacteria 7142
22 JGI24738J21930_10004515 3300002075 Bacteria 3403
23 JGI24738J21930_10005832 3300002075 Bacteria 2926
24 JGI24742J22300_10034976 3300002244 Bacteria 885
25 JGI25165J46597_1000165 3300003214 Bacteria 104009
26 rootH2_10155443 3300003320 Bacteria 2341
27 rootL2_10076898 3300003322 Bacteria 3607
28 rootL2_10155331 3300003322 Bacteria 1139
29 rootH1_10106799 3300003323 Bacteria 2604
30 rootH1_10262695 3300003323 Bacteria 2354
31 Ga0055542_1009332 3300003762 Bacteria 1858
32 Ga0055529_1005504 3300003763 Bacteria 1824
33 Ga0055536_1009163 3300003781 Bacteria 4138
34 Ga0055536_1012735 3300003781 Bacteria 3093
35 Ga0055536_1019914 3300003781 Bacteria 2092
36 Ga0055534_1005827 3300003784 Bacteria 3223
37 Ga0055530_10000197 3300003791 Bacteria 54281
38 Ga0055531_10008524 3300003794 Bacteria 5383
39 Ga0065704_10001961 3300005289 Bacteria 10690
40 Ga0065704_10003935 3300005289 Bacteria 8288
41 Ga0065704_10113709 3300005289 Bacteria 1902
42 Ga0065704_10164837 3300005289 Bacteria 1321
43 Ga0065707_10166599 3300005295 Bacteria 1517
44 Ga0070658_10000062 3300005327 Bacteria 107844
45 Ga0070658_10004018 3300005327 Bacteria 12053
46 Ga0070658_10004565 3300005327 Bacteria 11251
47 Ga0070658_10037040 3300005327 Bacteria 3931
48 Ga0070658_10067181 3300005327 Bacteria 2929
49 Ga0070658_10217520 3300005327 Bacteria 1615
50 Ga0070676_10000416 3300005328 Bacteria 20088
51 Ga0070683_100458475 3300005329 Bacteria 1217
52 Ga0070670_100083167 3300005331 Bacteria 2751
53 Ga0070670_100155196 3300005331 Bacteria 1982
54 Ga0068869_100015254 3300005334 Bacteria 5150
55 Ga0070660_100000377 3300005339 Bacteria 29678
56 Ga0070660_100002444 3300005339 Bacteria 12761
57 Ga0070660_100014500 3300005339 Bacteria 5679
58 Ga0070660_100019488 3300005339 Bacteria 4972
59 Ga0070660_100033044 3300005339 Bacteria 3897
60 Ga0070668_100000019 3300005347 Bacteria 98356
61 Ga0070668_100053308 3300005347 Bacteria 3119
62 Ga0070669_100004351 3300005353 Bacteria 10225
63 Ga0070669_100160160 3300005353 Bacteria 1748
64 Ga0070675_100150155 3300005354 Bacteria 1997
65 Ga0070671_100030999 3300005355 Bacteria 4415
66 Ga0070671_100067672 3300005355 Bacteria 2978
67 Ga0070673_100000002 3300005364 Bacteria 225084
68 Ga0070688_100473021 3300005365 Bacteria 941
69 Ga0070659_100006403 3300005366 Bacteria 8501
70 Ga0070659_100036509 3300005366 Bacteria 3831
71 Ga0070659_100254525 3300005366 Bacteria 1456
72 Ga0070659_100461694 3300005366 Bacteria 1078
73 Ga0070667_100000094 3300005367 Bacteria 111140
74 Ga0070701_10045151 3300005438 Bacteria 2260
75 Ga0070662_100029502 3300005457 Bacteria 3828
76 Ga0070662_100041043 3300005457 Bacteria 3299
77 Ga0070662_100146476 3300005457 Bacteria 1835
78 Ga0070662_100267170 3300005457 Bacteria 1380
79 Ga0068867_100000012 3300005459 Bacteria 118831
80 Ga0070685_10161641 3300005466 Bacteria 1428
81 Ga0070698_100748439 3300005471 Bacteria 920
82 Ga0068853_100041194 3300005539 Bacteria 3943
83 Ga0068853_100111734 3300005539 Bacteria 2428
84 Ga0068853_100279663 3300005539 Bacteria 1538
85 Ga0070686_100117382 3300005544 Bacteria 1822
86 Ga0070693_100020120 3300005547 Bacteria 3514
87 Ga0070665_100028448 3300005548 Bacteria 5628
88 Ga0068855_100000095 3300005563 Bacteria 106561
89 Ga0068855_100071449 3300005563 Bacteria 4036
90 Ga0068855_100114092 3300005563 Bacteria 3098
91 Ga0070664_100028935 3300005564 Bacteria 4615
92 Ga0070664_100273443 3300005564 Bacteria 1522
93 Ga0068857_100024736 3300005577 Bacteria 5289
94 Ga0068854_100000265 3300005578 Bacteria 35689
95 Ga0068854_100046578 3300005578 Bacteria 3088
96 Ga0068856_100016744 3300005614 Bacteria 7101
97 Ga0068856_100051628 3300005614 Bacteria 4054
98 Ga0068856_100072555 3300005614 Bacteria 3408
99 Ga0068856_100436920 3300005614 Bacteria 1329
100 Ga0068852_100000586 3300005616 Bacteria 23996
101 Ga0068852_100181971 3300005616 Bacteria 1977
102 Ga0068859_100105153 3300005617 Bacteria 2882
103 Ga0068864_100385107 3300005618 Bacteria 1330
104 Ga0068861_100050543 3300005719 Bacteria 3152
105 Ga0068863_100000057 3300005841 Bacteria 123606
106 Ga0068860_100018154 3300005843 Bacteria 6847
107 Ga0081455_10000187 3300005937 Bacteria 78623
108 Ga0075363_100005054 3300006048 Bacteria 5835
109 Ga0075367_10002832 3300006178 Bacteria 8060
110 Ga0075366_10041128 3300006195 Bacteria 2736
111 Ga0097621_100001128 3300006237 Bacteria 18562
112 Ga0075370_10017804 3300006353 Bacteria 3844
113 Ga0075370_10104550 3300006353 Bacteria 1641
114 Ga0068871_100007431 3300006358 Bacteria 7829
115 Ga0068865_100000004 3300006881 Bacteria 226236
116 Ga0097620_100105147 3300006931 Bacteria 2882
117 Ga0105251_10012849 3300009011 Bacteria 4714
118 Ga0105240_10179929 3300009093 Bacteria 2496
119 Ga0105245_10001027 3300009098 Bacteria 25355
120 Ga0114129_10374160 3300009147 Bacteria 1882
121 Ga0105243_10000146 3300009148 Bacteria 81008
122 Ga0105241_10006190 3300009174 Bacteria 8828
123 Ga0105242_10000497 3300009176 Bacteria 31053
124 Ga0105237_10015961 3300009545 Bacteria 7808
125 Ga0105237_10052574 3300009545 Bacteria 4088
126 Ga0105249_10015630 3300009553 Bacteria 6720
127 Ga0105249_10436507 3300009553 Bacteria 1346
128 Ga0105249_10635172 3300009553 Bacteria 1124
129 Ga0105148_100146 3300009978 Bacteria 10542
130 Ga0105239_10141816 3300010375 Bacteria 2678
131 Ga0105239_10491278 3300010375 Bacteria 1395
132 Ga0105239_10508456 3300010375 Bacteria 1370
133 Ga0105246_10000138 3300011119 Bacteria 33809
134 Ga0157373_10003665 3300013100 Bacteria 11612
135 Ga0157373_10043196 3300013100 Bacteria 3220
136 Ga0157373_10045347 3300013100 Bacteria 3138
137 Ga0157371_10214174 3300013102 Bacteria 1383
138 Ga0157370_10000096 3300013104 Bacteria 99163
139 Ga0157370_10091181 3300013104 Bacteria 2861
140 Ga0157370_10096868 3300013104 Bacteria 2767
141 Ga0157369_10022918 3300013105 Bacteria 6962
142 Ga0157369_10187251 3300013105 Bacteria 2176
143 Ga0157369_10282891 3300013105 Bacteria 1727
144 Ga0157374_10001104 3300013296 Bacteria 23221
145 Ga0157374_10010449 3300013296 Bacteria 7984
146 Ga0157378_10812021 3300013297 Bacteria 962
147 Ga0157372_10034063 3300013307 Bacteria 5596
148 Ga0157372_10060755 3300013307 Bacteria 4229
149 Ga0157372_10081266 3300013307 Bacteria 3668
150 Ga0157372_10725164 3300013307 Bacteria 1156
151 Ga0157372_10737957 3300013307 Bacteria 1145
152 Ga0157375_10000587 3300013308 Bacteria 32327
153 Ga0157375_10063387 3300013308 Bacteria 3677
154 Ga0157380_10259160 3300014326 Bacteria 1578
155 Ga0157376_10000131 3300014969 Bacteria 51790
156 Ga0163161_10002898 3300017792 Bacteria 12137
157 Ga0163161_10030610 3300017792 Bacteria 3832
158 Ga0163161_10212334 3300017792 Bacteria 1495
159 Ga0163161_10399733 3300017792 Bacteria 1101
160 Ga0209147_100815 3300025229 Bacteria 14909
161 Ga0207427_100557 3300025231 Bacteria 18931
162 Ga0209026_1001831 3300025250 Bacteria 8716
163 Ga0209148_1000074 3300025254 Bacteria 314356
164 Ga0209148_1001194 3300025254 Bacteria 14881
165 Ga0209233_1000098 3300025261 Bacteria 294111
166 Ga0209455_1000574 3300025272 Bacteria 24064
167 Ga0209455_1039272 3300025272 Bacteria 732
168 Ga0209675_1000162 3300025291 Bacteria 83810
169 Ga0209676_1000113 3300025292 Bacteria 207931
170 Ga0209676_1000146 3300025292 Bacteria 174095
171 Ga0209676_1002307 3300025292 Bacteria 13898
172 Ga0209676_1059602 3300025292 Bacteria 957
173 Ga0209025_1035622 3300025294 Bacteria 2245
174 Ga0209050_1000126 3300025298 Bacteria 188438
175 Ga0209050_1013537 3300025298 Bacteria 3612
176 Ga0209050_1021825 3300025298 Bacteria 2317
177 Ga0209257_1000256 3300025304 Bacteria 123057
178 Ga0209257_1002572 3300025304 Bacteria 17649
179 Ga0209257_1002727 3300025304 Bacteria 16784
180 Ga0207688_10184696 3300025901 Bacteria 1245
181 Ga0207680_10053509 3300025903 Bacteria 2424
182 Ga0207647_10004165 3300025904 Bacteria 10726
183 Ga0207647_10012219 3300025904 Bacteria 5985
184 Ga0207647_10020602 3300025904 Bacteria 4419
185 Ga0207647_10082489 3300025904 Bacteria 1926
186 Ga0207647_10095278 3300025904 Bacteria 1772
187 Ga0207645_10004384 3300025907 Bacteria 10452
188 Ga0207705_10000055 3300025909 Bacteria 160436
189 Ga0207705_10000179 3300025909 Bacteria 66765
190 Ga0207705_10007178 3300025909 Bacteria 8207
191 Ga0207705_10049148 3300025909 Bacteria 3036
192 Ga0207705_10440011 3300025909 Bacteria 1010
193 Ga0207705_10564913 3300025909 Bacteria 884
194 Ga0207695_10005778 3300025913 Bacteria 16288
195 Ga0207671_10014180 3300025914 Bacteria 6309
196 Ga0207671_10090510 3300025914 Bacteria 2304
197 Ga0207657_10000791 3300025919 Bacteria 33627
198 Ga0207657_10004951 3300025919 Bacteria 14018
199 Ga0207657_10010795 3300025919 Bacteria 9092
200 Ga0207657_10013332 3300025919 Bacteria 8064
201 Ga0207681_10002127 3300025923 Bacteria 12647
202 Ga0207681_10331354 3300025923 Bacteria 1213
203 Ga0207681_10393024 3300025923 Bacteria 1119
204 Ga0207694_10061897 3300025924 Bacteria 2913
205 Ga0207650_10108279 3300025925 Bacteria 2148
206 Ga0207650_10129821 3300025925 Bacteria 1971
207 Ga0207644_10113154 3300025931 Bacteria 2055
208 Ga0207644_10126625 3300025931 Bacteria 1950
209 Ga0207644_10164538 3300025931 Bacteria 1727
210 Ga0207706_10010431 3300025933 Bacteria 8489
211 Ga0207706_10017733 3300025933 Bacteria 6413
212 Ga0207706_10036405 3300025933 Bacteria 4371
213 Ga0207706_10037963 3300025933 Bacteria 4274
214 Ga0207706_10053390 3300025933 Bacteria 3568
215 Ga0207706_10162190 3300025933 Bacteria 1965
216 Ga0207686_10004317 3300025934 Bacteria 7623
217 Ga0207709_10000314 3300025935 Bacteria 52842
218 Ga0207670_10032957 3300025936 Bacteria 3335
219 Ga0207704_10000005 3300025938 Bacteria 225353
220 Ga0207704_10519372 3300025938 Bacteria 963
221 Ga0207691_10031510 3300025940 Bacteria 4947
222 Ga0207689_10001653 3300025942 Bacteria 21135
223 Ga0207667_10000016 3300025949 Bacteria 391466
224 Ga0207667_10079777 3300025949 Bacteria 3392
225 Ga0207667_10251436 3300025949 Bacteria 1808
226 Ga0207651_10000007 3300025960 Bacteria 225286
227 Ga0207712_10007902 3300025961 Bacteria 6720
228 Ga0207712_10095408 3300025961 Bacteria 2199
229 Ga0207668_10000296 3300025972 Bacteria 32653
230 Ga0207668_10036012 3300025972 Bacteria 3301
231 Ga0207640_10000139 3300025981 Bacteria 53517
232 Ga0207640_10024737 3300025981 Bacteria 3628
233 Ga0207658_10000072 3300025986 Bacteria 112469
234 Ga0207677_10000085 3300026023 Bacteria 78393
235 Ga0207639_10047804 3300026041 Bacteria 3235
236 Ga0207639_10057513 3300026041 Bacteria 2986
237 Ga0207678_10035760 3300026067 Bacteria 4324
238 Ga0207678_10036634 3300026067 Bacteria 4270
239 Ga0207708_10219575 3300026075 Bacteria 1522
240 Ga0207702_10005342 3300026078 Bacteria 11261
241 Ga0207702_10018661 3300026078 Bacteria 5738
242 Ga0207702_10383110 3300026078 Bacteria 1353
243 Ga0207641_10000096 3300026088 Bacteria 123585
244 Ga0207648_10000005 3300026089 Bacteria 225083
245 Ga0207674_10006242 3300026116 Bacteria 14046
246 Ga0207674_10017443 3300026116 Bacteria 7835
247 Ga0207675_100028654 3300026118 Bacteria 5187
248 Ga0207698_10000294 3300026142 Bacteria 30242
249 Ga0207698_10010421 3300026142 Bacteria 5971
250 Ga0207698_10056740 3300026142 Bacteria 3025
251 Ga0209813_10000020 3300027866 Bacteria 75376
252 Ga0268266_10135170 3300028379 Bacteria 2208
253 Ga0268264_10012832 3300028381 Bacteria 6896
254 Ga0307408_100027647 3300031548 Bacteria 3911
255 Ga0307405_10048066 3300031731 Bacteria 2629
256 Ga0307405_10146823 3300031731 Bacteria 1653
257 Ga0307413_10086671 3300031824 Bacteria 2025
258 Ga0307406_10085972 3300031901 Bacteria 2104
259 Ga0307406_10105751 3300031901 Bacteria 1926
260 Ga0307406_10393431 3300031901 Bacteria 1096
261 Ga0307412_10001306 3300031911 Bacteria 13981
262 Ga0307412_10001453 3300031911 Bacteria 13173
263 Ga0307412_10020708 3300031911 Bacteria 4006
264 Ga0307412_10091719 3300031911 Bacteria 2127
265 Ga0307412_10098664 3300031911 Bacteria 2060
266 Ga0307414_10000607 3300032004 Bacteria 18398
267 Ga0307414_10012355 3300032004 Bacteria 5046
268 Ga0307414_10079396 3300032004 Bacteria 2395
269 Ga0307414_10102825 3300032004 Bacteria 2154
270 Ga0307414_10216193 3300032004 Bacteria 1570
271 Ga0307411_10043443 3300032005 Bacteria 2875
272 Ga0307415_100677333 3300032126 Bacteria 928
273 Ga0395899_0001254 3300037312 Bacteria 22064
274 Ga0395900_0090023 3300037418 Bacteria 3154
275 Ga0395900_0366027 3300037418 Bacteria 1412
276 Ga0395905_0095441 3300037471 Bacteria 2791
277 Ga0395905_0224836 3300037471 Bacteria 1756
278 Ga0395901_0998747 3300038443 Bacteria 813
279 Ga0439448_0000954 3300042005 Bacteria 7133
280 Ga0439448_0002340 3300042005 Bacteria 5139
281 Ga0439448_0003467 3300042005 Bacteria 4370
282 Ga0439448_0005772 3300042005 Bacteria 3536
283 Ga0439455_0000109 3300042012 Bacteria 8273
284 Ga0439455_0000505 3300042012 Bacteria 5435
285 Ga0439455_0002132 3300042012 Bacteria 3535
286 Ga0439458_0000632 3300042157 Bacteria 9121
287 Ga0439458_0001013 3300042157 Bacteria 7188
288 Ga0466972_0010990 3300044658 Bacteria 4545
289 Ga0466965_0027007 3300044683 Bacteria 2784
290 Ga0466966_0011213 3300044684 Bacteria 5949
291 Ga0466961_0011581 3300044693 Bacteria 5637
292 Ga0466963_0049425 3300044694 Bacteria 2781
293 Ga0466964_0013581 3300044706 Bacteria 3089
294 Ga0466971_0022878 3300044719 Bacteria 2785
295 Ga0466970_0004968 3300044765 Bacteria 6570
296 Ga0466957_0036824 3300044842 Bacteria 2943
297 Ga0466957_0102411 3300044842 Bacteria 1806
298 Ga0466960_0101204 3300044901 Bacteria 1484
299 Ga0466959_0035767 3300045049 Bacteria 3670
300 Ga0466958_0021853 3300045836 Bacteria 3742
301 Ga0466967_0029296 3300045976 Bacteria 4606
302 Ga0466967_1033346 3300045976 Bacteria 818
303 Ga0495627_000941 3300046453 Bacteria 20026
304 Ga0495627_002847 3300046453 Bacteria 7993
305 Ga0495638_0000014 3300046460 Bacteria 417060
306 Ga0495638_0048227 3300046460 Bacteria 2667
307 Ga0495638_0280838 3300046460 Bacteria 905
308 Ga0495650_0001110 3300046471 Bacteria 29443
309 Ga0495584_0128531 3300046491 Bacteria 1285
310 Ga0495583_0000072 3300046506 Bacteria 182057
311 Ga0495583_0000201 3300046506 Bacteria 100380
312 Ga0495606_0000842 3300046507 Bacteria 46207
313 Ga0495610_0000127 3300046512 Bacteria 84143
314 Ga0495631_0029609 3300046518 Bacteria 2489
315 Ga0495632_0000048 3300046519 Bacteria 137883
316 Ga0495632_0000171 3300046519 Bacteria 66639
317 Ga0495637_0000423 3300046520 Bacteria 30963
318 Ga0495637_0009504 3300046520 Bacteria 4739
319 Ga0495643_0000030 3300046522 Bacteria 260229
320 Ga0495643_0010369 3300046522 Bacteria 5737
321 Ga0495648_0000021 3300046524 Bacteria 246945
322 Ga0495648_0021069 3300046524 Bacteria 4525
323 Ga0495663_0000003 3300046525 Bacteria 362694
324 Ga0495654_0045118 3300046530 Bacteria 2176
325 Ga0495633_0003052 3300046558 Bacteria 11397
326 Ga0495633_0006472 3300046558 Bacteria 6932
327 Ga0495633_0028739 3300046558 Bacteria 2707
328 Ga0495633_0068294 3300046558 Bacteria 1659
329 Ga0495668_0000015 3300046616 Bacteria 441932
330 Ga0495611_0008401 3300046648 Bacteria 4373
331 Ga0495625_0002061 3300046660 Bacteria 22521
332 Ga0495625_0070549 3300046660 Bacteria 2453
333 Ga0495671_0000028 3300046692 Bacteria 234938
334 Ga0495671_0000043 3300046692 Bacteria 163036
335 Ga0495671_0080243 3300046692 Bacteria 1599
336 Ga0495687_099181 3300047443 Bacteria 1097
337 Ga0495673_0000058 3300047469 Bacteria 235044
338 Ga0495673_0075903 3300047469 Bacteria 1403
339 Ga0495681_0000155 3300047470 Bacteria 57469
340 Ga0495681_0000983 3300047470 Bacteria 21816
341 Ga0495686_0000368 3300047472 Bacteria 73088
342 Ga0495686_0000518 3300047472 Bacteria 55768
343 Ga0495686_0001904 3300047472 Bacteria 20835
344 Ga0495686_0003497 3300047472 Bacteria 13569
345 Ga0495686_0031280 3300047472 Bacteria 3452
346 Ga0495686_0094738 3300047472 Bacteria 1809
347 Ga0496102_0000345 3300048905 Bacteria 56618
348 Ga0496103_0005035 3300048906 Bacteria 7969
349 Ga0496108_0000875 3300048911 Bacteria 23492
350 Ga0496109_0019845 3300048912 Bacteria 5932
351 Ga0496110_0008352 3300048913 Bacteria 8331
352 Ga0496110_0042254 3300048913 Bacteria 3979
353 Ga0496111_0024561 3300048914 Bacteria 4246
354 Ga0496113_0018744 3300048916 Bacteria 4826
355 Ga0496116_0011662 3300048919 Bacteria 7247
356 Ga0496117_0000633 3300048920 Bacteria 56618
357 Ga0496117_0110348 3300048920 Bacteria 1715
358 Ga0496117_0168034 3300048920 Bacteria 1276
359 Ga0496117_0187258 3300048920 Bacteria 1183
360 Ga0496118_0000654 3300048921 Bacteria 56618
361 Ga0496118_0010750 3300048921 Bacteria 9024
362 Ga0496118_0024851 3300048921 Bacteria 5158
363 Ga0496118_0070052 3300048921 Bacteria 2535
364 Ga0496118_0187737 3300048921 Bacteria 1240
365 Ga0496118_0217337 3300048921 Bacteria 1116
366 Ga0496119_0010246 3300048922 Bacteria 7902
367 Ga0496120_0017741 3300048923 Bacteria 4603
368 Ga0496120_0102992 3300048923 Bacteria 1505
369 Ga0496121_0000454 3300048924 Bacteria 80561
370 Ga0496121_0071532 3300048924 Bacteria 2789
371 Ga0496121_0113228 3300048924 Bacteria 2065
372 Ga0496122_0001352 3300048925 Bacteria 39977
373 Ga0496122_0036640 3300048925 Bacteria 3962
374 Ga0496122_0070406 3300048925 Bacteria 2499
375 Ga0496122_0093525 3300048925 Bacteria 2039
376 Ga0496123_0000465 3300048926 Bacteria 70986
377 Ga0496123_0022020 3300048926 Bacteria 4930
378 Ga0496123_0029963 3300048926 Bacteria 3994
379 Ga0496123_0045638 3300048926 Bacteria 2983
380 Ga0496123_0064154 3300048926 Bacteria 2342
381 Ga0496124_0000664 3300048927 Bacteria 56618
382 Ga0496124_0002038 3300048927 Bacteria 27462
383 Ga0496124_0008038 3300048927 Bacteria 11091
384 Ga0496124_0102915 3300048927 Bacteria 2310
385 Ga0496124_0106034 3300048927 Bacteria 2269
386 Ga0496124_0177029 3300048927 Bacteria 1645
387 Ga0496124_0238196 3300048927 Bacteria 1355
388 Ga0496125_0018322 3300048928 Bacteria 6653
389 Ga0496125_0024468 3300048928 Bacteria 5552
390 Ga0496125_0076136 3300048928 Bacteria 2592
391 Ga0496125_0132936 3300048928 Bacteria 1747
392 Ga0496126_0030460 3300048929 Bacteria 5111
393 Ga0496126_0093505 3300048929 Bacteria 2640
394 Ga0496126_0180428 3300048929 Bacteria 1794
395 Ga0495682_0023125 3300049460 Bacteria 2322
396 Ga0501031_0130277 3300049568 Bacteria 1643
397 Ga0501032_0062790 3300049569 Bacteria 2488
398 Ga0501033_0010630 3300049570 Bacteria 7057
399 Ga0501034_0075887 3300049571 Bacteria 3368
400 Ga0501036_0044978 3300049572 Bacteria 3740
401 Ga0501037_0066682 3300049573 Bacteria 2621
402 Ga0501038_0025913 3300049574 Bacteria 5223
403 Ga0501039_0015976 3300049575 Bacteria 5748
404 Ga0501043_0220013 3300049579 Bacteria 1469
405 Ga0501046_0297272 3300049580 Bacteria 1180
406 Ga0501047_0125830 3300049581 Bacteria 2443
407 Ga0501048_0194916 3300049582 Bacteria 1436
408 Ga0501223_000021 3300049663 Bacteria 66697
409 Ga0501225_0000011 3300049705 Bacteria 74084
410 Ga0501225_0019452 3300049705 Bacteria 1879
411 Ga0501035_0012696 3300049822 Bacteria 7783
412 Ga0501044_0044360 3300049823 Bacteria 4613
413 nmdc:mga03n38_1172_c1 3300050490 Bacteria 7301
414 nmdc:mga0k408_76067_c1 3300050493 Bacteria 1962
415 nmdc:mga06z11_59_c2 3300050494 Bacteria 45567
416 nmdc:mga04h51_11080_c1 3300050495 Bacteria 2494
417 nmdc:mga05p37_388028_c1 3300050507 Bacteria 1634
418 Ga0500651_0139240 3300053093 Bacteria 1464
419 Ga0500555_015164 3300053103 Bacteria 2222
420 Ga0500562_015571 3300053108 Bacteria 1951
421 Ga0500592_009184 3300053116 Bacteria 1570
422 Ga0500592_016041 3300053116 Bacteria 1203
423 Ga0500597_006565 3300053120 Bacteria 3874
424 Ga0500608_194398 3300053122 Bacteria 845
425 Ga0500568_0003398 3300053139 Bacteria 8897
426 Ga0500604_0074795 3300053151 Bacteria 1086
427 Ga0500616_0071306 3300053153 Bacteria 1770
428 Ga0500624_000008 3300053157 Bacteria 181801
429 Ga0500624_000012 3300053157 Bacteria 165895
430 Ga0500627_0000028 3300053158 Bacteria 99118
431 Ga0500637_0000101 3300053178 Bacteria 31079
432 Ga0500611_001800 3300053727 Bacteria 2446
433 Ga0466962_0001247 3300061719 Bacteria 11734
434 2512643711 2512564014 Bacteria 4639632
435 2643820289 2643221560 Bacteria 4801179
436 2643834607 2643221563 Bacteria 4726935
437 2644055533 2643221608 Bacteria 4724829
438 2778124763 2775507255 Bacteria 3945731
439 2809064346 2808606401 Bacteria 4586670
440 2809080314 2808606404 Bacteria 4652788
441 2809084678 2808606405 Bacteria 4586632
442 2852656259 2852653556 Bacteria 4050083
443 2852683320 2852680915 Bacteria 4100189
444 2880522085 2880518877 Bacteria 5012590
445 2919713310 2919709256 Bacteria 4318106
446 Ga0496117_0072393
447 JGI24736J21556_1001619
448 JGI24736J21556_1003382
449 JGI24741J21665_1000001
450 JGI24740J21852_10001522
451 JGI24739J22299_10000851
452 JGI24739J22299_10003297
453 JGI24739J22299_10012988
454 JGI24739J22299_10078374
455 JGI24737J22298_10000719
456 JGI24737J22298_10001952
457 JGI24737J22298_10048962
458 JGI24743J22301_10049196
459 JGI24735J21928_10004239
460 JGI24735J21928_10005935
461 JGI24735J21928_10011300
462 JGI24735J21928_10012995
463 JGI24735J21928_10018808
464 JGI24735J21928_10021137
465 JGI24735J21928_10029317
466 JGI24738J21930_10001250
467 JGI24738J21930_10004515
468 JGI24738J21930_10005832
469 JGI24742J22300_10034976
470 JGI25165J46597_1000165
471 rootH2_10155443
472 rootL2_10076898
473 rootL2_10155331
474 rootH1_10106799
475 rootH1_10262695
476 Ga0055542_1009332
477 Ga0055529_1005504
478 Ga0055536_1009163
479 Ga0055536_1012735
480 Ga0055536_1019914
481 Ga0055534_1005827
482 Ga0055530_10000197
483 Ga0055531_10008524
484 Ga0065704_10001961
485 Ga0065704_10003935
486 Ga0065704_10113709
487 Ga0065704_10164837
488 Ga0065707_10166599
489 Ga0070658_10000062
490 Ga0070658_10004018
491 Ga0070658_10004565
492 Ga0070658_10037040
493 Ga0070658_10067181
494 Ga0070658_10217520
495 Ga0070676_10000416
496 Ga0070683_100458475
497 Ga0070670_100083167
498 Ga0070670_100155196
499 Ga0068869_100015254
500 Ga0070660_100000377
501 Ga0070660_100002444
502 Ga0070660_100014500
503 Ga0070660_100019488
504 Ga0070660_100033044
505 Ga0070668_100000019
506 Ga0070668_100053308
507 Ga0070669_100004351
508 Ga0070669_100160160
509 Ga0070675_100150155
510 Ga0070671_100030999
511 Ga0070671_100067672
512 Ga0070673_100000002
513 Ga0070688_100473021
514 Ga0070659_100006403
515 Ga0070659_100036509
516 Ga0070659_100254525
517 Ga0070659_100461694
518 Ga0070667_100000094
519 Ga0070701_10045151
520 Ga0070662_100029502
521 Ga0070662_100041043
522 Ga0070662_100146476
523 Ga0070662_100267170
524 Ga0068867_100000012
525 Ga0070685_10161641
526 Ga0070698_100748439
527 Ga0068853_100041194
528 Ga0068853_100111734
529 Ga0068853_100279663
530 Ga0070686_100117382
531 Ga0070693_100020120
532 Ga0070665_100028448
533 Ga0068855_100000095
534 Ga0068855_100071449
535 Ga0068855_100114092
536 Ga0070664_100028935
537 Ga0070664_100273443
538 Ga0068857_100024736
539 Ga0068854_100000265
540 Ga0068854_100046578
541 Ga0068856_100016744
542 Ga0068856_100051628
543 Ga0068856_100072555
544 Ga0068856_100436920
545 Ga0068852_100000586
546 Ga0068852_100181971
547 Ga0068859_100105153
548 Ga0068864_100385107
549 Ga0068861_100050543
550 Ga0068863_100000057
551 Ga0068860_100018154
552 Ga0081455_10000187
553 Ga0075363_100005054
554 Ga0075367_10002832
555 Ga0075366_10041128
556 Ga0097621_100001128
557 Ga0075370_10017804
558 Ga0075370_10104550
559 Ga0068871_100007431
560 Ga0068865_100000004
561 Ga0097620_100105147
562 Ga0105251_10012849
563 Ga0105240_10179929
564 Ga0105245_10001027
565 Ga0114129_10374160
566 Ga0105243_10000146
567 Ga0105241_10006190
568 Ga0105242_10000497
569 Ga0105237_10015961
570 Ga0105237_10052574
571 Ga0105249_10015630
572 Ga0105249_10436507
573 Ga0105249_10635172
574 Ga0105148_100146
575 Ga0105239_10141816
576 Ga0105239_10491278
577 Ga0105239_10508456
578 Ga0105246_10000138
579 Ga0157373_10003665
580 Ga0157373_10043196
581 Ga0157373_10045347
582 Ga0157371_10214174
583 Ga0157370_10000096
584 Ga0157370_10091181
585 Ga0157370_10096868
586 Ga0157369_10022918
587 Ga0157369_10187251
588 Ga0157369_10282891
589 Ga0157374_10001104
590 Ga0157374_10010449
591 Ga0157378_10812021
592 Ga0157372_10034063
593 Ga0157372_10060755
594 Ga0157372_10081266
595 Ga0157372_10725164
596 Ga0157372_10737957
597 Ga0157375_10000587
598 Ga0157375_10063387
599 Ga0157380_10259160
600 Ga0157376_10000131
601 Ga0163161_10002898
602 Ga0163161_10030610
603 Ga0163161_10212334
604 Ga0163161_10399733
605 Ga0209147_100815
606 Ga0207427_100557
607 Ga0209026_1001831
608 Ga0209148_1000074
609 Ga0209148_1001194
610 Ga0209233_1000098
611 Ga0209455_1000574
612 Ga0209455_1039272
613 Ga0209675_1000162
614 Ga0209676_1000113
615 Ga0209676_1000146
616 Ga0209676_1002307
617 Ga0209676_1059602
618 Ga0209025_1035622
619 Ga0209050_1000126
620 Ga0209050_1013537
621 Ga0209050_1021825
622 Ga0209257_1000256
623 Ga0209257_1002572
624 Ga0209257_1002727
625 Ga0207688_10184696
626 Ga0207680_10053509
627 Ga0207647_10004165
628 Ga0207647_10012219
629 Ga0207647_10020602
630 Ga0207647_10082489
631 Ga0207647_10095278
632 Ga0207645_10004384
633 Ga0207705_10000055
634 Ga0207705_10000179
635 Ga0207705_10007178
636 Ga0207705_10049148
637 Ga0207705_10440011
638 Ga0207705_10564913
639 Ga0207695_10005778
640 Ga0207671_10014180
641 Ga0207671_10090510
642 Ga0207657_10000791
643 Ga0207657_10004951
644 Ga0207657_10010795
645 Ga0207657_10013332
646 Ga0207681_10002127
647 Ga0207681_10331354
648 Ga0207681_10393024
649 Ga0207694_10061897
650 Ga0207650_10108279
651 Ga0207650_10129821
652 Ga0207644_10113154
653 Ga0207644_10126625
654 Ga0207644_10164538
655 Ga0207706_10010431
656 Ga0207706_10017733
657 Ga0207706_10036405
658 Ga0207706_10037963
659 Ga0207706_10053390
660 Ga0207706_10162190
661 Ga0207686_10004317
662 Ga0207709_10000314
663 Ga0207670_10032957
664 Ga0207704_10000005
665 Ga0207704_10519372
666 Ga0207691_10031510
667 Ga0207689_10001653
668 Ga0207667_10000016
669 Ga0207667_10079777
670 Ga0207667_10251436
671 Ga0207651_10000007
672 Ga0207712_10007902
673 Ga0207712_10095408
674 Ga0207668_10000296
675 Ga0207668_10036012
676 Ga0207640_10000139
677 Ga0207640_10024737
678 Ga0207658_10000072
679 Ga0207677_10000085
680 Ga0207639_10047804
681 Ga0207639_10057513
682 Ga0207678_10035760
683 Ga0207678_10036634
684 Ga0207708_10219575
685 Ga0207702_10005342
686 Ga0207702_10018661
687 Ga0207702_10383110
688 Ga0207641_10000096
689 Ga0207648_10000005
690 Ga0207674_10006242
691 Ga0207674_10017443
692 Ga0207675_100028654
693 Ga0207698_10000294
694 Ga0207698_10010421
695 Ga0207698_10056740
696 Ga0209813_10000020
697 Ga0268266_10135170
698 Ga0268264_10012832
699 Ga0307408_100027647
700 Ga0307405_10048066
701 Ga0307405_10146823
702 Ga0307413_10086671
703 Ga0307406_10085972
704 Ga0307406_10105751
705 Ga0307406_10393431
706 Ga0307412_10001306
707 Ga0307412_10001453
708 Ga0307412_10020708
709 Ga0307412_10091719
710 Ga0307412_10098664
711 Ga0307414_10000607
712 Ga0307414_10012355
713 Ga0307414_10079396
714 Ga0307414_10102825
715 Ga0307414_10216193
716 Ga0307411_10043443
717 Ga0307415_100677333
718 Ga0395899_0001254
719 Ga0395900_0090023
720 Ga0395900_0366027
721 Ga0395905_0095441
722 Ga0395905_0224836
723 Ga0395901_0998747
724 Ga0439448_0000954
725 Ga0439448_0002340
726 Ga0439448_0003467
727 Ga0439448_0005772
728 Ga0439455_0000109
729 Ga0439455_0000505
730 Ga0439455_0002132
731 Ga0439458_0000632
732 Ga0439458_0001013
733 Ga0466972_0010990
734 Ga0466965_0027007
735 Ga0466966_0011213
736 Ga0466961_0011581
737 Ga0466963_0049425
738 Ga0466964_0013581
739 Ga0466971_0022878
740 Ga0466970_0004968
741 Ga0466957_0036824
742 Ga0466957_0102411
743 Ga0466960_0101204
744 Ga0466959_0035767
745 Ga0466958_0021853
746 Ga0466967_0029296
747 Ga0466967_1033346
748 Ga0495627_000941
749 Ga0495627_002847
750 Ga0495638_0000014
751 Ga0495638_0048227
752 Ga0495638_0280838
753 Ga0495650_0001110
754 Ga0495584_0128531
755 Ga0495583_0000072
756 Ga0495583_0000201
757 Ga0495606_0000842
758 Ga0495610_0000127
759 Ga0495631_0029609
760 Ga0495632_0000048
761 Ga0495632_0000171
762 Ga0495637_0000423
763 Ga0495637_0009504
764 Ga0495643_0000030
765 Ga0495643_0010369
766 Ga0495648_0000021
767 Ga0495648_0021069
768 Ga0495663_0000003
769 Ga0495654_0045118
770 Ga0495633_0003052
771 Ga0495633_0006472
772 Ga0495633_0028739
773 Ga0495633_0068294
774 Ga0495668_0000015
775 Ga0495611_0008401
776 Ga0495625_0002061
777 Ga0495625_0070549
778 Ga0495671_0000028
779 Ga0495671_0000043
780 Ga0495671_0080243
781 Ga0495687_099181
782 Ga0495673_0000058
783 Ga0495673_0075903
784 Ga0495681_0000155
785 Ga0495681_0000983
786 Ga0495686_0000368
787 Ga0495686_0000518
788 Ga0495686_0001904
789 Ga0495686_0003497
790 Ga0495686_0031280
791 Ga0495686_0094738
792 Ga0496102_0000345
793 Ga0496103_0005035
794 Ga0496108_0000875
795 Ga0496109_0019845
796 Ga0496110_0008352
797 Ga0496110_0042254
798 Ga0496111_0024561
799 Ga0496113_0018744
800 Ga0496116_0011662
801 Ga0496117_0000633
802 Ga0496117_0110348
803 Ga0496117_0168034
804 Ga0496117_0187258
805 Ga0496118_0000654
806 Ga0496118_0010750
807 Ga0496118_0024851
808 Ga0496118_0070052
809 Ga0496118_0187737
810 Ga0496118_0217337
811 Ga0496119_0010246
812 Ga0496120_0017741
813 Ga0496120_0102992
814 Ga0496121_0000454
815 Ga0496121_0071532
816 Ga0496121_0113228
817 Ga0496122_0001352
818 Ga0496122_0036640
819 Ga0496122_0070406
820 Ga0496122_0093525
821 Ga0496123_0000465
822 Ga0496123_0022020
823 Ga0496123_0029963
824 Ga0496123_0045638
825 Ga0496123_0064154
826 Ga0496124_0000664
827 Ga0496124_0002038
828 Ga0496124_0008038
829 Ga0496124_0102915
830 Ga0496124_0106034
831 Ga0496124_0177029
832 Ga0496124_0238196
833 Ga0496125_0018322
834 Ga0496125_0024468
835 Ga0496125_0076136
836 Ga0496125_0132936
837 Ga0496126_0030460
838 Ga0496126_0093505
839 Ga0496126_0180428
840 Ga0495682_0023125
841 Ga0501031_0130277
842 Ga0501032_0062790
843 Ga0501033_0010630
844 Ga0501034_0075887
845 Ga0501036_0044978
846 Ga0501037_0066682
847 Ga0501038_0025913
848 Ga0501039_0015976
849 Ga0501043_0220013
850 Ga0501046_0297272
851 Ga0501047_0125830
852 Ga0501048_0194916
853 Ga0501223_000021
854 Ga0501225_0000011
855 Ga0501225_0019452
856 Ga0501035_0012696
857 Ga0501044_0044360
858 nmdc:mga03n38_1172_c1
859 nmdc:mga0k408_76067_c1
860 nmdc:mga06z11_59_c2
861 nmdc:mga04h51_11080_c1
862 nmdc:mga05p37_388028_c1
863 Ga0500651_0139240
864 Ga0500555_015164
865 Ga0500562_015571
866 Ga0500592_009184
867 Ga0500592_016041
868 Ga0500597_006565
869 Ga0500608_194398
870 Ga0500568_0003398
871 Ga0500604_0074795
872 Ga0500616_0071306
873 Ga0500624_000008
874 Ga0500624_000012
875 Ga0500627_0000028
876 Ga0500637_0000101
877 Ga0500611_001800
878 Ga0466962_0001247
879 2512643711
880 2643820289
881 2643834607
882 2644055533
883 2778124763
884 2809064346
885 2809080314
886 2809084678
887 2852656259
888 2852683320
889 2880522085
890 2919713310

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

40

110

0.96

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

37

115

0.82

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

30

109

0.72

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

149

235

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mp4-assembly1.cif.gz_B crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure 0.883 2 206
4mp4-assembly2.cif.gz_C-2 crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure 0.8719 2 206
3bby-assembly1.cif.gz_A-2 crystal structure of glutathione s-transferase (np_416804.1) from escherichia coli k12 at 1.85 a resolution 0.8636 2 209
4mp4-assembly1.cif.gz_A crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure 0.8473 2 207
4mp4-assembly2.cif.gz_C-2 crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure 0.847 2 206
ID Description Score Start End Superfamily
3bbyA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8702 2 82 3.40.30.10
af_P77544_4_214_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8453 2 206 3.40.50.720
4mp4C02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.8394 86 193 1.20.1050.10
af_Q4CZ29_2_81_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.831 2 82 3.40.30.10
1n2aB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8276 1 81 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2W4ZCE3-F1-model_v4 Glutathione S-transferase 0.9971 2 196 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A2W5C6Y9-F1-model_v4 Glutathione S-transferase 0.9941 2 221 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A431J993-F1-model_v4 deleted 0.9864 1 160
AF-A5PCQ9-F1-model_v4 Glutathione S-transferase, N-terminal 0.9857 2 218 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A0B9A480-F1-model_v4 Glutathione S-transferase-like protein 0.9839 2 221 GO:0004364
GO:0006559
GO:0006749
GO:0016034

Map