F445642

General Info

Members Datasets Scaffolds Average Seq Length
446 391 892 310

Family's Representative Sequence

Representative Sequence 3300003578|Ga0006562J51391_1160326|Ga0006562J51391_11603262
Length 327
Sequence MRFKSPNNSEIDMTFRLYDLPEIEPSRSVGFSGNRIDRQSEKRQDDSAFTALELPETRIMLLGGNRLLLDYADEKAPRALFRLGEAKDFAPDLHEPIFLGLQDGAPLVALTTPLDPETMETPFRLQDYRSIYTEGLVSADLLGALAQAAALTAWHANHRFCGRCGTKTDMRAGGAKRQCPNCGAEHFPRTDPVAIMLPVRGEKCILARSPHFAPGSYSCLAGFIEHGETIEAAVRRESVEEMGLSIGRVAYHASQPWPFPYSLMIGCHAEVLSDDFTIDRSELEDGRWFSKAEVRTMLEGTHENGLRVPPSGAIATHLIKAWVYDAG

Samples

Sample ID Description Type Environment
1 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
7 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
8 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
9 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
10 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
11 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
13 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
14 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
15 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
16 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
17 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
18 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
19 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
20 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
21 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
22 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
23 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
25 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
26 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
28 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
39 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
41 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
42 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
43 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
44 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
45 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
46 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
47 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
48 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
49 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
50 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
51 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
52 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
53 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
54 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
55 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
56 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
57 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
58 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
59 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
60 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
61 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
62 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
63 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
64 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
65 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
66 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
79 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
80 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
81 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
82 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
83 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
84 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
85 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
86 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
87 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
90 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
91 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
92 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
93 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
94 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
95 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
96 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
97 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
98 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
99 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
100 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
101 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
102 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
103 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
104 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
105 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
106 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
107 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
108 2512875024
109 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
110 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
111 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
112 2534681786 Brucella suis 92/29 Isolate Unclassified
113 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
114 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
115 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
116 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
117 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
118 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
119 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
120 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
121 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
122 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
123 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
124 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
125 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
126 2738543024 Aminobacter sp. AP02 Isolate Unclassified
127 2751185800 Brucella pituitosa AA2 Isolate Unclassified
128 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
129 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
130 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
131 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
132 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
133 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
134 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
135 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
136 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
137 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
138 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
139 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
140 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
141 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
142 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
143 2854911287 Brucella lupini LUP21 Isolate Unclassified
144 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
145 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
146 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
147 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
148 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
149 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
150 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
151 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
152 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
153 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
154 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
155 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
156 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
157 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
158 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
159 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
160 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
161 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
162 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
163 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
164 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
165 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
166 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
167 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
168 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
169 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
170 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
171 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
172 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
173 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
174 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
175 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
176 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
177 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
178 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
179 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
180 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
181 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
182 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
183 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
184 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
185 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
186 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
187 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
188 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
189 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
190 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
191 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
192 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
193 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
194 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
195 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
196 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
197 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
198 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
199 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
200 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
201 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
202 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
203 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
204 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
205 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
206 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
207 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
208 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
209 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
210 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
211 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
212 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
213 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
214 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
215 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
216 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
217 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
218 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
219 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
220 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
221 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
222 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
223 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
224 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
225 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
226 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
227 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
228 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
229 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
230 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
231 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
232 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
233 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
234 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
235 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
236 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
237 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
238 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
239 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
240 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
241 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
242 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
243 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
244 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
245 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
246 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
247 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
248 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
249 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
250 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
251 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
252 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
253 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
254 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
255 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
256 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
257 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
258 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
259 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
260 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
261 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
262 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
263 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
264 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
265 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
266 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
267 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
268 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
269 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
270 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
271 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
272 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
273 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
274 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
275 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
276 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
277 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
278 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
279 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
280 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
281 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
282 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
283 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
284 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
285 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
286 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
287 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
288 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
289 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
290 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
291 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
292 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
293 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
294 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
295 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
296 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
297 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
298 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
299 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
300 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
301 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
302 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
303 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
304 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
305 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
306 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
307 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
308 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
309 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
310 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
311 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
312 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
313 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
314 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
315 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
316 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
317 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
318 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
319 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
320 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
321 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
322 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
323 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
324 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
325 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
326 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
327 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
328 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
329 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
330 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
331 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
332 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
333 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
334 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
335 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
336 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
337 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
338 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
339 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
340 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
341 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
342 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
343 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
344 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
345 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
346 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
347 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
348 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
349 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
350 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
351 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
352 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
353 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
354 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
355 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
356 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
357 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
358 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
359 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
360 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
361 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
362 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
363 3004167301 Mesorhizobium loti 582 Isolate Unclassified
364 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
365 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
366 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
367 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
368 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
369 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
370 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
371 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
372 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
373 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
374 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
375 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
376 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
377 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
378 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
379 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
380 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
381 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
382 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
383 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
384 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
385 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
386 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
387 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
388 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
389 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
390 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
391 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 34.08
Metatranscriptomes 0.22
Isolates 65.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.85
Nodule 52.91
Rhizoplane 1.79
Rhizosphere 24.89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006562J51391_1160326 3300003578 Bacteria 1720
2 JGI25157J39369_1001703 3300002741 Bacteria 7415
3 JGI25406J46586_10012845 3300003203 Bacteria 3617
4 JGI25165J46597_1000019 3300003214 Bacteria 371528
5 Ga0055542_1000625 3300003762 Bacteria 29738
6 Ga0070663_100020270 3300005455 Bacteria 4400
7 Ga0070665_100010479 3300005548 Bacteria 9378
8 Ga0070665_100044246 3300005548 Bacteria 4471
9 Ga0070665_100132015 3300005548 Bacteria 2499
10 Ga0068857_100077636 3300005577 Bacteria 2963
11 Ga0068854_100267610 3300005578 Bacteria 1371
12 Ga0068860_100591992 3300005843 Bacteria 1114
13 Ga0081539_10000410 3300005985 Bacteria 91484
14 Ga0075365_10002469 3300006038 Bacteria 9082
15 Ga0075365_10008459 3300006038 Bacteria 5846
16 Ga0075365_10018442 3300006038 Bacteria 4290
17 Ga0075365_10021658 3300006038 Bacteria 4013
18 Ga0075365_10340868 3300006038 Bacteria 1056
19 Ga0075363_100018547 3300006048 Bacteria 3469
20 Ga0075363_100046888 3300006048 Bacteria 2293
21 Ga0075363_100159380 3300006048 Bacteria 1277
22 Ga0075364_10024277 3300006051 Bacteria 3847
23 Ga0075364_10063456 3300006051 Bacteria 2425
24 Ga0075362_10107025 3300006177 Bacteria 1313
25 Ga0075367_10027169 3300006178 Bacteria 3253
26 Ga0075367_10032910 3300006178 Bacteria 2986
27 Ga0075367_10069460 3300006178 Bacteria 2115
28 Ga0105248_10378858 3300009177 Bacteria 1593
29 Ga0105238_10065945 3300009551 Bacteria 3622
30 Ga0105249_10370922 3300009553 Bacteria 1455
31 Ga0105239_10135892 3300010375 Bacteria 2737
32 Ga0105239_10239630 3300010375 Bacteria 2036
33 Ga0182008_10044070 3300014497 Bacteria 2219
34 Ga0209026_1000013 3300025250 Bacteria 415633
35 Ga0209148_1000032 3300025254 Bacteria 557660
36 Ga0209759_1000058 3300025256 Bacteria 203580
37 Ga0209233_1000034 3300025261 Bacteria 578898
38 Ga0209455_1000098 3300025272 Bacteria 213890
39 Ga0209758_1003869 3300025297 Bacteria 13112
40 Ga0207647_10045609 3300025904 Bacteria 2734
41 Ga0207705_10058343 3300025909 Bacteria 2785
42 Ga0207671_10157012 3300025914 Bacteria 1760
43 Ga0207657_10191723 3300025919 Bacteria 1648
44 Ga0207649_10149479 3300025920 Bacteria 1607
45 Ga0207694_10023400 3300025924 Bacteria 4689
46 Ga0207639_10075937 3300026041 Bacteria 2644
47 Ga0207678_10045832 3300026067 Bacteria 3781
48 Ga0207674_10106364 3300026116 Bacteria 2783
49 Ga0207698_10092806 3300026142 Bacteria 2476
50 Ga0209813_10013924 3300027866 Bacteria 2157
51 Ga0268266_10035412 3300028379 Bacteria 4246
52 Ga0268266_10044655 3300028379 Bacteria 3788
53 Ga0268266_10252133 3300028379 Bacteria 1633
54 Ga0316574_0089052 3300035398 Bacteria 1966
55 Ga0395899_0000014 3300037312 Bacteria 488813
56 Ga0395900_0000007 3300037418 Bacteria 488860
57 Ga0395900_0012123 3300037418 Bacteria 8808
58 Ga0395900_0601448 3300037418 Bacteria 1040
59 Ga0395898_0000011 3300037466 Bacteria 488860
60 Ga0395905_0000008 3300037471 Bacteria 488860
61 Ga0395905_0060689 3300037471 Bacteria 3536
62 Ga0395905_0083016 3300037471 Bacteria 3002
63 Ga0395905_0120943 3300037471 Bacteria 2461
64 Ga0395901_0000020 3300038443 Bacteria 314918
65 Ga0395901_0137149 3300038443 Bacteria 2571
66 Ga0439465_0045728 3300041413 Bacteria 1424
67 Ga0466972_0025807 3300044658 Bacteria 2911
68 Ga0495638_0037557 3300046460 Bacteria 3080
69 Ga0495637_0081136 3300046520 Bacteria 1293
70 Ga0495597_0022565 3300046542 Bacteria 2918
71 Ga0495670_0056027 3300046691 Bacteria 1977
72 Ga0495681_0063910 3300047470 Bacteria 1688
73 Ga0495686_0067638 3300047472 Bacteria 2205
74 Ga0495626_0040254 3300048091 Bacteria 2208
75 Ga0496102_0062875 3300048905 Bacteria 3399
76 Ga0496103_0216537 3300048906 Bacteria 1232
77 Ga0496105_0335871 3300048908 Bacteria 1209
78 Ga0496112_0080011 3300048915 Bacteria 3232
79 Ga0496112_0228823 3300048915 Bacteria 1814
80 Ga0496118_0164187 3300048921 Bacteria 1368
81 Ga0496119_0010625 3300048922 Bacteria 7720
82 Ga0496120_0005806 3300048923 Bacteria 9674
83 Ga0496120_0118975 3300048923 Bacteria 1368
84 Ga0496122_0066441 3300048925 Bacteria 2605
85 Ga0496124_0213751 3300048927 Bacteria 1457
86 Ga0496124_0351086 3300048927 Bacteria 1043
87 Ga0496125_0164729 3300048928 Bacteria 1500
88 Ga0496126_0103067 3300048929 Bacteria 2494
89 Ga0496126_0198360 3300048929 Bacteria 1696
90 Ga0501031_0000076 3300049568 Bacteria 51870
91 Ga0501032_0000004 3300049569 Bacteria 310855
92 Ga0501032_0001730 3300049569 Bacteria 17269
93 Ga0501033_0000156 3300049570 Bacteria 65847
94 Ga0501033_0018009 3300049570 Bacteria 5333
95 Ga0501033_0065273 3300049570 Bacteria 2678
96 Ga0501033_0213104 3300049570 Bacteria 1377
97 Ga0501034_0000011 3300049571 Bacteria 310855
98 Ga0501034_0016156 3300049571 Bacteria 7658
99 Ga0501034_0058466 3300049571 Bacteria 3875
100 Ga0501034_0076165 3300049571 Bacteria 3362
101 Ga0501034_0217595 3300049571 Bacteria 1863
102 Ga0501034_0355151 3300049571 Bacteria 1393
103 Ga0501036_0000001 3300049572 Bacteria 310855
104 Ga0501036_0022807 3300049572 Bacteria 5270
105 Ga0501037_0000064 3300049573 Bacteria 97087
106 Ga0501038_0000003 3300049574 Bacteria 310855
107 Ga0501038_0049366 3300049574 Bacteria 3638
108 Ga0501038_0290565 3300049574 Bacteria 1285
109 Ga0501038_0290855 3300049574 Bacteria 1284
110 Ga0501039_0000004 3300049575 Bacteria 310855
111 Ga0501039_0071860 3300049575 Bacteria 2688
112 Ga0501040_0010928 3300049576 Bacteria 5936
113 Ga0501043_0000417 3300049579 Bacteria 38233
114 Ga0501043_0078984 3300049579 Bacteria 2586
115 Ga0501047_0002889 3300049581 Bacteria 16294
116 Ga0501047_0061516 3300049581 Bacteria 3623
117 Ga0501047_0225249 3300049581 Bacteria 1730
118 Ga0501048_0006355 3300049582 Bacteria 8982
119 Ga0501067_0080323 3300049583 Bacteria 1808
120 Ga0501069_0005987 3300049585 Bacteria 6345
121 Ga0501070_0007807 3300049586 Bacteria 9069
122 Ga0501070_0009102 3300049586 Bacteria 8397
123 Ga0501070_0062989 3300049586 Bacteria 3072
124 Ga0501070_0187504 3300049586 Bacteria 1701
125 Ga0501071_0021753 3300049587 Bacteria 4470
126 Ga0501072_0162910 3300049588 Bacteria 1779
127 Ga0501073_0036359 3300049589 Bacteria 3499
128 Ga0501074_0022436 3300049590 Bacteria 4586
129 Ga0501079_0074809 3300049741 Bacteria 2619
130 Ga0501083_0038807 3300049744 Bacteria 3236
131 Ga0501035_0000009 3300049822 Bacteria 310827
132 Ga0501035_0014973 3300049822 Bacteria 7156
133 Ga0501035_0040762 3300049822 Bacteria 4194
134 Ga0501035_0330784 3300049822 Bacteria 1278
135 Ga0501044_0000005 3300049823 Bacteria 310855
136 Ga0501044_0037294 3300049823 Bacteria 5081
137 Ga0501044_0190897 3300049823 Bacteria 2011
138 Ga0501044_0346303 3300049823 Bacteria 1406
139 Ga0501045_0005304 3300049824 Bacteria 8932
140 nmdc:mga03683_34683_c1 3300050489 Bacteria 2043
141 nmdc:mga0yw44_11553_c1 3300050492 Bacteria 4565
142 nmdc:mga0yw44_150999_c1 3300050492 Bacteria 1515
143 nmdc:mga0yw44_36177_c1 3300050492 Bacteria 2908
144 nmdc:mga0yw44_55055_c1 3300050492 Bacteria 2420
145 nmdc:mga0sz30_23981_c3 3300050516 Bacteria 982
146 Ga0500643_017331 3300053087 Bacteria 2414
147 Ga0500658_0063262 3300053134 Bacteria 1544
148 Ga0500568_0000052 3300053139 Bacteria 112079
149 Ga0500604_0061160 3300053151 Bacteria 1183
150 Ga0500604_0107615 3300053151 Bacteria 924
151 Ga0500616_0078569 3300053153 Bacteria 1664
152 Ga0500620_000113 3300053155 Bacteria 15929
153 Ga0500627_0013430 3300053158 Bacteria 3105
154 2503198061 2503198000 Bacteria 6884444
155 2509113652 2508501123 Bacteria 6283661
156 2509140273 2508501127 Bacteria 7037543
157 2509370574 2509276018 Bacteria 6910194
158 2509392989 2509276022 Bacteria 6200534
159 2510314407 2510065059 Bacteria 6847884
160 2511389200 2511231027 Bacteria 5013807
161 2512934456 2512875016 Bacteria 6529530
162 2512962802 2512875024 Bacteria 7195110
163 2513609522 2513237090 Bacteria 7096802
164 2514037525 2513237164 Bacteria 7563725
165 2514586134 2513237351 Bacteria 6968952
166 2535485656 2534681786 Bacteria 3308809
167 2588520627 2588253730 Bacteria 6881675
168 2597810145 2597489875 Bacteria 7010078
169 2599935737 2599185301 Bacteria 6161860
170 2643770747 2643221550 Bacteria 4619371
171 2643777734 2643221551 Bacteria 3750538
172 2643796182 2643221555 Bacteria 3749717
173 2643839671 2643221564 Bacteria 4193379
174 2643985018 2643221595 Bacteria 6565519
175 2644133600 2643221623 Bacteria 5239945
176 2644154052 2643221627 Bacteria 6761570
177 2688595374 2687453392 Bacteria 6880454
178 2694628498 2693429783 Bacteria 7019804
179 2694640628 2693429784 Bacteria 7241525
180 2739308440 2738543024 Bacteria 5603683
181 2753358359 2751185800 Bacteria 5467370
182 2756674552 2756170246 Bacteria 7451806
183 2758640584 2758568016 Bacteria 5645291
184 2765464088 2765235802 Bacteria 5618596
185 2770196738 2767802442 Bacteria 5747986
186 2776272769 2775506902 Bacteria 6208009
187 2776284713 2775506904 Bacteria 5954060
188 2792746570 2791355123 Bacteria 8049106
189 2839994017 2839993093 Bacteria 5512535
190 2840769543 2840764183 Bacteria 6358399
191 2841735841 2841734538 Bacteria 6784580
192 2842873192 2842871566 Bacteria 4827117
193 2844004112 2844002411 Bacteria 7168230
194 2844010096 2844009547 Bacteria 6728125
195 2847672965 2847670302 Bacteria 6165597
196 2847689447 2847686936 Bacteria 6278406
197 2854913867 2854911287 Bacteria 5582813
198 2856320003 2856314179 Bacteria 6477897
199 2856327858 2856320880 Bacteria 7263508
200 2856332033 2856328259 Bacteria 6528202
201 2856339326 2856334872 Bacteria 7037011
202 2856345441 2856342000 Bacteria 7176905
203 2856371253 2856364286 Bacteria 6939991
204 2857354349 2857349434 Bacteria 7926032
205 2857374114 2857367948 Bacteria 6965560
206 2869168714 2869162929 Bacteria 6399702
207 2869175029 2869169390 Bacteria 6659796
208 2869239810 2869234852 Bacteria 6654993
209 2869246299 2869242130 Bacteria 6609239
210 2869256051 2869249662 Bacteria 6868783
211 2869261194 2869256925 Bacteria 6981691
212 2869264379 2869264136 Bacteria 6880765
213 2869271840 2869271264 Bacteria 6908218
214 2869279809 2869278585 Bacteria 7077053
215 2869292476 2869285874 Bacteria 6901219
216 2871429291 2871429161 Bacteria 6547891
217 2871436158 2871435913 Bacteria 6880295
218 2871445529 2871444079 Bacteria 6423508
219 2871459256 2871451962 Bacteria 7336357
220 2871463958 2871459585 Bacteria 6866887
221 2871469812 2871466892 Bacteria 6923287
222 2871478397 2871474448 Bacteria 6806570
223 2871484470 2871481445 Bacteria 6700002
224 2871490812 2871488783 Bacteria 6929816
225 2871499386 2871495908 Bacteria 6935695
226 2874109035 2874102143 Bacteria 6342645
227 2874112570 2874109183 Bacteria 6517025
228 2874117345 2874116593 Bacteria 6674494
229 2874129510 2874123672 Bacteria 7238285
230 2874138873 2874131515 Bacteria 6820270
231 2874145698 2874139085 Bacteria 7021506
232 2874154197 2874146452 Bacteria 7533118
233 2874161699 2874155637 Bacteria 6724144
234 2874162559 2874162495 Bacteria 6174670
235 2874171768 2874168670 Bacteria 8062617
236 2876363282 2876363079 Bacteria 6544991
237 2876374970 2876369609 Bacteria 6807521
238 2876387101 2876386047 Bacteria 6698674
239 2876392916 2876392853 Bacteria 6660880
240 2876405102 2876399893 Bacteria 6927900
241 2876409461 2876406927 Bacteria 6191900
242 2876419881 2876413966 Bacteria 6831344
243 2876423640 2876420981 Bacteria 6687741
244 2878035573 2878035449 Bacteria 6555736
245 2878737517 2878730984 Bacteria 6380721
246 2878740348 2878738818 Bacteria 7136951
247 2878752819 2878745973 Bacteria 6867388
248 2878755216 2878753008 Bacteria 6922523
249 2878763576 2878760144 Bacteria 6823465
250 2878770574 2878767105 Bacteria 6898628
251 2878776156 2878774303 Bacteria 6108671
252 2878782593 2878781027 Bacteria 6834456
253 2878795370 2878788777 Bacteria 6567085
254 2881147626 2881147464 Bacteria 7779814
255 2881158726 2881155292 Bacteria 6461656
256 2881164401 2881161766 Bacteria 7127907
257 2881852620 2881845957 Bacteria 6611900
258 2881863202 2881861095 Bacteria 7128710
259 2882632764 2882632389 Bacteria 8154593
260 2882912471 2882912400 Bacteria 6801539
261 2885306264 2885305155 Bacteria 7348390
262 2885314688 2885312484 Bacteria 6415165
263 2885321019 2885318864 Bacteria 6729568
264 2885329220 2885326080 Bacteria 7134805
265 2885335834 2885334103 Bacteria 7216818
266 2885344783 2885342637 Bacteria 7011821
267 2885357097 2885350715 Bacteria 6787678
268 2888342710 2888337043 Bacteria 6629336
269 2888343814 2888343758 Bacteria 6611049
270 2888352287 2888350351 Bacteria 7372807
271 2889014277 2889010040 Bacteria 6749192
272 2889021018 2889016732 Bacteria 6700763
273 2889792542 2889790730 Bacteria 5689708
274 2889916209 2889914905 Bacteria 5702301
275 2894653011 2894652903 Bacteria 4587256
276 2903454643 2903448605 Bacteria 7357801
277 2903494918 2903492973 Bacteria 13473544
278 2903499304 2903492973 Bacteria 13473544
279 2903521275 2903513507 Bacteria 6344008
280 2903525232 2903521522 Bacteria 6525694
281 2903532023 2903528002 Bacteria 6586099
282 2903544191 2903540706 Bacteria 7062119
283 2904579267 2904578770 Bacteria 5302906
284 2904659622 2904659560 Bacteria 6685615
285 2906315210 2906308376 Bacteria 6841989
286 2906321466 2906321335 Bacteria 6579571
287 2906334542 2906328253 Bacteria 6585166
288 2906369883 2906363423 Bacteria 6856682
289 2906374462 2906370794 Bacteria 6881062
290 2906382266 2906378014 Bacteria 6911440
291 2906390612 2906386501 Bacteria 5977019
292 2906398354 2906393657 Bacteria 6790866
293 2906404652 2906401398 Bacteria 6693206
294 2906412476 2906408224 Bacteria 6162342
295 2906420779 2906414383 Bacteria 6580790
296 2906433775 2906427513 Bacteria 6375796
297 2915650742 2915650412 Bacteria 4288180
298 2919121906 2919119836 Bacteria 5208557
299 2922138569 2922130491 Bacteria 7173936
300 2922158326 2922151315 Bacteria 6902399
301 2922162342 2922158528 Bacteria 6573167
302 2922173409 2922172374 Bacteria 6167644
303 2922188953 2922185730 Bacteria 7113964
304 2924716824 2924710171 Bacteria 6752351
305 2924724978 2924718760 Bacteria 6331356
306 2924732875 2924726620 Bacteria 6271473
307 2924734282 2924733363 Bacteria 7574837
308 2924743880 2924741084 Bacteria 6661321
309 2924751509 2924748358 Bacteria 6154725
310 2924756126 2924754689 Bacteria 6774424
311 2924767708 2924762789 Bacteria 6561353
312 2924777949 2924776078 Bacteria 7492003
313 2924791437 2924784321 Bacteria 7416538
314 2928522121 2928521798 Bacteria 4960112
315 2937821752 2937813078 Bacteria 7783518
316 2937826027 2937822353 Bacteria 7290551
317 2937839135 2937836603 Bacteria 6811263
318 2937849824 2937848649 Bacteria 6983481
319 2937864145 2937861824 Bacteria 6660327
320 2937874134 2937868953 Bacteria 6639878
321 2937884511 2937877337 Bacteria 7246526
322 2937895892 2937891427 Bacteria 6357007
323 2937980534 2937972304 Bacteria 7532020
324 2937986353 2937980651 Bacteria 6517427
325 2937998035 2937994558 Bacteria 7036190
326 2938017576 2938014810 Bacteria 6700592
327 2954014459 2954011201 Bacteria 4762601
328 2958035677 2958034702 Bacteria 6989922
329 2958044708 2958041894 Bacteria 13082850
330 2958066735 2958064165 Bacteria 7158582
331 2958076294 2958071322 Bacteria 6815895
332 2958091822 2958084443 Bacteria 7312792
333 2958101463 2958100919 Bacteria 6800575
334 2958112756 2958108152 Bacteria 6681128
335 2958119665 2958115193 Bacteria 6923548
336 2958128493 2958122699 Bacteria 7280457
337 2958136876 2958130278 Bacteria 6897202
338 2958138572 2958137437 Bacteria 6050276
339 2958158633 2958158011 Bacteria 6058449
340 2958168510 2958165035 Bacteria 6906348
341 2958173736 2958172287 Bacteria 6716688
342 2958186759 2958179912 Bacteria 6874908
343 2961085260 2961077736 Bacteria 7079850
344 2961114947 2961114664 Bacteria 6680456
345 2961135821 2961127735 Bacteria 7196641
346 2961166974 2961163497 Bacteria 6901077
347 2961176742 2961170736 Bacteria 7072258
348 2961189640 2961183825 Bacteria 6688536
349 2963644742 2963644680 Bacteria 6530403
350 2965021798 2965018300 Bacteria 6883036
351 2965028841 2965025482 Bacteria 6532201
352 2965046671 2965040258 Bacteria 6855979
353 2965053194 2965047637 Bacteria 6623551
354 2965064621 2965062239 Bacteria 7412989
355 2965093060 2965089291 Bacteria 6866420
356 2965107735 2965102966 Bacteria 6800987
357 2965118101 2965110997 Bacteria 6693150
358 2965121457 2965119406 Bacteria 6956431
359 2968001149 2967996073 Bacteria 6787468
360 2968007202 2968003550 Bacteria 6929263
361 2968021634 2968016561 Bacteria 7022047
362 2968088982 2968083720 Bacteria 7351627
363 2968094089 2968091066 Bacteria 6052692
364 2968100680 2968097103 Bacteria 6107094
365 2968110675 2968110612 Bacteria 6814636
366 2968121599 2968117919 Bacteria 6536078
367 2968131296 2968128360 Bacteria 6270294
368 2968145085 2968138860 Bacteria 6605449
369 2968175380 2968171901 Bacteria 6894245
370 2970476687 2970469710 Bacteria 6969209
371 2970494144 2970489779 Bacteria 6517260
372 2970509415 2970503327 Bacteria 7099517
373 2970516317 2970510686 Bacteria 7006402
374 2970525521 2970524798 Bacteria 6840927
375 2970535004 2970532167 Bacteria 6553173
376 2970545079 2970540015 Bacteria 6977556
377 2970553798 2970547951 Bacteria 6931819
378 2970558418 2970554993 Bacteria 6814252
379 2970594409 2970593180 Bacteria 7073582
380 2970622536 2970619444 Bacteria 6986144
381 2970627914 2970627176 Bacteria 6680862
382 2977824356 2977821940 Bacteria 6906439
383 2977831156 2977828996 Bacteria 7007971
384 2977850023 2977843712 Bacteria 6753583
385 2977855080 2977851361 Bacteria 6694324
386 2977858395 2977858184 Bacteria 6215359
387 2977868305 2977864932 Bacteria 7534097
388 2977879982 2977872689 Bacteria 7270173
389 2977906449 2977898635 Bacteria 6675551
390 2977912346 2977907340 Bacteria 6577984
391 2977915175 2977915119 Bacteria 6829656
392 2977925368 2977922695 Bacteria 6956781
393 2977938287 2977935797 Bacteria 6252826
394 2977943635 2977942078 Bacteria 7570577
395 2977953096 2977950692 Bacteria 6893264
396 2977959920 2977957713 Bacteria 6877875
397 2977977374 2977971508 Bacteria 7472917
398 2977987337 2977986579 Bacteria 6581278
399 2979716937 2979710463 Bacteria 6785254
400 2979750541 2979742915 Bacteria 7301278
401 2979768852 2979764755 Bacteria 6610066
402 2979778661 2979772303 Bacteria 6618277
403 2979784643 2979779861 Bacteria 6219781
404 2979794293 2979793036 Bacteria 6808957
405 2979814202 2979808191 Bacteria 7179355
406 2987642242 2987636660 Bacteria 8088555
407 2987650222 2987645492 Bacteria 6117018
408 2987658216 2987652177 Bacteria 6969023
409 2987662986 2987659509 Bacteria 6966464
410 2987668393 2987666974 Bacteria 6509233
411 2987674810 2987673487 Bacteria 6884027
412 2996314468 2996310559 Bacteria 6357320
413 2996336798 2996336353 Bacteria 5511628
414 2996346142 2996341866 Bacteria 6643098
415 2996356110 2996348954 Bacteria 7239054
416 2996388486 2996386984 Bacteria 6978667
417 3000135942 3000135777 Bacteria 6891109
418 3004172550 3004167301 Bacteria 8330599
419 3004192038 3004188549 Bacteria 6952365
420 3004198422 3004195979 Bacteria 6776956
421 3004210328 3004203850 Bacteria 7307914
422 3004216687 3004211236 Bacteria 7417683
423 3004219720 3004218560 Bacteria 7421728
424 3004233557 3004232784 Bacteria 6662140
425 3004245738 3004239961 Bacteria 6892290
426 3004253453 3004248173 Bacteria 6563236
427 3004273067 3004268573 Bacteria 7043476
428 3004282424 3004275668 Bacteria 7114440
429 3004338054 3004334049 Bacteria 8449246
430 637077628 637000159 Bacteria 7596297
431 649869934 649633066 Bacteria 6690028
432 8002291235 8002285264 Bacteria 6717907
433 8004307137 8004300914 Bacteria 6132239
434 8004319624 8004312739 Bacteria 7444653
435 8004365381 8004361976 Bacteria 6858373
436 8004376795 8004374579 Bacteria 6898112
437 8004395150 8004387939 Bacteria 7049250
438 8004401206 8004395343 Bacteria 6620908
439 8004449749 8004445564 Bacteria 6322258
440 8004638733 8004633249 Bacteria 6723080
441 8004646908 8004640170 Bacteria 6723001
442 8004701655 8004695233 Bacteria 6731676
443 8004707249 8004703790 Bacteria 8006957
444 8004721471 8004714634 Bacteria 6776161
445 8004734538 8004727605 Bacteria 6643904
446 8055617370 8055617313 Bacteria 7548464
447 Ga0006562J51391_1160326
448 JGI25157J39369_1001703
449 JGI25406J46586_10012845
450 JGI25165J46597_1000019
451 Ga0055542_1000625
452 Ga0070663_100020270
453 Ga0070665_100010479
454 Ga0070665_100044246
455 Ga0070665_100132015
456 Ga0068857_100077636
457 Ga0068854_100267610
458 Ga0068860_100591992
459 Ga0081539_10000410
460 Ga0075365_10002469
461 Ga0075365_10008459
462 Ga0075365_10018442
463 Ga0075365_10021658
464 Ga0075365_10340868
465 Ga0075363_100018547
466 Ga0075363_100046888
467 Ga0075363_100159380
468 Ga0075364_10024277
469 Ga0075364_10063456
470 Ga0075362_10107025
471 Ga0075367_10027169
472 Ga0075367_10032910
473 Ga0075367_10069460
474 Ga0105248_10378858
475 Ga0105238_10065945
476 Ga0105249_10370922
477 Ga0105239_10135892
478 Ga0105239_10239630
479 Ga0182008_10044070
480 Ga0209026_1000013
481 Ga0209148_1000032
482 Ga0209759_1000058
483 Ga0209233_1000034
484 Ga0209455_1000098
485 Ga0209758_1003869
486 Ga0207647_10045609
487 Ga0207705_10058343
488 Ga0207671_10157012
489 Ga0207657_10191723
490 Ga0207649_10149479
491 Ga0207694_10023400
492 Ga0207639_10075937
493 Ga0207678_10045832
494 Ga0207674_10106364
495 Ga0207698_10092806
496 Ga0209813_10013924
497 Ga0268266_10035412
498 Ga0268266_10044655
499 Ga0268266_10252133
500 Ga0316574_0089052
501 Ga0395899_0000014
502 Ga0395900_0000007
503 Ga0395900_0012123
504 Ga0395900_0601448
505 Ga0395898_0000011
506 Ga0395905_0000008
507 Ga0395905_0060689
508 Ga0395905_0083016
509 Ga0395905_0120943
510 Ga0395901_0000020
511 Ga0395901_0137149
512 Ga0439465_0045728
513 Ga0466972_0025807
514 Ga0495638_0037557
515 Ga0495637_0081136
516 Ga0495597_0022565
517 Ga0495670_0056027
518 Ga0495681_0063910
519 Ga0495686_0067638
520 Ga0495626_0040254
521 Ga0496102_0062875
522 Ga0496103_0216537
523 Ga0496105_0335871
524 Ga0496112_0080011
525 Ga0496112_0228823
526 Ga0496118_0164187
527 Ga0496119_0010625
528 Ga0496120_0005806
529 Ga0496120_0118975
530 Ga0496122_0066441
531 Ga0496124_0213751
532 Ga0496124_0351086
533 Ga0496125_0164729
534 Ga0496126_0103067
535 Ga0496126_0198360
536 Ga0501031_0000076
537 Ga0501032_0000004
538 Ga0501032_0001730
539 Ga0501033_0000156
540 Ga0501033_0018009
541 Ga0501033_0065273
542 Ga0501033_0213104
543 Ga0501034_0000011
544 Ga0501034_0016156
545 Ga0501034_0058466
546 Ga0501034_0076165
547 Ga0501034_0217595
548 Ga0501034_0355151
549 Ga0501036_0000001
550 Ga0501036_0022807
551 Ga0501037_0000064
552 Ga0501038_0000003
553 Ga0501038_0049366
554 Ga0501038_0290565
555 Ga0501038_0290855
556 Ga0501039_0000004
557 Ga0501039_0071860
558 Ga0501040_0010928
559 Ga0501043_0000417
560 Ga0501043_0078984
561 Ga0501047_0002889
562 Ga0501047_0061516
563 Ga0501047_0225249
564 Ga0501048_0006355
565 Ga0501067_0080323
566 Ga0501069_0005987
567 Ga0501070_0007807
568 Ga0501070_0009102
569 Ga0501070_0062989
570 Ga0501070_0187504
571 Ga0501071_0021753
572 Ga0501072_0162910
573 Ga0501073_0036359
574 Ga0501074_0022436
575 Ga0501079_0074809
576 Ga0501083_0038807
577 Ga0501035_0000009
578 Ga0501035_0014973
579 Ga0501035_0040762
580 Ga0501035_0330784
581 Ga0501044_0000005
582 Ga0501044_0037294
583 Ga0501044_0190897
584 Ga0501044_0346303
585 Ga0501045_0005304
586 nmdc:mga03683_34683_c1
587 nmdc:mga0yw44_11553_c1
588 nmdc:mga0yw44_150999_c1
589 nmdc:mga0yw44_36177_c1
590 nmdc:mga0yw44_55055_c1
591 nmdc:mga0sz30_23981_c3
592 Ga0500643_017331
593 Ga0500658_0063262
594 Ga0500568_0000052
595 Ga0500604_0061160
596 Ga0500604_0107615
597 Ga0500616_0078569
598 Ga0500620_000113
599 Ga0500627_0013430
600 2503198061
601 2509113652
602 2509140273
603 2509370574
604 2509392989
605 2510314407
606 2511389200
607 2512934456
608 2512962802
609 2513609522
610 2514037525
611 2514586134
612 2535485656
613 2588520627
614 2597810145
615 2599935737
616 2643770747
617 2643777734
618 2643796182
619 2643839671
620 2643985018
621 2644133600
622 2644154052
623 2688595374
624 2694628498
625 2694640628
626 2739308440
627 2753358359
628 2756674552
629 2758640584
630 2765464088
631 2770196738
632 2776272769
633 2776284713
634 2792746570
635 2839994017
636 2840769543
637 2841735841
638 2842873192
639 2844004112
640 2844010096
641 2847672965
642 2847689447
643 2854913867
644 2856320003
645 2856327858
646 2856332033
647 2856339326
648 2856345441
649 2856371253
650 2857354349
651 2857374114
652 2869168714
653 2869175029
654 2869239810
655 2869246299
656 2869256051
657 2869261194
658 2869264379
659 2869271840
660 2869279809
661 2869292476
662 2871429291
663 2871436158
664 2871445529
665 2871459256
666 2871463958
667 2871469812
668 2871478397
669 2871484470
670 2871490812
671 2871499386
672 2874109035
673 2874112570
674 2874117345
675 2874129510
676 2874138873
677 2874145698
678 2874154197
679 2874161699
680 2874162559
681 2874171768
682 2876363282
683 2876374970
684 2876387101
685 2876392916
686 2876405102
687 2876409461
688 2876419881
689 2876423640
690 2878035573
691 2878737517
692 2878740348
693 2878752819
694 2878755216
695 2878763576
696 2878770574
697 2878776156
698 2878782593
699 2878795370
700 2881147626
701 2881158726
702 2881164401
703 2881852620
704 2881863202
705 2882632764
706 2882912471
707 2885306264
708 2885314688
709 2885321019
710 2885329220
711 2885335834
712 2885344783
713 2885357097
714 2888342710
715 2888343814
716 2888352287
717 2889014277
718 2889021018
719 2889792542
720 2889916209
721 2894653011
722 2903454643
723 2903494918
724 2903499304
725 2903521275
726 2903525232
727 2903532023
728 2903544191
729 2904579267
730 2904659622
731 2906315210
732 2906321466
733 2906334542
734 2906369883
735 2906374462
736 2906382266
737 2906390612
738 2906398354
739 2906404652
740 2906412476
741 2906420779
742 2906433775
743 2915650742
744 2919121906
745 2922138569
746 2922158326
747 2922162342
748 2922173409
749 2922188953
750 2924716824
751 2924724978
752 2924732875
753 2924734282
754 2924743880
755 2924751509
756 2924756126
757 2924767708
758 2924777949
759 2924791437
760 2928522121
761 2937821752
762 2937826027
763 2937839135
764 2937849824
765 2937864145
766 2937874134
767 2937884511
768 2937895892
769 2937980534
770 2937986353
771 2937998035
772 2938017576
773 2954014459
774 2958035677
775 2958044708
776 2958066735
777 2958076294
778 2958091822
779 2958101463
780 2958112756
781 2958119665
782 2958128493
783 2958136876
784 2958138572
785 2958158633
786 2958168510
787 2958173736
788 2958186759
789 2961085260
790 2961114947
791 2961135821
792 2961166974
793 2961176742
794 2961189640
795 2963644742
796 2965021798
797 2965028841
798 2965046671
799 2965053194
800 2965064621
801 2965093060
802 2965107735
803 2965118101
804 2965121457
805 2968001149
806 2968007202
807 2968021634
808 2968088982
809 2968094089
810 2968100680
811 2968110675
812 2968121599
813 2968131296
814 2968145085
815 2968175380
816 2970476687
817 2970494144
818 2970509415
819 2970516317
820 2970525521
821 2970535004
822 2970545079
823 2970553798
824 2970558418
825 2970594409
826 2970622536
827 2970627914
828 2977824356
829 2977831156
830 2977850023
831 2977855080
832 2977858395
833 2977868305
834 2977879982
835 2977906449
836 2977912346
837 2977915175
838 2977925368
839 2977938287
840 2977943635
841 2977953096
842 2977959920
843 2977977374
844 2977987337
845 2979716937
846 2979750541
847 2979768852
848 2979778661
849 2979784643
850 2979794293
851 2979814202
852 2987642242
853 2987650222
854 2987658216
855 2987662986
856 2987668393
857 2987674810
858 2996314468
859 2996336798
860 2996346142
861 2996356110
862 2996388486
863 3000135942
864 3004172550
865 3004192038
866 3004198422
867 3004210328
868 3004216687
869 3004219720
870 3004233557
871 3004245738
872 3004253453
873 3004273067
874 3004282424
875 3004338054
876 637077628
877 649869934
878 8002291235
879 8004307137
880 8004319624
881 8004365381
882 8004376795
883 8004395150
884 8004401206
885 8004449749
886 8004638733
887 8004646908
888 8004701655
889 8004707249
890 8004721471
891 8004734538
892 8055617370

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09296

NUDIX-like

NADH pyrophosphatase-like rudimentary NUDIX domain

56

154

0.98

PF09297

zf-NADH-PPase

NADH pyrophosphatase zinc ribbon domain

156

187

0.98

PF00293

NUDIX

NUDIX domain

189

308

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wy6-assembly1.cif.gz_A crystal structure of atnudx1 (e56a) 0.8664 178 277
6ypf-assembly1.cif.gz_A nudix1 hydrolase from rosa x hybrida in complex with geranyl pyrophosphate 0.8654 178 279
4kyx-assembly1.cif.gz_A crystal structure of adp-ribose pyrophosphatase mutt from rickettsia felis 0.8507 178 279
5gp0-assembly1.cif.gz_I crystal structure of geraniol-nudx1 complex 0.8497 178 277
4kyx-assembly1.cif.gz_B crystal structure of adp-ribose pyrophosphatase mutt from rickettsia felis 0.8419 178 276
ID Description Score Start End Superfamily
af_I1MUA9_246_385_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9646 178 285 3.90.79.10
af_A0A0R4ISD4_291_431_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9597 178 311 3.90.79.10
af_Q94A82_242_424_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9338 178 313 3.90.79.10
af_Q9Y7J0_225_368_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9264 177 310 3.90.79.10
af_A4I7A0_174_307_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9231 178 309 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A7X6EJC4-F1-model_v4 deleted 0.964 198 313
AF-A0A358MEV2-F1-model_v4 NAD(+) diphosphatase (EC 3.6.1.22) 0.9525 199 305 GO:0005829
GO:0006734
GO:0006742
GO:0019677
GO:0035529
GO:0046872
AF-A0A3C0FX59-F1-model_v4 NAD(+) diphosphatase (EC 3.6.1.22) 0.9482 177 310 GO:0005829
GO:0006734
GO:0006742
GO:0019677
GO:0035529
GO:0046872
AF-A0A383CFI2-F1-model_v4 NAD(+) diphosphatase (EC 3.6.1.22) 0.9437 192 311 GO:0005777
GO:0005829
GO:0006734
GO:0006742
GO:0019677
GO:0035529
GO:0046872
AF-A0A7X6EJC4-F1-model_v4 deleted 0.9402 198 313

Map