F445618

General Info

Members Datasets Scaffolds Average Seq Length
445 181 445 208

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_134588_c1|nmdc:mga0n895_134588_c1_480_1109
Length 195
Sequence MQRFDIITEADARVLPRGETVMLARGGHVTPLAADTLRERRVLVIHEGGTSPDDSSLAPRAEIRTIAVGSDHTGAALRRRLVAFLRGRGLTVRDLGGEEGVVVDYPDVAASVATSVTRGESDAANKVAGVRAAMCTNETLARYSREHNGANVLTLGSTLVTADEAQAIVLTWLTTPMREPRYIRRLAKIRDLEKR

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
139 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
140 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
141 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
142 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
143 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
144 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
145 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
152 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
153 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
154 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
178 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
179 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.92
Rhizosphere 97.08
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10067826 3300005290 Bacteria 27846
2 Ga0065715_10001091 3300005293 Bacteria 9278
3 Ga0065707_10027415 3300005295 Unclassified 982
4 Ga0070676_10002514 3300005328 Bacteria 9414
5 Ga0070683_100596202 3300005329 Bacteria 1057
6 Ga0070690_100024456 3300005330 Bacteria 3713
7 Ga0070690_100026268 3300005330 Unclassified 3591
8 Ga0070670_100001157 3300005331 Bacteria 20903
9 Ga0070670_100047002 3300005331 Bacteria 3713
10 Ga0070677_10000434 3300005333 Bacteria 14385
11 Ga0070677_10136468 3300005333 Bacteria 1126
12 Ga0068869_100001429 3300005334 Bacteria 14144
13 Ga0068869_100009875 3300005334 Bacteria 6199
14 Ga0068869_100146541 3300005334 Bacteria 1828
15 Ga0068869_100323028 3300005334 Unclassified 1252
16 Ga0068869_100361786 3300005334 Bacteria 1185
17 Ga0068869_100392267 3300005334 Unclassified 1140
18 Ga0070666_10001709 3300005335 Bacteria 13392
19 Ga0070666_10015963 3300005335 Bacteria 4797
20 Ga0070666_10066121 3300005335 Bacteria 2453
21 Ga0070680_100461561 3300005336 Bacteria 1085
22 Ga0068868_100003970 3300005338 Bacteria 10329
23 Ga0068868_100043532 3300005338 Bacteria 3507
24 Ga0070689_100006234 3300005340 Bacteria 8231
25 Ga0070689_100079286 3300005340 Bacteria 2575
26 Ga0070689_100259469 3300005340 Bacteria 1436
27 Ga0070687_100002549 3300005343 Bacteria 6872
28 Ga0070687_100109151 3300005343 Bacteria 1563
29 Ga0070687_100468954 3300005343 Bacteria 841
30 Ga0070661_100013969 3300005344 Bacteria 5646
31 Ga0070661_100093566 3300005344 Bacteria 2227
32 Ga0070668_100039635 3300005347 Bacteria 3602
33 Ga0070668_100645007 3300005347 Bacteria 930
34 Ga0070669_100000985 3300005353 Bacteria 20776
35 Ga0070669_100013232 3300005353 Bacteria 5865
36 Ga0070669_100242373 3300005353 Bacteria 1433
37 Ga0070669_100478578 3300005353 Bacteria 1030
38 Ga0070669_100534166 3300005353 Bacteria 976
39 Ga0070675_100001019 3300005354 Bacteria 20145
40 Ga0070675_100018889 3300005354 Bacteria 5489
41 Ga0070675_100021726 3300005354 Bacteria 5127
42 Ga0070671_100007203 3300005355 Bacteria 8894
43 Ga0070674_100126576 3300005356 Bacteria 1899
44 Ga0070674_100154264 3300005356 Bacteria 1736
45 Ga0070674_100358454 3300005356 Bacteria 1180
46 Ga0070673_100040268 3300005364 Bacteria 3583
47 Ga0070673_100044033 3300005364 Bacteria 3453
48 Ga0070673_100427059 3300005364 Unclassified 1189
49 Ga0070688_100003136 3300005365 Bacteria 8455
50 Ga0070688_100025205 3300005365 Bacteria 3519
51 Ga0070659_100761875 3300005366 Unclassified 840
52 Ga0070667_100022694 3300005367 Bacteria 5204
53 Ga0070667_100116822 3300005367 Bacteria 2317
54 Ga0070667_100260051 3300005367 Bacteria 1554
55 Ga0070667_100294324 3300005367 Bacteria 1461
56 Ga0070701_10003750 3300005438 Bacteria 6071
57 Ga0070701_10012102 3300005438 Bacteria 3880
58 Ga0070705_100221196 3300005440 Bacteria 1311
59 Ga0070700_100010640 3300005441 Bacteria 5081
60 Ga0070700_100153854 3300005441 Bacteria 1576
61 Ga0070694_100002830 3300005444 Bacteria 10303
62 Ga0070694_100089460 3300005444 Bacteria 2157
63 Ga0070694_100387763 3300005444 Bacteria 1091
64 Ga0070708_100074638 3300005445 Bacteria 3059
65 Ga0070678_100032050 3300005456 Bacteria 3633
66 Ga0070678_100774009 3300005456 Unclassified 870
67 Ga0068867_100001729 3300005459 Bacteria 15211
68 Ga0068867_100067293 3300005459 Bacteria 2670
69 Ga0068867_100229525 3300005459 Bacteria 1500
70 Ga0068867_100819917 3300005459 Bacteria 831
71 Ga0070685_10023745 3300005466 Bacteria 3360
72 Ga0070685_10154317 3300005466 Bacteria 1458
73 Ga0070706_100652427 3300005467 Bacteria 977
74 Ga0070707_100012543 3300005468 Bacteria 7916
75 Ga0070697_100083836 3300005536 Bacteria 2629
76 Ga0070672_100001095 3300005543 Bacteria 16521
77 Ga0070672_100056887 3300005543 Bacteria 3069
78 Ga0070672_100105451 3300005543 Bacteria 2292
79 Ga0070672_100131015 3300005543 Bacteria 2061
80 Ga0070686_100005664 3300005544 Bacteria 6919
81 Ga0070686_100070430 3300005544 Bacteria 2287
82 Ga0070695_100207259 3300005545 Bacteria 1405
83 Ga0070695_100332288 3300005545 Bacteria 1133
84 Ga0070696_100074610 3300005546 Bacteria 2392
85 Ga0070665_100011255 3300005548 Bacteria 9048
86 Ga0070665_100015158 3300005548 Bacteria 7738
87 Ga0070665_100044465 3300005548 Bacteria 4460
88 Ga0070704_100119686 3300005549 Bacteria 2020
89 Ga0070704_100280065 3300005549 Bacteria 1381
90 Ga0070704_100621573 3300005549 Bacteria 951
91 Ga0070664_100002638 3300005564 Bacteria 14464
92 Ga0070664_100004803 3300005564 Bacteria 10831
93 Ga0070664_100054570 3300005564 Bacteria 3390
94 Ga0070664_100092572 3300005564 Bacteria 2618
95 Ga0070664_100591874 3300005564 Bacteria 1028
96 Ga0068854_100332778 3300005578 Bacteria 1238
97 Ga0068856_100309563 3300005614 Bacteria 1597
98 Ga0070702_100076810 3300005615 Bacteria 1989
99 Ga0070702_100294323 3300005615 Bacteria 1120
100 Ga0068852_100181419 3300005616 Bacteria 1980
101 Ga0068859_100004833 3300005617 Bacteria 13719
102 Ga0068859_100020533 3300005617 Bacteria 6629
103 Ga0068864_100024558 3300005618 Bacteria 5071
104 Ga0068864_100190253 3300005618 Bacteria 1881
105 Ga0068864_100223053 3300005618 Bacteria 1740
106 Ga0068864_100478016 3300005618 Unclassified 1195
107 Ga0068866_10113991 3300005718 Bacteria 1513
108 Ga0068861_100047545 3300005719 Bacteria 3239
109 Ga0068861_100081450 3300005719 Bacteria 2534
110 Ga0068861_100106100 3300005719 Bacteria 2243
111 Ga0068861_100606971 3300005719 Bacteria 1005
112 Ga0068870_10377438 3300005840 Bacteria 917
113 Ga0068863_100014491 3300005841 Bacteria 7592
114 Ga0068863_100022970 3300005841 Bacteria 5961
115 Ga0068863_100085412 3300005841 Bacteria 2991
116 Ga0068863_100129213 3300005841 Bacteria 2412
117 Ga0068858_100024275 3300005842 Bacteria 5651
118 Ga0068858_100028800 3300005842 Bacteria 5157
119 Ga0068858_100191886 3300005842 Bacteria 1930
120 Ga0068860_100003450 3300005843 Bacteria 16260
121 Ga0068860_100312255 3300005843 Bacteria 1542
122 Ga0068862_101247424 3300005844 Bacteria 743
123 Ga0081539_10003749 3300005985 Bacteria 18053
124 Ga0081539_10107171 3300005985 Bacteria 1413
125 Ga0070716_100285454 3300006173 Bacteria 1141
126 Ga0097621_100036288 3300006237 Bacteria 3944
127 Ga0097621_100240643 3300006237 Bacteria 1582
128 Ga0097621_100476243 3300006237 Bacteria 1128
129 Ga0068871_100012716 3300006358 Bacteria 6222
130 Ga0068871_100026556 3300006358 Bacteria 4519
131 Ga0068871_100042953 3300006358 Bacteria 3631
132 Ga0068871_100090622 3300006358 Bacteria 2547
133 Ga0075428_100026289 3300006844 Bacteria 6445
134 Ga0075428_100180687 3300006844 Bacteria 2284
135 Ga0075428_101052180 3300006844 Bacteria 860
136 Ga0075428_101244293 3300006844 Unclassified 784
137 Ga0075430_100001195 3300006846 Bacteria 20824
138 Ga0075431_100097745 3300006847 Bacteria 3032
139 Ga0075431_100323811 3300006847 Bacteria 1554
140 Ga0075433_10000087 3300006852 Bacteria 42396
141 Ga0075433_10000414 3300006852 Bacteria 27216
142 Ga0075433_10015183 3300006852 Bacteria 6311
143 Ga0075433_10107739 3300006852 Bacteria 2471
144 Ga0075434_100000626 3300006871 Bacteria 27295
145 Ga0075434_100012503 3300006871 Bacteria 8052
146 Ga0075434_100012663 3300006871 Bacteria 7999
147 Ga0075434_100040577 3300006871 Bacteria 4609
148 Ga0075434_100208665 3300006871 Bacteria 1974
149 Ga0075429_100043050 3300006880 Bacteria 3929
150 Ga0075429_100126501 3300006880 Bacteria 2235
151 Ga0075429_100233616 3300006880 Bacteria 1611
152 Ga0075429_101160181 3300006880 Unclassified 674
153 Ga0068865_100012806 3300006881 Bacteria 5287
154 Ga0068865_100266930 3300006881 Bacteria 1357
155 Ga0068865_100318220 3300006881 Unclassified 1251
156 Ga0068865_100670014 3300006881 Unclassified 883
157 Ga0075436_100000266 3300006914 Bacteria 32724
158 Ga0075436_100306695 3300006914 Bacteria 1138
159 Ga0075436_100358299 3300006914 Unclassified 1052
160 Ga0097620_100004833 3300006931 Bacteria 13719
161 Ga0097620_100020533 3300006931 Bacteria 6629
162 Ga0075435_100000009 3300007076 Bacteria 114381
163 Ga0075435_100015712 3300007076 Bacteria 5695
164 Ga0075435_100033442 3300007076 Bacteria 4066
165 Ga0075435_100040052 3300007076 Bacteria 3741
166 Ga0075435_100332219 3300007076 Bacteria 1302
167 Ga0111539_10000161 3300009094 Bacteria 76584
168 Ga0111539_10011889 3300009094 Bacteria 10910
169 Ga0111539_10016933 3300009094 Bacteria 9022
170 Ga0111539_10026054 3300009094 Bacteria 7157
171 Ga0111539_10094462 3300009094 Bacteria 3513
172 Ga0111539_10285762 3300009094 Bacteria 1920
173 Ga0105245_10053672 3300009098 Bacteria 3618
174 Ga0105245_10069305 3300009098 Bacteria 3198
175 Ga0105245_10149671 3300009098 Bacteria 2206
176 Ga0105245_10158901 3300009098 Bacteria 2143
177 Ga0105245_10328879 3300009098 Bacteria 1508
178 Ga0105245_10425865 3300009098 Bacteria 1331
179 Ga0105245_11001609 3300009098 Bacteria 880
180 Ga0105247_10195887 3300009101 Bacteria 1355
181 Ga0105247_10258819 3300009101 Bacteria 1192
182 Ga0114129_10008842 3300009147 Bacteria 14372
183 Ga0114129_10012536 3300009147 Bacteria 12073
184 Ga0114129_10023167 3300009147 Bacteria 8807
185 Ga0114129_10133974 3300009147 Bacteria 3401
186 Ga0114129_10203181 3300009147 Bacteria 2682
187 Ga0114129_10322850 3300009147 Unclassified 2052
188 Ga0114129_11049477 3300009147 Bacteria 1023
189 Ga0105243_10015170 3300009148 Bacteria 5831
190 Ga0105243_10714442 3300009148 Bacteria 978
191 Ga0105243_11268619 3300009148 Unclassified 753
192 Ga0105241_10039584 3300009174 Bacteria 3556
193 Ga0105242_10020323 3300009176 Bacteria 5206
194 Ga0105242_10022829 3300009176 Bacteria 4926
195 Ga0105242_10037605 3300009176 Bacteria 3888
196 Ga0105242_10088761 3300009176 Bacteria 2598
197 Ga0105242_10127881 3300009176 Bacteria 2189
198 Ga0105242_10277838 3300009176 Bacteria 1520
199 Ga0105248_10019547 3300009177 Bacteria 7497
200 Ga0105248_10023221 3300009177 Bacteria 6888
201 Ga0105248_10070590 3300009177 Bacteria 3922
202 Ga0105248_10164328 3300009177 Bacteria 2503
203 Ga0105248_10190659 3300009177 Bacteria 2310
204 Ga0105248_10747120 3300009177 Bacteria 1104
205 Ga0105249_10000849 3300009553 Bacteria 27295
206 Ga0105249_10321609 3300009553 Bacteria 1558
207 Ga0105249_10418419 3300009553 Unclassified 1373
208 Ga0105246_10039091 3300011119 Bacteria 3193
209 Ga0157374_10030541 3300013296 Bacteria 4894
210 Ga0163162_10182118 3300013306 Bacteria 2227
211 Ga0163162_10538849 3300013306 Bacteria 1296
212 Ga0163162_10992678 3300013306 Bacteria 949
213 Ga0157375_10590832 3300013308 Bacteria 1270
214 Ga0157375_10979438 3300013308 Bacteria 986
215 Ga0157375_11146392 3300013308 Unclassified 911
216 Ga0163163_10008809 3300014325 Bacteria 8982
217 Ga0163163_10021206 3300014325 Bacteria 6128
218 Ga0163163_10318469 3300014325 Bacteria 1609
219 Ga0163163_10373774 3300014325 Bacteria 1482
220 Ga0157380_10007939 3300014326 Bacteria 7556
221 Ga0157380_10016962 3300014326 Bacteria 5380
222 Ga0157380_10062355 3300014326 Bacteria 2986
223 Ga0157380_10071915 3300014326 Bacteria 2799
224 Ga0157380_10209611 3300014326 Bacteria 1735
225 Ga0157380_10331557 3300014326 Bacteria 1415
226 Ga0157380_10489562 3300014326 Bacteria 1192
227 Ga0157377_10044302 3300014745 Bacteria 2480
228 Ga0157379_10027012 3300014968 Bacteria 5108
229 Ga0157379_10053237 3300014968 Bacteria 3616
230 Ga0157376_10177108 3300014969 Bacteria 1946
231 Ga0157376_10202563 3300014969 Bacteria 1827
232 Ga0207673_1006520 3300025290 Bacteria 1446
233 Ga0207697_10000700 3300025315 Bacteria 19071
234 Ga0207682_10001270 3300025893 Bacteria 11594
235 Ga0207710_10260627 3300025900 Unclassified 869
236 Ga0207688_10004180 3300025901 Bacteria 7866
237 Ga0207680_10008194 3300025903 Bacteria 5121
238 Ga0207680_10066318 3300025903 Bacteria 2220
239 Ga0207680_10095313 3300025903 Bacteria 1901
240 Ga0207685_10094764 3300025905 Bacteria 1265
241 Ga0207699_10035634 3300025906 Bacteria 2832
242 Ga0207645_10002538 3300025907 Bacteria 14289
243 Ga0207645_10006287 3300025907 Bacteria 8537
244 Ga0207643_10000138 3300025908 Bacteria 49379
245 Ga0207643_10050644 3300025908 Bacteria 2355
246 Ga0207643_10077683 3300025908 Bacteria 1919
247 Ga0207705_10450461 3300025909 Unclassified 998
248 Ga0207662_10001333 3300025918 Bacteria 11911
249 Ga0207662_10117297 3300025918 Bacteria 1666
250 Ga0207657_10414096 3300025919 Bacteria 1060
251 Ga0207649_10013889 3300025920 Bacteria 4505
252 Ga0207649_10156929 3300025920 Bacteria 1573
253 Ga0207649_10215049 3300025920 Bacteria 1366
254 Ga0207646_10164131 3300025922 Bacteria 2005
255 Ga0207681_10019145 3300025923 Bacteria 4322
256 Ga0207681_10071627 3300025923 Bacteria 2418
257 Ga0207681_10093885 3300025923 Bacteria 2149
258 Ga0207681_10525690 3300025923 Bacteria 971
259 Ga0207650_10001847 3300025925 Bacteria 14927
260 Ga0207659_10001457 3300025926 Bacteria 14140
261 Ga0207659_10003705 3300025926 Bacteria 9214
262 Ga0207659_10010656 3300025926 Bacteria 5780
263 Ga0207659_10011494 3300025926 Bacteria 5593
264 Ga0207659_10011758 3300025926 Bacteria 5541
265 Ga0207659_10049431 3300025926 Bacteria 2983
266 Ga0207659_10157875 3300025926 Bacteria 1778
267 Ga0207687_10046109 3300025927 Bacteria 3016
268 Ga0207687_10126203 3300025927 Bacteria 1921
269 Ga0207687_10161632 3300025927 Bacteria 1719
270 Ga0207687_10211603 3300025927 Bacteria 1521
271 Ga0207687_10312045 3300025927 Bacteria 1270
272 Ga0207644_10004034 3300025931 Bacteria 9527
273 Ga0207706_10002156 3300025933 Bacteria 19227
274 Ga0207686_10003019 3300025934 Bacteria 9069
275 Ga0207686_10477809 3300025934 Bacteria 963
276 Ga0207686_10566274 3300025934 Unclassified 890
277 Ga0207709_10011708 3300025935 Bacteria 4837
278 Ga0207709_10110313 3300025935 Bacteria 1838
279 Ga0207670_10005191 3300025936 Bacteria 7124
280 Ga0207670_10661442 3300025936 Bacteria 862
281 Ga0207670_10930520 3300025936 Bacteria 729
282 Ga0207669_10011625 3300025937 Bacteria 4292
283 Ga0207669_10311734 3300025937 Bacteria 1200
284 Ga0207704_10002413 3300025938 Bacteria 8406
285 Ga0207704_10247918 3300025938 Bacteria 1335
286 Ga0207704_10270865 3300025938 Bacteria 1286
287 Ga0207704_10296607 3300025938 Bacteria 1236
288 Ga0207691_10002649 3300025940 Bacteria 17491
289 Ga0207691_10018147 3300025940 Bacteria 6665
290 Ga0207691_10028470 3300025940 Bacteria 5232
291 Ga0207691_10069065 3300025940 Bacteria 3192
292 Ga0207691_10092617 3300025940 Bacteria 2706
293 Ga0207711_10033242 3300025941 Bacteria 4363
294 Ga0207711_10101736 3300025941 Bacteria 2543
295 Ga0207711_10190414 3300025941 Bacteria 1869
296 Ga0207711_10420961 3300025941 Unclassified 1242
297 Ga0207711_10431364 3300025941 Bacteria 1226
298 Ga0207689_10001347 3300025942 Bacteria 23609
299 Ga0207689_10008111 3300025942 Bacteria 9161
300 Ga0207689_10092992 3300025942 Bacteria 2477
301 Ga0207689_10223107 3300025942 Bacteria 1557
302 Ga0207679_10137860 3300025945 Bacteria 1967
303 Ga0207651_10005003 3300025960 Bacteria 6759
304 Ga0207651_10007223 3300025960 Bacteria 5906
305 Ga0207651_10065420 3300025960 Bacteria 2549
306 Ga0207651_10161505 3300025960 Bacteria 1757
307 Ga0207651_10178073 3300025960 Bacteria 1684
308 Ga0207712_10009601 3300025961 Bacteria 6127
309 Ga0207712_10402010 3300025961 Unclassified 1151
310 Ga0207712_10558505 3300025961 Bacteria 985
311 Ga0207668_10585128 3300025972 Bacteria 971
312 Ga0207658_10010408 3300025986 Bacteria 6318
313 Ga0207658_10057155 3300025986 Bacteria 2898
314 Ga0207658_10222502 3300025986 Bacteria 1589
315 Ga0207677_10028815 3300026023 Bacteria 3519
316 Ga0207677_10051405 3300026023 Unclassified 2794
317 Ga0207677_10086281 3300026023 Bacteria 2268
318 Ga0207703_10062857 3300026035 Bacteria 3042
319 Ga0207703_10148233 3300026035 Bacteria 2043
320 Ga0207703_10240138 3300026035 Bacteria 1629
321 Ga0207703_10471115 3300026035 Bacteria 1176
322 Ga0207708_10029599 3300026075 Bacteria 4151
323 Ga0207708_10569150 3300026075 Bacteria 957
324 Ga0207641_10028218 3300026088 Bacteria 4636
325 Ga0207641_10158116 3300026088 Bacteria 2058
326 Ga0207641_10448503 3300026088 Bacteria 1246
327 Ga0207648_10001667 3300026089 Bacteria 24343
328 Ga0207648_10033002 3300026089 Bacteria 4568
329 Ga0207648_10059553 3300026089 Bacteria 3330
330 Ga0207648_10281115 3300026089 Bacteria 1488
331 Ga0207648_10332091 3300026089 Bacteria 1368
332 Ga0207676_10009893 3300026095 Bacteria 6784
333 Ga0207676_10039823 3300026095 Bacteria 3598
334 Ga0207676_10131305 3300026095 Bacteria 2130
335 Ga0207676_10161872 3300026095 Bacteria 1940
336 Ga0207676_10717165 3300026095 Bacteria 970
337 Ga0207675_100003681 3300026118 Bacteria 14938
338 Ga0207675_100027414 3300026118 Bacteria 5306
339 Ga0207675_100111678 3300026118 Bacteria 2579
340 Ga0207675_100190162 3300026118 Bacteria 1969
341 Ga0207675_100217815 3300026118 Bacteria 1838
342 Ga0207675_100460877 3300026118 Bacteria 1261
343 Ga0207683_10017416 3300026121 Bacteria 6124
344 Ga0207683_10070562 3300026121 Bacteria 3087
345 Ga0207683_10247703 3300026121 Bacteria 1626
346 Ga0207698_10191963 3300026142 Bacteria 1820
347 Ga0210002_1027233 3300027617 Unclassified 941
348 Ga0209974_10011030 3300027876 Bacteria 3042
349 Ga0209974_10065407 3300027876 Bacteria 1235
350 Ga0207428_10006937 3300027907 Bacteria 10379
351 Ga0207428_10040990 3300027907 Bacteria 3751
352 Ga0268266_10044128 3300028379 Bacteria 3810
353 Ga0268265_10029973 3300028380 Bacteria 3914
354 Ga0268265_10473989 3300028380 Bacteria 1174
355 Ga0268265_10483043 3300028380 Unclassified 1164
356 Ga0268264_11161142 3300028381 Bacteria 781
357 Ga0307409_100673752 3300031995 Bacteria 1031
358 Ga0373929_0052049 3300035085 Unclassified 938
359 Ga0373940_0085857 3300035088 Bacteria 937
360 Ga0373949_0022951 3300035090 Bacteria 1442
361 Ga0373932_0016075 3300035112 Bacteria 1906
362 Ga0373939_0013721 3300035114 Bacteria 2090
363 Ga0373960_0032379 3300035121 Bacteria 1468
364 Ga0373955_0051497 3300035172 Bacteria 2243
365 Ga0373955_0191853 3300035172 Bacteria 1215
366 Ga0373962_0012723 3300035242 Bacteria 2124
367 Ga0373962_0079520 3300035242 Bacteria 993
368 Ga0373931_0195593 3300035691 Bacteria 1205
369 Ga0373931_0311332 3300035691 Unclassified 975
370 Ga0439433_0011938 3300041999 Bacteria 1903
371 Ga0451576_0272649 3300045051 Bacteria 1769
372 Ga0451576_1198266 3300045051 Bacteria 793
373 Ga0495603_0452997 3300046455 Bacteria 735
374 Ga0495580_0397866 3300046472 Bacteria 929
375 Ga0495594_0062723 3300046499 Bacteria 2058
376 Ga0495598_0100828 3300046537 Bacteria 955
377 Ga0495656_0035759 3300046615 Bacteria 2042
378 Ga0495656_0127344 3300046615 Unclassified 1209
379 Ga0495659_0063743 3300046664 Bacteria 1367
380 Ga0495658_0046335 3300046683 Bacteria 2444
381 Ga0495674_0364025 3300047319 Bacteria 1172
382 Ga0496100_0023812 3300048903 Bacteria 3726
383 Ga0496100_0244315 3300048903 Bacteria 1326
384 Ga0496101_0001450 3300048904 Bacteria 14154
385 Ga0496102_0214851 3300048905 Bacteria 1812
386 Ga0496104_0030810 3300048907 Bacteria 4987
387 Ga0496104_0380922 3300048907 Bacteria 1323
388 Ga0496104_1032076 3300048907 Bacteria 726
389 Ga0496107_0742930 3300048910 Bacteria 720
390 Ga0496108_0724637 3300048911 Bacteria 861
391 Ga0496109_0054505 3300048912 Bacteria 3648
392 Ga0496109_0609571 3300048912 Bacteria 1028
393 Ga0496114_0012458 3300048917 Bacteria 6807
394 Ga0496114_0280559 3300048917 Bacteria 1469
395 Ga0501040_1019930 3300049576 Unclassified 600
396 Ga0501048_0125196 3300049582 Bacteria 1817
397 Ga0501072_0076863 3300049588 Bacteria 2642
398 Ga0501076_0323324 3300049592 Unclassified 1265
399 Ga0501081_0004819 3300049743 Bacteria 8671
400 Ga0501081_0295373 3300049743 Bacteria 1188
401 nmdc:mga05p37_1189558_c1 3300050507 Bacteria 789
402 nmdc:mga05p37_133704_c1 3300050507 Bacteria 3043
403 nmdc:mga05p37_189705_c1 3300050507 Bacteria 2496
404 nmdc:mga05p37_24822_c1 3300050507 Bacteria 6265
405 nmdc:mga05p37_48514_c1 3300050507 Bacteria 5222
406 nmdc:mga05p37_711521_c1 3300050507 Bacteria 1114
407 nmdc:mga05p37_762036_c1 3300050507 Bacteria 1065
408 nmdc:mga05p37_82816_c1 3300050507 Bacteria 3953
409 nmdc:mga09592_21714_c1 3300050508 Bacteria 5292
410 nmdc:mga09592_24939_c1 3300050508 Bacteria 4946
411 nmdc:mga09592_84262_c1 3300050508 Bacteria 2710
412 nmdc:mga0qj67_1228_c1 3300050509 Bacteria 17870
413 nmdc:mga0qj67_317200_c1 3300050509 Bacteria 1262
414 nmdc:mga06r32_1311_c1 3300050510 Bacteria 22452
415 nmdc:mga06r32_988661_c1 3300050510 Bacteria 794
416 nmdc:mga08y16_11410_c1 3300050511 Bacteria 9336
417 nmdc:mga08y16_1170_c1 3300050511 Bacteria 25854
418 nmdc:mga08y16_16556_c1 3300050511 Bacteria 7755
419 nmdc:mga08y16_211895_c1 3300050511 Bacteria 2007
420 nmdc:mga08y16_52006_c1 3300050511 Bacteria 4286
421 nmdc:mga0n895_121784_c1 3300050512 Bacteria 2630
422 nmdc:mga0n895_134588_c1 3300050512 Bacteria 2497
423 nmdc:mga0n895_19525_c1 3300050512 Bacteria 6301
424 nmdc:mga0n895_38241_c1 3300050512 Unclassified 4648
425 nmdc:mga0n895_570204_c1 3300050512 Bacteria 1137
426 nmdc:mga0n895_76_c1 3300050512 Bacteria 56942
427 nmdc:mga0rr50_105686_c1 3300050513 Bacteria 2220
428 nmdc:mga0rr50_11116_c1 3300050513 Bacteria 5745
429 nmdc:mga0rr50_174356_c1 3300050513 Unclassified 1754
430 nmdc:mga0rr50_25_c1 3300050513 Bacteria 114931
431 nmdc:mga0rr50_3825_c1 3300050513 Bacteria 8739
432 nmdc:mga0rr50_386219_c1 3300050513 Bacteria 1181
433 nmdc:mga0rr50_433484_c1 3300050513 Bacteria 1113
434 nmdc:mga08x19_13897_c1 3300050514 Bacteria 4876
435 nmdc:mga08x19_339_c1 3300050514 Bacteria 33785
436 nmdc:mga08x19_43329_c1 3300050514 Bacteria 2871
437 nmdc:mga0a205_151_c1 3300050515 Bacteria 29511
438 nmdc:mga0a205_169673_c1 3300050515 Bacteria 2078
439 nmdc:mga0a205_17824_c1 3300050515 Bacteria 6665
440 nmdc:mga0a205_5532_c1 3300050515 Bacteria 11382
441 nmdc:mga0a205_58538_c1 3300050515 Bacteria 3721
442 nmdc:mga0a205_6986_c1 3300050515 Bacteria 10203
443 Ga0495595_0261727 3300053084 Bacteria 867
444 Ga0501084_0211043 3300054114 Bacteria 1638
445 Ga0590075_004621 3300059424 Bacteria 3260

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009553 Ga0105249_10418419 Ga0105249_104184191 170
2 3300009174 Ga0105241_10039584 Ga0105241_100395843 174
3 3300049576 Ga0501040_1019930 Ga0501040_1019930_39_590 182
4 3300050513 nmdc:mga0rr50_386219_c1 nmdc:mga0rr50_386219_c1_17_583 187
5 3300050512 nmdc:mga0n895_134588_c1 nmdc:mga0n895_134588_c1_480_1109 189
6 3300005445 Ga0070708_100074638 Ga0070708_1000746383 192
7 3300005367 Ga0070667_100116822 Ga0070667_1001168222 195
8 3300005444 Ga0070694_100002830 Ga0070694_1000028305 195
9 3300005842 Ga0068858_100028800 Ga0068858_1000288006 195
10 3300009101 Ga0105247_10195887 Ga0105247_101958872 195
11 3300014325 Ga0163163_10021206 Ga0163163_100212061 195
12 3300025986 Ga0207658_10057155 Ga0207658_100571554 195
13 3300026035 Ga0207703_10240138 Ga0207703_102401382 195
14 3300006852 Ga0075433_10107739 Ga0075433_101077393 198
15 3300009147 Ga0114129_10008842 Ga0114129_1000884213 198
16 3300050507 nmdc:mga05p37_24822_c1 nmdc:mga05p37_24822_c1_2139_2768 198
17 3300050515 nmdc:mga0a205_169673_c1 nmdc:mga0a205_169673_c1_1064_1693 198
18 3300006237 Ga0097621_100476243 Ga0097621_1004762432 201
19 3300009147 Ga0114129_10203181 Ga0114129_102031813 201
20 3300009177 Ga0105248_10019547 Ga0105248_100195477 201
21 3300013306 Ga0163162_10538849 Ga0163162_105388492 201
22 3300050507 nmdc:mga05p37_82816_c1 nmdc:mga05p37_82816_c1_1453_2076 201
23 3300006844 Ga0075428_101052180 Ga0075428_1010521802 202
24 3300006871 Ga0075434_100012663 Ga0075434_1000126636 202
25 3300006914 Ga0075436_100000266 Ga0075436_10000026625 202
26 3300007076 Ga0075435_100000009 Ga0075435_10000000973 202
27 3300009094 Ga0111539_10094462 Ga0111539_100944624 202
28 3300050507 nmdc:mga05p37_1189558_c1 nmdc:mga05p37_1189558_c1_148_774 202
29 3300050512 nmdc:mga0n895_76_c1 nmdc:mga0n895_76_c1_25589_26215 202
30 3300050513 nmdc:mga0rr50_25_c1 nmdc:mga0rr50_25_c1_26304_26930 202
31 3300050514 nmdc:mga08x19_339_c1 nmdc:mga08x19_339_c1_4191_4817 202
32 3300005334 Ga0068869_100361786 Ga0068869_1003617862 203
33 3300005365 Ga0070688_100025205 Ga0070688_1000252053 203
34 3300005459 Ga0068867_100229525 Ga0068867_1002295253 203
35 3300005468 Ga0070707_100012543 Ga0070707_1000125437 203
36 3300005545 Ga0070695_100332288 Ga0070695_1003322882 203
37 3300005546 Ga0070696_100074610 Ga0070696_1000746102 203
38 3300005549 Ga0070704_100280065 Ga0070704_1002800652 203
39 3300005549 Ga0070704_100621573 Ga0070704_1006215731 203
40 3300005618 Ga0068864_100190253 Ga0068864_1001902532 203
41 3300005985 Ga0081539_10107171 Ga0081539_101071712 203
42 3300006173 Ga0070716_100285454 Ga0070716_1002854542 203
43 3300006237 Ga0097621_100240643 Ga0097621_1002406432 203
44 3300006844 Ga0075428_100180687 Ga0075428_1001806873 203
45 3300006852 Ga0075433_10000087 Ga0075433_1000008734 203
46 3300006852 Ga0075433_10000414 Ga0075433_1000041415 203
47 3300006871 Ga0075434_100000626 Ga0075434_10000062620 203
48 3300006871 Ga0075434_100012503 Ga0075434_1000125039 203
49 3300006871 Ga0075434_100208665 Ga0075434_1002086652 203
50 3300006880 Ga0075429_100233616 Ga0075429_1002336163 203
51 3300006914 Ga0075436_100306695 Ga0075436_1003066952 203
52 3300006914 Ga0075436_100358299 Ga0075436_1003582992 203
53 3300007076 Ga0075435_100015712 Ga0075435_1000157122 203
54 3300007076 Ga0075435_100033442 Ga0075435_1000334423 203
55 3300007076 Ga0075435_100332219 Ga0075435_1003322192 203
56 3300009098 Ga0105245_10425865 Ga0105245_104258652 203
57 3300009147 Ga0114129_10012536 Ga0114129_100125366 203
58 3300009147 Ga0114129_10133974 Ga0114129_101339742 203
59 3300009147 Ga0114129_10322850 Ga0114129_103228502 203
60 3300009148 Ga0105243_10714442 Ga0105243_107144422 203
61 3300025906 Ga0207699_10035634 Ga0207699_100356341 203
62 3300025922 Ga0207646_10164131 Ga0207646_101641312 203
63 3300025927 Ga0207687_10312045 Ga0207687_103120452 203
64 3300025938 Ga0207704_10247918 Ga0207704_102479182 203
65 3300025942 Ga0207689_10223107 Ga0207689_102231072 203
66 3300025972 Ga0207668_10585128 Ga0207668_105851282 203
67 3300026089 Ga0207648_10332091 Ga0207648_103320912 203
68 3300026095 Ga0207676_10161872 Ga0207676_101618722 203
69 3300026118 Ga0207675_100460877 Ga0207675_1004608771 203
70 3300031995 Ga0307409_100673752 Ga0307409_1006737522 203
71 3300046615 Ga0495656_0127344 Ga0495656_0127344_354_983 203
72 3300048917 Ga0496114_0280559 Ga0496114_0280559_785_1414 203
73 3300050507 nmdc:mga05p37_133704_c1 nmdc:mga05p37_133704_c1_468_1097 203
74 3300050507 nmdc:mga05p37_762036_c1 nmdc:mga05p37_762036_c1_163_792 203
75 3300050512 nmdc:mga0n895_121784_c1 nmdc:mga0n895_121784_c1_736_1350 203
76 3300050512 nmdc:mga0n895_570204_c1 nmdc:mga0n895_570204_c1_257_886 203
77 3300050513 nmdc:mga0rr50_105686_c1 nmdc:mga0rr50_105686_c1_872_1501 203
78 3300050513 nmdc:mga0rr50_11116_c1 nmdc:mga0rr50_11116_c1_3404_4033 203
79 3300050513 nmdc:mga0rr50_174356_c1 nmdc:mga0rr50_174356_c1_1089_1718 203
80 3300050513 nmdc:mga0rr50_3825_c1 nmdc:mga0rr50_3825_c1_6949_7563 203
81 3300050514 nmdc:mga08x19_13897_c1 nmdc:mga08x19_13897_c1_1730_2359 203
82 3300050514 nmdc:mga08x19_43329_c1 nmdc:mga08x19_43329_c1_215_844 203
83 3300050515 nmdc:mga0a205_151_c1 nmdc:mga0a205_151_c1_6236_6850 203
84 3300050515 nmdc:mga0a205_17824_c1 nmdc:mga0a205_17824_c1_3375_4004 203
85 3300050515 nmdc:mga0a205_58538_c1 nmdc:mga0a205_58538_c1_2057_2686 203
86 3300050515 nmdc:mga0a205_6986_c1 nmdc:mga0a205_6986_c1_563_1177 203
87 3300005334 Ga0068869_100323028 Ga0068869_1003230282 204
88 3300005843 Ga0068860_100312255 Ga0068860_1003122553 204
89 3300006880 Ga0075429_101160181 Ga0075429_1011601811 204
90 3300009094 Ga0111539_10011889 Ga0111539_100118894 204
91 3300009098 Ga0105245_10053672 Ga0105245_100536723 204
92 3300009098 Ga0105245_11001609 Ga0105245_110016091 204
93 3300025927 Ga0207687_10211603 Ga0207687_102116032 204
94 3300025961 Ga0207712_10402010 Ga0207712_104020102 204
95 3300026089 Ga0207648_10281115 Ga0207648_102811153 204
96 3300028380 Ga0268265_10473989 Ga0268265_104739891 204
97 3300028380 Ga0268265_10483043 Ga0268265_104830432 204
98 3300041999 Ga0439433_0011938 Ga0439433_0011938_398_1027 204
99 3300050511 nmdc:mga08y16_16556_c1 nmdc:mga08y16_16556_c1_1449_2066 204
100 3300059424 Ga0590075_004621 Ga0590075_004621_2170_2799 204
101 3300005290 Ga0065712_10067826 Ga0065712_1006782624 205
102 3300005293 Ga0065715_10001091 Ga0065715_1000109113 205
103 3300005295 Ga0065707_10027415 Ga0065707_100274152 205
104 3300005328 Ga0070676_10002514 Ga0070676_1000251411 205
105 3300005329 Ga0070683_100596202 Ga0070683_1005962022 205
106 3300005330 Ga0070690_100024456 Ga0070690_1000244562 205
107 3300005330 Ga0070690_100026268 Ga0070690_1000262683 205
108 3300005331 Ga0070670_100001157 Ga0070670_10000115719 205
109 3300005331 Ga0070670_100047002 Ga0070670_1000470024 205
110 3300005333 Ga0070677_10000434 Ga0070677_1000043411 205
111 3300005333 Ga0070677_10136468 Ga0070677_101364682 205
112 3300005334 Ga0068869_100001429 Ga0068869_10000142912 205
113 3300005334 Ga0068869_100009875 Ga0068869_1000098755 205
114 3300005334 Ga0068869_100146541 Ga0068869_1001465412 205
115 3300005334 Ga0068869_100392267 Ga0068869_1003922672 205
116 3300005335 Ga0070666_10001709 Ga0070666_100017099 205
117 3300005335 Ga0070666_10015963 Ga0070666_100159631 205
118 3300005335 Ga0070666_10066121 Ga0070666_100661212 205
119 3300005336 Ga0070680_100461561 Ga0070680_1004615611 205
120 3300005338 Ga0068868_100003970 Ga0068868_10000397014 205
121 3300005338 Ga0068868_100043532 Ga0068868_1000435322 205
122 3300005340 Ga0070689_100006234 Ga0070689_1000062343 205
123 3300005340 Ga0070689_100079286 Ga0070689_1000792864 205
124 3300005340 Ga0070689_100259469 Ga0070689_1002594692 205
125 3300005343 Ga0070687_100002549 Ga0070687_1000025494 205
126 3300005343 Ga0070687_100109151 Ga0070687_1001091512 205
127 3300005343 Ga0070687_100468954 Ga0070687_1004689542 205
128 3300005344 Ga0070661_100013969 Ga0070661_1000139697 205
129 3300005344 Ga0070661_100093566 Ga0070661_1000935662 205
130 3300005347 Ga0070668_100039635 Ga0070668_1000396355 205
131 3300005347 Ga0070668_100645007 Ga0070668_1006450072 205
132 3300005353 Ga0070669_100000985 Ga0070669_10000098519 205
133 3300005353 Ga0070669_100013232 Ga0070669_1000132325 205
134 3300005353 Ga0070669_100242373 Ga0070669_1002423732 205
135 3300005353 Ga0070669_100478578 Ga0070669_1004785781 205
136 3300005353 Ga0070669_100534166 Ga0070669_1005341662 205
137 3300005354 Ga0070675_100001019 Ga0070675_10000101911 205
138 3300005354 Ga0070675_100018889 Ga0070675_1000188894 205
139 3300005354 Ga0070675_100021726 Ga0070675_1000217263 205
140 3300005355 Ga0070671_100007203 Ga0070671_1000072033 205
141 3300005356 Ga0070674_100126576 Ga0070674_1001265762 205
142 3300005356 Ga0070674_100154264 Ga0070674_1001542642 205
143 3300005356 Ga0070674_100358454 Ga0070674_1003584542 205
144 3300005364 Ga0070673_100040268 Ga0070673_1000402682 205
145 3300005364 Ga0070673_100044033 Ga0070673_1000440334 205
146 3300005364 Ga0070673_100427059 Ga0070673_1004270591 205
147 3300005365 Ga0070688_100003136 Ga0070688_1000031362 205
148 3300005366 Ga0070659_100761875 Ga0070659_1007618752 205
149 3300005367 Ga0070667_100022694 Ga0070667_1000226947 205
150 3300005367 Ga0070667_100260051 Ga0070667_1002600512 205
151 3300005367 Ga0070667_100294324 Ga0070667_1002943242 205
152 3300005438 Ga0070701_10003750 Ga0070701_100037506 205
153 3300005438 Ga0070701_10012102 Ga0070701_100121022 205
154 3300005440 Ga0070705_100221196 Ga0070705_1002211962 205
155 3300005441 Ga0070700_100010640 Ga0070700_1000106402 205
156 3300005441 Ga0070700_100153854 Ga0070700_1001538542 205
157 3300005444 Ga0070694_100089460 Ga0070694_1000894602 205
158 3300005444 Ga0070694_100387763 Ga0070694_1003877632 205
159 3300005456 Ga0070678_100032050 Ga0070678_1000320502 205
160 3300005456 Ga0070678_100774009 Ga0070678_1007740091 205
161 3300005459 Ga0068867_100001729 Ga0068867_10000172911 205
162 3300005459 Ga0068867_100067293 Ga0068867_1000672932 205
163 3300005459 Ga0068867_100819917 Ga0068867_1008199172 205
164 3300005466 Ga0070685_10023745 Ga0070685_100237452 205
165 3300005466 Ga0070685_10154317 Ga0070685_101543171 205
166 3300005467 Ga0070706_100652427 Ga0070706_1006524271 205
167 3300005536 Ga0070697_100083836 Ga0070697_1000838362 205
168 3300005543 Ga0070672_100001095 Ga0070672_1000010957 205
169 3300005543 Ga0070672_100056887 Ga0070672_1000568873 205
170 3300005543 Ga0070672_100105451 Ga0070672_1001054512 205
171 3300005543 Ga0070672_100131015 Ga0070672_1001310152 205
172 3300005544 Ga0070686_100005664 Ga0070686_1000056649 205
173 3300005544 Ga0070686_100070430 Ga0070686_1000704303 205
174 3300005545 Ga0070695_100207259 Ga0070695_1002072592 205
175 3300005548 Ga0070665_100011255 Ga0070665_10001125510 205
176 3300005548 Ga0070665_100015158 Ga0070665_1000151585 205
177 3300005548 Ga0070665_100044465 Ga0070665_1000444656 205
178 3300005549 Ga0070704_100119686 Ga0070704_1001196863 205
179 3300005564 Ga0070664_100002638 Ga0070664_10000263816 205
180 3300005564 Ga0070664_100004803 Ga0070664_1000048033 205
181 3300005564 Ga0070664_100054570 Ga0070664_1000545702 205
182 3300005564 Ga0070664_100092572 Ga0070664_1000925723 205
183 3300005564 Ga0070664_100591874 Ga0070664_1005918741 205
184 3300005578 Ga0068854_100332778 Ga0068854_1003327782 205
185 3300005614 Ga0068856_100309563 Ga0068856_1003095632 205
186 3300005615 Ga0070702_100076810 Ga0070702_1000768102 205
187 3300005615 Ga0070702_100294323 Ga0070702_1002943231 205
188 3300005616 Ga0068852_100181419 Ga0068852_1001814192 205
189 3300005617 Ga0068859_100004833 Ga0068859_10000483311 205
190 3300005617 Ga0068859_100020533 Ga0068859_1000205336 205
191 3300005618 Ga0068864_100024558 Ga0068864_1000245585 205
192 3300005618 Ga0068864_100223053 Ga0068864_1002230532 205
193 3300005618 Ga0068864_100478016 Ga0068864_1004780162 205
194 3300005718 Ga0068866_10113991 Ga0068866_101139912 205
195 3300005719 Ga0068861_100047545 Ga0068861_1000475452 205
196 3300005719 Ga0068861_100081450 Ga0068861_1000814503 205
197 3300005719 Ga0068861_100106100 Ga0068861_1001061003 205
198 3300005719 Ga0068861_100606971 Ga0068861_1006069712 205
199 3300005840 Ga0068870_10377438 Ga0068870_103774381 205
200 3300005841 Ga0068863_100014491 Ga0068863_10001449112 205
201 3300005841 Ga0068863_100022970 Ga0068863_1000229702 205
202 3300005841 Ga0068863_100085412 Ga0068863_1000854122 205
203 3300005841 Ga0068863_100129213 Ga0068863_1001292133 205
204 3300005842 Ga0068858_100024275 Ga0068858_1000242752 205
205 3300005842 Ga0068858_100191886 Ga0068858_1001918861 205
206 3300005843 Ga0068860_100003450 Ga0068860_1000034504 205
207 3300005844 Ga0068862_101247424 Ga0068862_1012474241 205
208 3300005985 Ga0081539_10003749 Ga0081539_100037494 205
209 3300006237 Ga0097621_100036288 Ga0097621_1000362882 205
210 3300006358 Ga0068871_100012716 Ga0068871_1000127162 205
211 3300006358 Ga0068871_100026556 Ga0068871_1000265566 205
212 3300006358 Ga0068871_100042953 Ga0068871_1000429534 205
213 3300006358 Ga0068871_100090622 Ga0068871_1000906222 205
214 3300006844 Ga0075428_100026289 Ga0075428_1000262895 205
215 3300006844 Ga0075428_101244293 Ga0075428_1012442931 205
216 3300006846 Ga0075430_100001195 Ga0075430_10000119511 205
217 3300006847 Ga0075431_100097745 Ga0075431_1000977452 205
218 3300006847 Ga0075431_100323811 Ga0075431_1003238112 205
219 3300006852 Ga0075433_10015183 Ga0075433_100151834 205
220 3300006871 Ga0075434_100040577 Ga0075434_1000405773 205
221 3300006880 Ga0075429_100043050 Ga0075429_1000430505 205
222 3300006880 Ga0075429_100126501 Ga0075429_1001265011 205
223 3300006881 Ga0068865_100012806 Ga0068865_1000128064 205
224 3300006881 Ga0068865_100266930 Ga0068865_1002669302 205
225 3300006881 Ga0068865_100318220 Ga0068865_1003182202 205
226 3300006881 Ga0068865_100670014 Ga0068865_1006700142 205
227 3300006931 Ga0097620_100004833 Ga0097620_10000483311 205
228 3300006931 Ga0097620_100020533 Ga0097620_1000205333 205
229 3300007076 Ga0075435_100040052 Ga0075435_1000400524 205
230 3300009094 Ga0111539_10000161 Ga0111539_1000016164 205
231 3300009094 Ga0111539_10016933 Ga0111539_100169332 205
232 3300009094 Ga0111539_10026054 Ga0111539_100260545 205
233 3300009094 Ga0111539_10285762 Ga0111539_102857623 205
234 3300009098 Ga0105245_10069305 Ga0105245_100693052 205
235 3300009098 Ga0105245_10149671 Ga0105245_101496713 205
236 3300009098 Ga0105245_10158901 Ga0105245_101589014 205
237 3300009098 Ga0105245_10328879 Ga0105245_103288792 205
238 3300009101 Ga0105247_10258819 Ga0105247_102588192 205
239 3300009147 Ga0114129_10023167 Ga0114129_100231679 205
240 3300009147 Ga0114129_11049477 Ga0114129_110494772 205
241 3300009148 Ga0105243_10015170 Ga0105243_100151707 205
242 3300009148 Ga0105243_11268619 Ga0105243_112686192 205
243 3300009176 Ga0105242_10020323 Ga0105242_100203234 205
244 3300009176 Ga0105242_10022829 Ga0105242_100228295 205
245 3300009176 Ga0105242_10037605 Ga0105242_100376054 205
246 3300009176 Ga0105242_10088761 Ga0105242_100887613 205
247 3300009176 Ga0105242_10127881 Ga0105242_101278813 205
248 3300009176 Ga0105242_10277838 Ga0105242_102778381 205
249 3300009177 Ga0105248_10023221 Ga0105248_100232218 205
250 3300009177 Ga0105248_10070590 Ga0105248_100705902 205
251 3300009177 Ga0105248_10164328 Ga0105248_101643282 205
252 3300009177 Ga0105248_10190659 Ga0105248_101906592 205
253 3300009177 Ga0105248_10747120 Ga0105248_107471202 205
254 3300009553 Ga0105249_10000849 Ga0105249_1000084920 205
255 3300009553 Ga0105249_10321609 Ga0105249_103216092 205
256 3300011119 Ga0105246_10039091 Ga0105246_100390912 205
257 3300013296 Ga0157374_10030541 Ga0157374_100305413 205
258 3300013306 Ga0163162_10182118 Ga0163162_101821184 205
259 3300013306 Ga0163162_10992678 Ga0163162_109926782 205
260 3300013308 Ga0157375_10590832 Ga0157375_105908321 205
261 3300013308 Ga0157375_10979438 Ga0157375_109794382 205
262 3300013308 Ga0157375_11146392 Ga0157375_111463921 205
263 3300014325 Ga0163163_10008809 Ga0163163_1000880910 205
264 3300014325 Ga0163163_10318469 Ga0163163_103184692 205
265 3300014325 Ga0163163_10373774 Ga0163163_103737742 205
266 3300014326 Ga0157380_10007939 Ga0157380_100079394 205
267 3300014326 Ga0157380_10016962 Ga0157380_100169626 205
268 3300014326 Ga0157380_10062355 Ga0157380_100623554 205
269 3300014326 Ga0157380_10071915 Ga0157380_100719154 205
270 3300014326 Ga0157380_10209611 Ga0157380_102096113 205
271 3300014326 Ga0157380_10331557 Ga0157380_103315572 205
272 3300014326 Ga0157380_10489562 Ga0157380_104895622 205
273 3300014745 Ga0157377_10044302 Ga0157377_100443023 205
274 3300014968 Ga0157379_10027012 Ga0157379_100270125 205
275 3300014968 Ga0157379_10053237 Ga0157379_100532373 205
276 3300014969 Ga0157376_10177108 Ga0157376_101771081 205
277 3300014969 Ga0157376_10202563 Ga0157376_102025633 205
278 3300025290 Ga0207673_1006520 Ga0207673_10065201 205
279 3300025315 Ga0207697_10000700 Ga0207697_1000070016 205
280 3300025893 Ga0207682_10001270 Ga0207682_100012705 205
281 3300025900 Ga0207710_10260627 Ga0207710_102606272 205
282 3300025901 Ga0207688_10004180 Ga0207688_1000418010 205
283 3300025903 Ga0207680_10008194 Ga0207680_100081943 205
284 3300025903 Ga0207680_10066318 Ga0207680_100663183 205
285 3300025903 Ga0207680_10095313 Ga0207680_100953132 205
286 3300025905 Ga0207685_10094764 Ga0207685_100947641 205
287 3300025907 Ga0207645_10002538 Ga0207645_100025389 205
288 3300025907 Ga0207645_10006287 Ga0207645_100062879 205
289 3300025908 Ga0207643_10000138 Ga0207643_1000013831 205
290 3300025908 Ga0207643_10050644 Ga0207643_100506443 205
291 3300025908 Ga0207643_10077683 Ga0207643_100776832 205
292 3300025909 Ga0207705_10450461 Ga0207705_104504611 205
293 3300025918 Ga0207662_10001333 Ga0207662_1000133313 205
294 3300025918 Ga0207662_10117297 Ga0207662_101172972 205
295 3300025919 Ga0207657_10414096 Ga0207657_104140962 205
296 3300025920 Ga0207649_10013889 Ga0207649_100138896 205
297 3300025920 Ga0207649_10156929 Ga0207649_101569292 205
298 3300025920 Ga0207649_10215049 Ga0207649_102150492 205
299 3300025923 Ga0207681_10019145 Ga0207681_100191454 205
300 3300025923 Ga0207681_10071627 Ga0207681_100716274 205
301 3300025923 Ga0207681_10093885 Ga0207681_100938852 205
302 3300025923 Ga0207681_10525690 Ga0207681_105256902 205
303 3300025925 Ga0207650_10001847 Ga0207650_1000184713 205
304 3300025926 Ga0207659_10001457 Ga0207659_1000145712 205
305 3300025926 Ga0207659_10003705 Ga0207659_100037052 205
306 3300025926 Ga0207659_10010656 Ga0207659_100106564 205
307 3300025926 Ga0207659_10011494 Ga0207659_100114945 205
308 3300025926 Ga0207659_10011758 Ga0207659_100117582 205
309 3300025926 Ga0207659_10049431 Ga0207659_100494312 205
310 3300025926 Ga0207659_10157875 Ga0207659_101578752 205
311 3300025927 Ga0207687_10046109 Ga0207687_100461092 205
312 3300025927 Ga0207687_10126203 Ga0207687_101262031 205
313 3300025927 Ga0207687_10161632 Ga0207687_101616322 205
314 3300025931 Ga0207644_10004034 Ga0207644_1000403411 205
315 3300025933 Ga0207706_10002156 Ga0207706_1000215615 205
316 3300025934 Ga0207686_10003019 Ga0207686_100030195 205
317 3300025934 Ga0207686_10477809 Ga0207686_104778091 205
318 3300025934 Ga0207686_10566274 Ga0207686_105662742 205
319 3300025935 Ga0207709_10011708 Ga0207709_100117084 205
320 3300025935 Ga0207709_10110313 Ga0207709_101103133 205
321 3300025936 Ga0207670_10005191 Ga0207670_100051916 205
322 3300025936 Ga0207670_10661442 Ga0207670_106614421 205
323 3300025936 Ga0207670_10930520 Ga0207670_109305201 205
324 3300025937 Ga0207669_10011625 Ga0207669_100116255 205
325 3300025937 Ga0207669_10311734 Ga0207669_103117342 205
326 3300025938 Ga0207704_10002413 Ga0207704_100024136 205
327 3300025938 Ga0207704_10270865 Ga0207704_102708652 205
328 3300025938 Ga0207704_10296607 Ga0207704_102966072 205
329 3300025940 Ga0207691_10002649 Ga0207691_1000264913 205
330 3300025940 Ga0207691_10018147 Ga0207691_100181473 205
331 3300025940 Ga0207691_10028470 Ga0207691_100284705 205
332 3300025940 Ga0207691_10069065 Ga0207691_100690652 205
333 3300025940 Ga0207691_10092617 Ga0207691_100926174 205
334 3300025941 Ga0207711_10033242 Ga0207711_100332426 205
335 3300025941 Ga0207711_10101736 Ga0207711_101017362 205
336 3300025941 Ga0207711_10190414 Ga0207711_101904143 205
337 3300025941 Ga0207711_10420961 Ga0207711_104209612 205
338 3300025941 Ga0207711_10431364 Ga0207711_104313642 205
339 3300025942 Ga0207689_10001347 Ga0207689_1000134716 205
340 3300025942 Ga0207689_10008111 Ga0207689_100081118 205
341 3300025942 Ga0207689_10092992 Ga0207689_100929923 205
342 3300025945 Ga0207679_10137860 Ga0207679_101378603 205
343 3300025960 Ga0207651_10005003 Ga0207651_100050032 205
344 3300025960 Ga0207651_10007223 Ga0207651_100072237 205
345 3300025960 Ga0207651_10065420 Ga0207651_100654203 205
346 3300025960 Ga0207651_10161505 Ga0207651_101615053 205
347 3300025960 Ga0207651_10178073 Ga0207651_101780732 205
348 3300025961 Ga0207712_10009601 Ga0207712_100096015 205
349 3300025961 Ga0207712_10558505 Ga0207712_105585052 205
350 3300025986 Ga0207658_10010408 Ga0207658_100104084 205
351 3300025986 Ga0207658_10222502 Ga0207658_102225022 205
352 3300026023 Ga0207677_10028815 Ga0207677_100288152 205
353 3300026023 Ga0207677_10051405 Ga0207677_100514052 205
354 3300026023 Ga0207677_10086281 Ga0207677_100862813 205
355 3300026035 Ga0207703_10062857 Ga0207703_100628573 205
356 3300026035 Ga0207703_10148233 Ga0207703_101482333 205
357 3300026035 Ga0207703_10471115 Ga0207703_104711152 205
358 3300026075 Ga0207708_10029599 Ga0207708_100295995 205
359 3300026075 Ga0207708_10569150 Ga0207708_105691501 205
360 3300026088 Ga0207641_10028218 Ga0207641_100282186 205
361 3300026088 Ga0207641_10158116 Ga0207641_101581162 205
362 3300026088 Ga0207641_10448503 Ga0207641_104485032 205
363 3300026089 Ga0207648_10001667 Ga0207648_1000166717 205
364 3300026089 Ga0207648_10033002 Ga0207648_100330023 205
365 3300026089 Ga0207648_10059553 Ga0207648_100595533 205
366 3300026095 Ga0207676_10009893 Ga0207676_100098937 205
367 3300026095 Ga0207676_10039823 Ga0207676_100398232 205
368 3300026095 Ga0207676_10131305 Ga0207676_101313053 205
369 3300026095 Ga0207676_10717165 Ga0207676_107171652 205
370 3300026118 Ga0207675_100003681 Ga0207675_1000036813 205
371 3300026118 Ga0207675_100027414 Ga0207675_1000274146 205
372 3300026118 Ga0207675_100111678 Ga0207675_1001116784 205
373 3300026118 Ga0207675_100190162 Ga0207675_1001901623 205
374 3300026118 Ga0207675_100217815 Ga0207675_1002178152 205
375 3300026121 Ga0207683_10017416 Ga0207683_100174165 205
376 3300026121 Ga0207683_10070562 Ga0207683_100705624 205
377 3300026121 Ga0207683_10247703 Ga0207683_102477032 205
378 3300026142 Ga0207698_10191963 Ga0207698_101919633 205
379 3300027617 Ga0210002_1027233 Ga0210002_10272332 205
380 3300027876 Ga0209974_10011030 Ga0209974_100110303 205
381 3300027876 Ga0209974_10065407 Ga0209974_100654072 205
382 3300027907 Ga0207428_10006937 Ga0207428_1000693710 205
383 3300027907 Ga0207428_10040990 Ga0207428_100409902 205
384 3300028379 Ga0268266_10044128 Ga0268266_100441283 205
385 3300028380 Ga0268265_10029973 Ga0268265_100299733 205
386 3300028381 Ga0268264_11161142 Ga0268264_111611422 205
387 3300035085 Ga0373929_0052049 Ga0373929_0052049_144_764 205
388 3300035088 Ga0373940_0085857 Ga0373940_0085857_13_633 205
389 3300035090 Ga0373949_0022951 Ga0373949_0022951_428_1048 205
390 3300035112 Ga0373932_0016075 Ga0373932_0016075_368_988 205
391 3300035114 Ga0373939_0013721 Ga0373939_0013721_252_872 205
392 3300035121 Ga0373960_0032379 Ga0373960_0032379_318_938 205
393 3300035172 Ga0373955_0051497 Ga0373955_0051497_155_793 205
394 3300035172 Ga0373955_0191853 Ga0373955_0191853_363_998 205
395 3300035242 Ga0373962_0012723 Ga0373962_0012723_882_1502 205
396 3300035242 Ga0373962_0079520 Ga0373962_0079520_324_944 205
397 3300035691 Ga0373931_0195593 Ga0373931_0195593_431_1051 205
398 3300035691 Ga0373931_0311332 Ga0373931_0311332_129_749 205
399 3300045051 Ga0451576_0272649 Ga0451576_0272649_1007_1663 205
400 3300045051 Ga0451576_1198266 Ga0451576_1198266_121_756 205
401 3300046455 Ga0495603_0452997 Ga0495603_0452997_44_664 205
402 3300046472 Ga0495580_0397866 Ga0495580_0397866_50_670 205
403 3300046499 Ga0495594_0062723 Ga0495594_0062723_871_1491 205
404 3300046537 Ga0495598_0100828 Ga0495598_0100828_16_768 205
405 3300046615 Ga0495656_0035759 Ga0495656_0035759_717_1337 205
406 3300046664 Ga0495659_0063743 Ga0495659_0063743_346_966 205
407 3300046683 Ga0495658_0046335 Ga0495658_0046335_792_1427 205
408 3300047319 Ga0495674_0364025 Ga0495674_0364025_14_649 205
409 3300048903 Ga0496100_0023812 Ga0496100_0023812_1570_2205 205
410 3300048903 Ga0496100_0244315 Ga0496100_0244315_147_782 205
411 3300048904 Ga0496101_0001450 Ga0496101_0001450_9832_10467 205
412 3300048905 Ga0496102_0214851 Ga0496102_0214851_547_1182 205
413 3300048907 Ga0496104_0030810 Ga0496104_0030810_2098_2733 205
414 3300048907 Ga0496104_0380922 Ga0496104_0380922_622_1257 205
415 3300048907 Ga0496104_1032076 Ga0496104_1032076_50_685 205
416 3300048910 Ga0496107_0742930 Ga0496107_0742930_50_685 205
417 3300048911 Ga0496108_0724637 Ga0496108_0724637_90_707 205
418 3300048912 Ga0496109_0054505 Ga0496109_0054505_611_1228 205
419 3300048912 Ga0496109_0609571 Ga0496109_0609571_318_956 205
420 3300048917 Ga0496114_0012458 Ga0496114_0012458_1341_1976 205
421 3300049582 Ga0501048_0125196 Ga0501048_0125196_800_1420 205
422 3300049588 Ga0501072_0076863 Ga0501072_0076863_1057_1677 205
423 3300049592 Ga0501076_0323324 Ga0501076_0323324_398_1018 205
424 3300049743 Ga0501081_0004819 Ga0501081_0004819_4245_4865 205
425 3300049743 Ga0501081_0295373 Ga0501081_0295373_497_1117 205
426 3300050507 nmdc:mga05p37_189705_c1 nmdc:mga05p37_189705_c1_1686_2327 205
427 3300050507 nmdc:mga05p37_48514_c1 nmdc:mga05p37_48514_c1_1660_2280 205
428 3300050507 nmdc:mga05p37_711521_c1 nmdc:mga05p37_711521_c1_487_1104 205
429 3300050508 nmdc:mga09592_21714_c1 nmdc:mga09592_21714_c1_2221_2841 205
430 3300050508 nmdc:mga09592_24939_c1 nmdc:mga09592_24939_c1_1221_1841 205
431 3300050508 nmdc:mga09592_84262_c1 nmdc:mga09592_84262_c1_1889_2509 205
432 3300050509 nmdc:mga0qj67_1228_c1 nmdc:mga0qj67_1228_c1_3712_4332 205
433 3300050509 nmdc:mga0qj67_317200_c1 nmdc:mga0qj67_317200_c1_247_882 205
434 3300050510 nmdc:mga06r32_1311_c1 nmdc:mga06r32_1311_c1_19968_20588 205
435 3300050510 nmdc:mga06r32_988661_c1 nmdc:mga06r32_988661_c1_100_720 205
436 3300050511 nmdc:mga08y16_11410_c1 nmdc:mga08y16_11410_c1_4995_5615 205
437 3300050511 nmdc:mga08y16_1170_c1 nmdc:mga08y16_1170_c1_18347_18967 205
438 3300050511 nmdc:mga08y16_211895_c1 nmdc:mga08y16_211895_c1_1109_1729 205
439 3300050511 nmdc:mga08y16_52006_c1 nmdc:mga08y16_52006_c1_2407_3024 205
440 3300050512 nmdc:mga0n895_19525_c1 nmdc:mga0n895_19525_c1_3428_4045 205
441 3300050512 nmdc:mga0n895_38241_c1 nmdc:mga0n895_38241_c1_1629_2249 205
442 3300050513 nmdc:mga0rr50_433484_c1 nmdc:mga0rr50_433484_c1_481_1101 205
443 3300050515 nmdc:mga0a205_5532_c1 nmdc:mga0a205_5532_c1_2881_3501 205
444 3300053084 Ga0495595_0261727 Ga0495595_0261727_212_847 205
445 3300054114 Ga0501084_0211043 Ga0501084_0211043_381_1001 205

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02502

LacAB_rpiB

Ribose/Galactose Isomerase

66

189

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ifz-assembly1.cif.gz_B crystal structure of ribose-5-phosphate isomerase from brucella melitensis 16m 0.9687 59 181
3ph4-assembly1.cif.gz_A clostridium thermocellum ribose-5-phosphate isomerase b with d-allose 0.9619 59 201
2vvr-assembly1.cif.gz_A crystal structure of the h99n mutant of ribose-5-phosphate isomerase b from e. coli soaked with ribose 5-phosphate 0.9561 57 203
2vvr-assembly1.cif.gz_A crystal structure of the h99n mutant of ribose-5-phosphate isomerase b from e. coli soaked with ribose 5-phosphate 0.9498 57 203
4lfk-assembly1.cif.gz_B crystal structure of d-galactose-6-phosphate isomerase in a substrate-free form 0.9486 59 200
ID Description Score Start End Superfamily
5ifzB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9687 59 181 3.40.1400.10
4lfkB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9486 59 200 3.40.1400.10
af_P9WKD7_1_162_3.40.1400.10 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9472 56 203 3.40.1400.10
3s5pB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9435 54 186 3.40.1400.10
1o1xA00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9427 58 199 3.40.1400.10
ID Description Score Start End GO Terms
AF-A0A5Q4GAX0-F1-model_v4 Ribose 5-phosphate isomerase B (EC 5.3.1.6) 0.9754 59 183 GO:0004751
GO:0005975
AF-A0A7X6X9T7-F1-model_v4 Ribose 5-phosphate isomerase B (EC 5.3.1.6) 0.9733 59 173 GO:0004751
GO:0009052
GO:0019316
AF-A0A3B9JH88-F1-model_v4 Ribose-5-phosphate isomerase 0.9726 57 202 GO:0005975
GO:0016861
AF-A0A521WPV9-F1-model_v4 RpiB/LacA/LacB family sugar-phosphate isomerase 0.9725 59 177 GO:0005975
GO:0016861
AF-A0A1F2VLC0-F1-model_v4 Ribose 5-phosphate isomerase B 0.9719 57 204 GO:0005975
GO:0016861

Feature Viewer

pLDDT pTM Quality
89.7 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map