F445666

General Info

Members Datasets Scaffolds Average Seq Length
446 141 892 431

Family's Representative Sequence

Representative Sequence 3300005457|Ga0070662_100023581|Ga0070662_1000235812
Length 451
Sequence MCVKRQTMMHWFKDQHFRSLVKNTSYLGVSKIVAAVAGVATLAFAGRGLGVILFGTLILITSYVKAVSGIAKFQSWQLIVRYGGHGVAHGDPEHFKVATGFAFALDVVSGIGGMLVGAALLPFVGTWAGIDPQYLWLGMLYCTVVPVMSSATPDGVLRVLDRFDLISWSATLMPITRAILAGAAFMTGASFAVYVAIWFVTDLIGNVYPWYLGWRELRRHGLLDDIRPTLKPTALAGAWRFAIDVNLASSVQAVWGPIGRLVVGGLLGPAGAALFRVASTLADSAQRPADLLGKAFYPEVMRMDLSSAKPWKLMLRGTAMVSIVALVAILILILGGKPLMALIFGKEFLGAYQPLVILMAIPFIGVFSFPLSPMLYALGRSDGPLKAKLLGSGVFFLSIAPLSWTWGITGAAIALVLANAANAGAMMIQLRGEHRRVRPKAKAQPQTGART

Samples

Sample ID Description Type Environment
1 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
116 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
117 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
122 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
123 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
124 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
125 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
128 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
129 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
130 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
131 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
132 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
133 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
141 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.69
Rhizosphere 97.09
Stem 0
Stem Tuber 0
Unclassified 5.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070662_100023581 3300005457 Bacteria 4228
2 JGI24736J21556_1001200 3300001904 Bacteria 4765
3 JGI24740J21852_10001338 3300001979 Bacteria 11209
4 JGI24740J21852_10003040 3300001979 Bacteria 7414
5 JGI24737J22298_10000494 3300001990 Bacteria 13696
6 Ga0070658_10004662 3300005327 Bacteria 11154
7 Ga0070658_10007049 3300005327 Bacteria 9067
8 Ga0070658_10025966 3300005327 Bacteria 4699
9 Ga0070658_10049502 3300005327 Bacteria 3404
10 Ga0070658_10085102 3300005327 Bacteria 2600
11 Ga0070658_10110665 3300005327 Bacteria 2275
12 Ga0070676_10005538 3300005328 Bacteria 6730
13 Ga0070676_10138016 3300005328 Unclassified 1549
14 Ga0070683_100006282 3300005329 Bacteria 9969
15 Ga0070683_100013626 3300005329 Bacteria 7097
16 Ga0070683_100018574 3300005329 Bacteria 6162
17 Ga0070683_100055757 3300005329 Bacteria 3668
18 Ga0070683_100104783 3300005329 Bacteria 2665
19 Ga0070670_100010219 3300005331 Bacteria 8009
20 Ga0070670_100093614 3300005331 Bacteria 2584
21 Ga0070670_100129886 3300005331 Bacteria 2175
22 Ga0070666_10002901 3300005335 Bacteria 10357
23 Ga0070666_10004347 3300005335 Bacteria 8628
24 Ga0070666_10032989 3300005335 Bacteria 3424
25 Ga0070680_100002421 3300005336 Bacteria 13826
26 Ga0070680_100002872 3300005336 Bacteria 12792
27 Ga0070682_100031885 3300005337 Bacteria 3191
28 Ga0070682_100111346 3300005337 Unclassified 1825
29 Ga0070660_100003799 3300005339 Bacteria 10432
30 Ga0070660_100005974 3300005339 Bacteria 8415
31 Ga0070660_100008743 3300005339 Bacteria 7092
32 Ga0070660_100012232 3300005339 Bacteria 6125
33 Ga0070660_100028245 3300005339 Bacteria 4195
34 Ga0070660_100051068 3300005339 Bacteria 3183
35 Ga0070660_100189935 3300005339 Bacteria 1664
36 Ga0070661_100005963 3300005344 Bacteria 8385
37 Ga0070661_100037817 3300005344 Bacteria 3511
38 Ga0070661_100102041 3300005344 Bacteria 2135
39 Ga0070692_10042389 3300005345 Unclassified 2337
40 Ga0070668_100017977 3300005347 Bacteria 5304
41 Ga0070668_100032331 3300005347 Bacteria 3982
42 Ga0070669_100022422 3300005353 Bacteria 4513
43 Ga0070675_100111533 3300005354 Bacteria 2315
44 Ga0070671_100000773 3300005355 Bacteria 22941
45 Ga0070671_100018987 3300005355 Bacteria 5591
46 Ga0070671_100021351 3300005355 Bacteria 5288
47 Ga0070671_100030895 3300005355 Bacteria 4421
48 Ga0070671_100138574 3300005355 Bacteria 2052
49 Ga0070674_100069038 3300005356 Bacteria 2492
50 Ga0070674_100145931 3300005356 Bacteria 1781
51 Ga0070673_100026185 3300005364 Bacteria 4304
52 Ga0070659_100003299 3300005366 Bacteria 11492
53 Ga0070659_100010032 3300005366 Bacteria 6971
54 Ga0070659_100049220 3300005366 Bacteria 3313
55 Ga0070659_100055647 3300005366 Bacteria 3119
56 Ga0070659_100080045 3300005366 Bacteria 2608
57 Ga0070667_100001859 3300005367 Bacteria 18763
58 Ga0070667_100033862 3300005367 Bacteria 4273
59 Ga0070667_100068990 3300005367 Bacteria 3008
60 Ga0070714_100095205 3300005435 Bacteria 2615
61 Ga0070714_100164532 3300005435 Unclassified 2009
62 Ga0070663_100001512 3300005455 Bacteria 12784
63 Ga0070663_100004641 3300005455 Bacteria 8094
64 Ga0070663_100011231 3300005455 Bacteria 5612
65 Ga0070663_100026757 3300005455 Bacteria 3910
66 Ga0070663_100126683 3300005455 Bacteria 1935
67 Ga0070663_100136609 3300005455 Bacteria 1867
68 Ga0070678_100005924 3300005456 Bacteria 7110
69 Ga0070678_100009191 3300005456 Bacteria 5971
70 Ga0070662_100007074 3300005457 Bacteria 7261
71 Ga0070662_100039919 3300005457 Bacteria 3340
72 Ga0070662_100116343 3300005457 Bacteria 2043
73 Ga0070662_100148986 3300005457 Bacteria 1820
74 Ga0070662_100180786 3300005457 Bacteria 1662
75 Ga0070662_100236261 3300005457 Bacteria 1464
76 Ga0070662_100249554 3300005457 Bacteria 1426
77 Ga0070681_10039641 3300005458 Bacteria 4721
78 Ga0070681_10055825 3300005458 Bacteria 3931
79 Ga0070681_10125603 3300005458 Bacteria 2498
80 Ga0070681_10251811 3300005458 Unclassified 1678
81 Ga0068867_100071006 3300005459 Bacteria 2604
82 Ga0068867_100119554 3300005459 Bacteria 2034
83 Ga0070679_100027559 3300005530 Bacteria 5593
84 Ga0070679_100263844 3300005530 Bacteria 1677
85 Ga0070684_100007162 3300005535 Bacteria 8666
86 Ga0070684_100073715 3300005535 Bacteria 3008
87 Ga0070684_100145031 3300005535 Bacteria 2148
88 Ga0068853_100017381 3300005539 Bacteria 5939
89 Ga0068853_100030851 3300005539 Bacteria 4529
90 Ga0068853_100038450 3300005539 Bacteria 4076
91 Ga0068853_100105060 3300005539 Bacteria 2501
92 Ga0070672_100030117 3300005543 Bacteria 4074
93 Ga0070672_100037073 3300005543 Bacteria 3718
94 Ga0070672_100053474 3300005543 Bacteria 3157
95 Ga0070672_100072357 3300005543 Bacteria 2745
96 Ga0070665_100011428 3300005548 Bacteria 8976
97 Ga0068855_100016147 3300005563 Bacteria 8977
98 Ga0068855_100034793 3300005563 Bacteria 6004
99 Ga0070664_100001648 3300005564 Bacteria 17871
100 Ga0070664_100007048 3300005564 Bacteria 9070
101 Ga0070664_100008931 3300005564 Bacteria 8126
102 Ga0070664_100009914 3300005564 Bacteria 7722
103 Ga0070664_100074721 3300005564 Bacteria 2909
104 Ga0070664_100074818 3300005564 Bacteria 2907
105 Ga0070664_100105746 3300005564 Bacteria 2451
106 Ga0070664_100171993 3300005564 Bacteria 1922
107 Ga0068857_100005165 3300005577 Bacteria 11100
108 Ga0068857_100053229 3300005577 Bacteria 3591
109 Ga0068857_100112969 3300005577 Bacteria 2442
110 Ga0068854_100001158 3300005578 Bacteria 15853
111 Ga0068854_100024106 3300005578 Bacteria 4163
112 Ga0068854_100028565 3300005578 Bacteria 3855
113 Ga0068854_100035139 3300005578 Bacteria 3506
114 Ga0068854_100094207 3300005578 Bacteria 2233
115 Ga0068854_100168637 3300005578 Bacteria 1702
116 Ga0068856_100021660 3300005614 Bacteria 6246
117 Ga0068856_100061813 3300005614 Bacteria 3700
118 Ga0068856_100101998 3300005614 Bacteria 2862
119 Ga0068852_100003056 3300005616 Bacteria 11642
120 Ga0068852_100020813 3300005616 Bacteria 5220
121 Ga0068852_100039096 3300005616 Bacteria 3992
122 Ga0068852_100045233 3300005616 Bacteria 3743
123 Ga0068852_100058046 3300005616 Bacteria 3350
124 Ga0068852_100064810 3300005616 Bacteria 3186
125 Ga0068852_100336015 3300005616 Bacteria 1471
126 Ga0068864_100003609 3300005618 Bacteria 12794
127 Ga0068864_100074125 3300005618 Bacteria 2969
128 Ga0068864_100163170 3300005618 Bacteria 2027
129 Ga0068864_100282306 3300005618 Bacteria 1550
130 Ga0068851_10045662 3300005834 Bacteria 2214
131 Ga0068863_100004857 3300005841 Bacteria 13244
132 Ga0068863_100005862 3300005841 Bacteria 12035
133 Ga0068863_100038085 3300005841 Bacteria 4576
134 Ga0068858_100001758 3300005842 Bacteria 22091
135 Ga0068860_100132548 3300005843 Bacteria 2392
136 Ga0068862_100012929 3300005844 Bacteria 6906
137 Ga0097621_100011378 3300006237 Bacteria 6549
138 Ga0068865_100025419 3300006881 Bacteria 3895
139 Ga0105240_10014590 3300009093 Bacteria 10720
140 Ga0105240_10019486 3300009093 Bacteria 9063
141 Ga0105240_10199222 3300009093 Bacteria 2348
142 Ga0105243_10028352 3300009148 Bacteria 4298
143 Ga0105241_10071034 3300009174 Bacteria 2702
144 Ga0105241_10175692 3300009174 Bacteria 1772
145 Ga0105248_10011744 3300009177 Bacteria 9660
146 Ga0105237_10015914 3300009545 Bacteria 7821
147 Ga0105238_10005248 3300009551 Bacteria 12810
148 Ga0105238_10091345 3300009551 Bacteria 3032
149 Ga0105238_10242617 3300009551 Bacteria 1779
150 Ga0157373_10067813 3300013100 Bacteria 2523
151 Ga0157371_10001471 3300013102 Bacteria 24445
152 Ga0157371_10075157 3300013102 Bacteria 2393
153 Ga0157371_10087195 3300013102 Bacteria 2210
154 Ga0157371_10099932 3300013102 Bacteria 2057
155 Ga0157370_10002797 3300013104 Bacteria 20845
156 Ga0157370_10004977 3300013104 Bacteria 15039
157 Ga0157370_10057667 3300013104 Bacteria 3691
158 Ga0157370_10156842 3300013104 Bacteria 2118
159 Ga0157369_10002151 3300013105 Bacteria 23758
160 Ga0157369_10005379 3300013105 Bacteria 14908
161 Ga0157369_10017309 3300013105 Bacteria 8102
162 Ga0157369_10057169 3300013105 Unclassified 4209
163 Ga0157369_10065158 3300013105 Bacteria 3922
164 Ga0157369_10089668 3300013105 Bacteria 3283
165 Ga0157369_10097818 3300013105 Bacteria 3130
166 Ga0157369_10130557 3300013105 Bacteria 2663
167 Ga0157369_10252213 3300013105 Unclassified 1841
168 Ga0157374_10002218 3300013296 Bacteria 16382
169 Ga0157374_10071532 3300013296 Bacteria 3270
170 Ga0157374_10101855 3300013296 Bacteria 2753
171 Ga0163162_10021243 3300013306 Bacteria 6388
172 Ga0157372_10020920 3300013307 Bacteria 7062
173 Ga0157372_10021073 3300013307 Bacteria 7038
174 Ga0157372_10239955 3300013307 Bacteria 2103
175 Ga0157375_10000296 3300013308 Bacteria 45207
176 Ga0163163_10012757 3300014325 Bacteria 7666
177 Ga0163163_10060101 3300014325 Bacteria 3762
178 Ga0157380_10026190 3300014326 Bacteria 4428
179 Ga0182008_10012801 3300014497 Bacteria 4423
180 Ga0163161_10100373 3300017792 Unclassified 2154
181 Ga0206356_10318857 3300020070 Bacteria 2071
182 Ga0207642_10041001 3300025899 Bacteria 2024
183 Ga0207680_10012612 3300025903 Bacteria 4310
184 Ga0207680_10016215 3300025903 Bacteria 3907
185 Ga0207680_10022568 3300025903 Bacteria 3425
186 Ga0207647_10003096 3300025904 Bacteria 12494
187 Ga0207647_10009883 3300025904 Bacteria 6758
188 Ga0207647_10032456 3300025904 Bacteria 3353
189 Ga0207647_10041144 3300025904 Bacteria 2908
190 Ga0207647_10048745 3300025904 Bacteria 2630
191 Ga0207647_10057193 3300025904 Bacteria 2391
192 Ga0207647_10066772 3300025904 Bacteria 2180
193 Ga0207645_10041446 3300025907 Bacteria 2947
194 Ga0207645_10114036 3300025907 Bacteria 1751
195 Ga0207705_10000101 3300025909 Bacteria 98231
196 Ga0207705_10000205 3300025909 Bacteria 59773
197 Ga0207705_10001949 3300025909 Bacteria 16132
198 Ga0207705_10006298 3300025909 Bacteria 8809
199 Ga0207705_10007215 3300025909 Bacteria 8183
200 Ga0207705_10014989 3300025909 Bacteria 5573
201 Ga0207705_10036639 3300025909 Bacteria 3510
202 Ga0207705_10040664 3300025909 Bacteria 3335
203 Ga0207705_10071720 3300025909 Bacteria 2511
204 Ga0207705_10075381 3300025909 Bacteria 2450
205 Ga0207707_10063189 3300025912 Bacteria 3222
206 Ga0207707_10093841 3300025912 Bacteria 2622
207 Ga0207695_10006995 3300025913 Bacteria 14476
208 Ga0207695_10034740 3300025913 Bacteria 5478
209 Ga0207660_10018799 3300025917 Bacteria 4612
210 Ga0207657_10001024 3300025919 Bacteria 29655
211 Ga0207657_10002754 3300025919 Bacteria 18921
212 Ga0207657_10004300 3300025919 Bacteria 15090
213 Ga0207657_10007378 3300025919 Bacteria 11280
214 Ga0207657_10008816 3300025919 Bacteria 10203
215 Ga0207657_10018700 3300025919 Bacteria 6603
216 Ga0207657_10029066 3300025919 Bacteria 5037
217 Ga0207657_10032636 3300025919 Bacteria 4702
218 Ga0207657_10101765 3300025919 Bacteria 2384
219 Ga0207649_10000176 3300025920 Bacteria 52479
220 Ga0207649_10003830 3300025920 Bacteria 8201
221 Ga0207649_10033738 3300025920 Bacteria 3061
222 Ga0207649_10049028 3300025920 Bacteria 2606
223 Ga0207649_10051258 3300025920 Bacteria 2555
224 Ga0207649_10093375 3300025920 Bacteria 1974
225 Ga0207652_10000270 3300025921 Bacteria 54010
226 Ga0207652_10213578 3300025921 Bacteria 1738
227 Ga0207681_10085398 3300025923 Bacteria 2240
228 Ga0207681_10106841 3300025923 Bacteria 2029
229 Ga0207694_10004309 3300025924 Bacteria 11120
230 Ga0207694_10006910 3300025924 Bacteria 8614
231 Ga0207650_10005349 3300025925 Bacteria 8756
232 Ga0207650_10043611 3300025925 Bacteria 3293
233 Ga0207650_10086330 3300025925 Bacteria 2389
234 Ga0207650_10205258 3300025925 Bacteria 1580
235 Ga0207664_10146997 3300025929 Bacteria 1999
236 Ga0207644_10000571 3300025931 Bacteria 23623
237 Ga0207644_10008343 3300025931 Bacteria 6788
238 Ga0207644_10028462 3300025931 Bacteria 3869
239 Ga0207690_10002269 3300025932 Bacteria 11725
240 Ga0207690_10002525 3300025932 Bacteria 11062
241 Ga0207690_10009287 3300025932 Bacteria 5844
242 Ga0207690_10032506 3300025932 Bacteria 3348
243 Ga0207690_10036014 3300025932 Bacteria 3202
244 Ga0207690_10067119 3300025932 Bacteria 2459
245 Ga0207706_10011200 3300025933 Bacteria 8176
246 Ga0207706_10012016 3300025933 Bacteria 7888
247 Ga0207706_10015530 3300025933 Bacteria 6880
248 Ga0207706_10064073 3300025933 Bacteria 3236
249 Ga0207706_10082515 3300025933 Bacteria 2825
250 Ga0207706_10090802 3300025933 Bacteria 2685
251 Ga0207706_10116268 3300025933 Bacteria 2352
252 Ga0207706_10143525 3300025933 Bacteria 2101
253 Ga0207706_10257722 3300025933 Bacteria 1523
254 Ga0207706_10263774 3300025933 Bacteria 1503
255 Ga0207691_10003309 3300025940 Bacteria 15700
256 Ga0207691_10015595 3300025940 Bacteria 7225
257 Ga0207691_10096970 3300025940 Bacteria 2636
258 Ga0207711_10059271 3300025941 Bacteria 3296
259 Ga0207711_10061032 3300025941 Bacteria 3250
260 Ga0207711_10064791 3300025941 Bacteria 3157
261 Ga0207711_10087991 3300025941 Bacteria 2726
262 Ga0207711_10128973 3300025941 Bacteria 2265
263 Ga0207661_10006246 3300025944 Bacteria 8426
264 Ga0207661_10009301 3300025944 Bacteria 7043
265 Ga0207679_10001455 3300025945 Bacteria 14860
266 Ga0207679_10002144 3300025945 Bacteria 12220
267 Ga0207679_10026352 3300025945 Bacteria 4007
268 Ga0207667_10008756 3300025949 Bacteria 11991
269 Ga0207667_10021296 3300025949 Bacteria 7185
270 Ga0207667_10027130 3300025949 Bacteria 6243
271 Ga0207667_10065775 3300025949 Bacteria 3780
272 Ga0207667_10067438 3300025949 Bacteria 3727
273 Ga0207667_10111160 3300025949 Bacteria 2826
274 Ga0207667_10304190 3300025949 Bacteria 1629
275 Ga0207651_10048916 3300025960 Bacteria 2861
276 Ga0207668_10042101 3300025972 Unclassified 3091
277 Ga0207640_10000963 3300025981 Bacteria 15985
278 Ga0207640_10017297 3300025981 Bacteria 4217
279 Ga0207640_10017863 3300025981 Unclassified 4156
280 Ga0207640_10020387 3300025981 Bacteria 3936
281 Ga0207658_10040591 3300025986 Bacteria 3365
282 Ga0207639_10000444 3300026041 Bacteria 28699
283 Ga0207639_10026576 3300026041 Bacteria 4206
284 Ga0207639_10032788 3300026041 Bacteria 3827
285 Ga0207639_10057425 3300026041 Bacteria 2988
286 Ga0207678_10000745 3300026067 Bacteria 29748
287 Ga0207678_10000774 3300026067 Bacteria 29166
288 Ga0207678_10001279 3300026067 Bacteria 23238
289 Ga0207678_10009002 3300026067 Bacteria 8786
290 Ga0207678_10013690 3300026067 Bacteria 7124
291 Ga0207678_10024573 3300026067 Bacteria 5263
292 Ga0207678_10034249 3300026067 Bacteria 4424
293 Ga0207678_10035965 3300026067 Bacteria 4311
294 Ga0207678_10095501 3300026067 Bacteria 2541
295 Ga0207678_10098777 3300026067 Unclassified 2494
296 Ga0207702_10005019 3300026078 Bacteria 11627
297 Ga0207702_10015252 3300026078 Bacteria 6372
298 Ga0207702_10058050 3300026078 Bacteria 3292
299 Ga0207702_10067701 3300026078 Bacteria 3065
300 Ga0207702_10162701 3300026078 Bacteria 2039
301 Ga0207641_10027157 3300026088 Bacteria 4727
302 Ga0207641_10092766 3300026088 Bacteria 2645
303 Ga0207648_10048084 3300026089 Bacteria 3736
304 Ga0207648_10152124 3300026089 Bacteria 2042
305 Ga0207676_10053817 3300026095 Bacteria 3151
306 Ga0207676_10166609 3300026095 Bacteria 1915
307 Ga0207674_10000347 3300026116 Bacteria 59568
308 Ga0207674_10001873 3300026116 Bacteria 26800
309 Ga0207674_10015519 3300026116 Bacteria 8367
310 Ga0207674_10016538 3300026116 Bacteria 8069
311 Ga0207674_10020273 3300026116 Bacteria 7186
312 Ga0207683_10004977 3300026121 Bacteria 11426
313 Ga0207683_10010924 3300026121 Bacteria 7746
314 Ga0207698_10003914 3300026142 Bacteria 9019
315 Ga0207698_10010725 3300026142 Bacteria 5911
316 Ga0207698_10023631 3300026142 Unclassified 4297
317 Ga0207698_10067522 3300026142 Unclassified 2820
318 Ga0207698_10152266 3300026142 Bacteria 2009
319 Ga0207698_10268210 3300026142 Bacteria 1572
320 Ga0268266_10177846 3300028379 Unclassified 1935
321 Ga0268264_10104878 3300028381 Bacteria 2465
322 Ga0307405_10013091 3300031731 Bacteria 4416
323 Ga0307407_10095788 3300031903 Bacteria 1830
324 Ga0307409_100041395 3300031995 Bacteria 3440
325 Ga0307414_10033217 3300032004 Bacteria 3408
326 Ga0307411_10002581 3300032005 Bacteria 8081
327 Ga0307411_10098765 3300032005 Bacteria 2058
328 Ga0395899_0000548 3300037312 Bacteria 40528
329 Ga0395899_0000759 3300037312 Bacteria 31923
330 Ga0395899_0002057 3300037312 Bacteria 16558
331 Ga0395899_0002320 3300037312 Bacteria 15509
332 Ga0395899_0007086 3300037312 Bacteria 8677
333 Ga0395899_0018594 3300037312 Bacteria 5280
334 Ga0395899_0058839 3300037312 Bacteria 2833
335 Ga0395899_0089886 3300037312 Bacteria 2227
336 Ga0395899_0132877 3300037312 Bacteria 1776
337 Ga0395899_0184764 3300037312 Unclassified 1461
338 Ga0395900_0000036 3300037418 Bacteria 250619
339 Ga0395900_0000130 3300037418 Bacteria 126231
340 Ga0395900_0002993 3300037418 Bacteria 18388
341 Ga0395900_0007644 3300037418 Bacteria 11158
342 Ga0395900_0011832 3300037418 Bacteria 8924
343 Ga0395900_0015602 3300037418 Bacteria 7743
344 Ga0395900_0028632 3300037418 Bacteria 5710
345 Ga0395900_0041182 3300037418 Bacteria 4763
346 Ga0395900_0043360 3300037418 Bacteria 4637
347 Ga0395900_0061645 3300037418 Bacteria 3856
348 Ga0395900_0076927 3300037418 Unclassified 3428
349 Ga0395900_0083607 3300037418 Bacteria 3279
350 Ga0395900_0116207 3300037418 Bacteria 2745
351 Ga0395898_0000274 3300037466 Bacteria 125922
352 Ga0395898_0004303 3300037466 Bacteria 15595
353 Ga0395898_0004704 3300037466 Bacteria 14856
354 Ga0395898_0005531 3300037466 Bacteria 13634
355 Ga0395898_0006106 3300037466 Bacteria 12914
356 Ga0395898_0007446 3300037466 Bacteria 11619
357 Ga0395898_0010149 3300037466 Bacteria 9857
358 Ga0395898_0066265 3300037466 Bacteria 3499
359 Ga0395898_0077511 3300037466 Viruses 3209
360 Ga0395898_0146553 3300037466 Unclassified 2259
361 Ga0395898_0176324 3300037466 Bacteria 2043
362 Ga0395898_0288493 3300037466 Bacteria 1565
363 Ga0395905_0000006 3300037471 Bacteria 549428
364 Ga0395905_0002188 3300037471 Bacteria 22082
365 Ga0395905_0003075 3300037471 Bacteria 18051
366 Ga0395905_0004506 3300037471 Bacteria 14438
367 Ga0395905_0006722 3300037471 Bacteria 11514
368 Ga0395905_0014050 3300037471 Bacteria 7656
369 Ga0395905_0033159 3300037471 Bacteria 4853
370 Ga0395905_0045078 3300037471 Bacteria 4136
371 Ga0395905_0052920 3300037471 Bacteria 3800
372 Ga0395905_0063393 3300037471 Bacteria 3458
373 Ga0395905_0080218 3300037471 Bacteria 3058
374 Ga0395905_0080388 3300037471 Unclassified 3055
375 Ga0395905_0090760 3300037471 Bacteria 2864
376 Ga0395905_0093682 3300037471 Bacteria 2817
377 Ga0395905_0131632 3300037471 Bacteria 2352
378 Ga0395905_0145050 3300037471 Unclassified 2234
379 Ga0395905_0154421 3300037471 Unclassified 2159
380 Ga0395901_0000036 3300038443 Bacteria 214274
381 Ga0395901_0003488 3300038443 Bacteria 15846
382 Ga0395901_0009176 3300038443 Bacteria 10021
383 Ga0395901_0012700 3300038443 Bacteria 8543
384 Ga0395901_0030523 3300038443 Bacteria 5553
385 Ga0395901_0033978 3300038443 Bacteria 5265
386 Ga0395901_0036123 3300038443 Bacteria 5105
387 Ga0395901_0063461 3300038443 Bacteria 3844
388 Ga0395901_0069413 3300038443 Bacteria 3670
389 Ga0395901_0077554 3300038443 Bacteria 3468
390 Ga0395901_0078112 3300038443 Bacteria 3456
391 Ga0395901_0079038 3300038443 Bacteria 3434
392 Ga0395901_0092515 3300038443 Bacteria 3165
393 Ga0395901_0095713 3300038443 Bacteria 3111
394 Ga0395901_0219692 3300038443 Unclassified 1986
395 Ga0436365_1435754 3300039437 Bacteria 20552
396 Ga0439448_0007522 3300042005 Bacteria 3160
397 Ga0439455_0020804 3300042012 Bacteria 1558
398 Ga0439458_0000433 3300042157 Bacteria 10562
399 Ga0439458_0000947 3300042157 Bacteria 7466
400 Ga0466966_0000004 3300044684 Bacteria 223594
401 Ga0466966_0001072 3300044684 Bacteria 17475
402 Ga0466966_0021955 3300044684 Bacteria 4190
403 Ga0466966_0077981 3300044684 Bacteria 2067
404 Ga0466961_0010542 3300044693 Bacteria 5895
405 Ga0466963_0016363 3300044694 Bacteria 4611
406 Ga0466963_0023836 3300044694 Bacteria 3891
407 Ga0466964_0002775 3300044706 Bacteria 6291
408 Ga0466971_0001014 3300044719 Bacteria 11609
409 Ga0466971_0003333 3300044719 Bacteria 6861
410 Ga0466968_0007636 3300044735 Bacteria 4118
411 Ga0466970_0016613 3300044765 Bacteria 3797
412 Ga0466970_0033478 3300044765 Bacteria 2716
413 Ga0466970_0065534 3300044765 Bacteria 1949
414 Ga0466957_0000979 3300044842 Bacteria 14682
415 Ga0466957_0012903 3300044842 Bacteria 4842
416 Ga0466959_0056084 3300045049 Unclassified 2875
417 Ga0466959_0086008 3300045049 Bacteria 2262
418 Ga0466958_0002974 3300045836 Bacteria 8681
419 Ga0466958_0028163 3300045836 Bacteria 3330
420 Ga0495642_0022255 3300046528 Bacteria 2497
421 Ga0495621_0001538 3300046539 Bacteria 6005
422 Ga0495621_0030276 3300046539 Bacteria 1849
423 Ga0495633_0007069 3300046558 Bacteria 6529
424 Ga0495669_0002673 3300046684 Bacteria 7298
425 Ga0495669_0003308 3300046684 Bacteria 6631
426 Ga0495669_0009457 3300046684 Bacteria 4111
427 Ga0495669_0010574 3300046684 Bacteria 3901
428 Ga0495669_0013855 3300046684 Bacteria 3441
429 Ga0495677_0006121 3300047445 Bacteria 4552
430 Ga0495677_0007334 3300047445 Bacteria 4124
431 Ga0496107_0012594 3300048910 Bacteria 5906
432 Ga0496107_0098574 3300048910 Bacteria 2141
433 Ga0496108_0000883 3300048911 Bacteria 23370
434 Ga0496108_0021979 3300048911 Bacteria 5243
435 Ga0496110_0008800 3300048913 Bacteria 8133
436 Ga0496110_0200646 3300048913 Unclassified 1812
437 Ga0496111_0008127 3300048914 Bacteria 6931
438 Ga0496112_0003475 3300048915 Bacteria 13035
439 Ga0496112_0081233 3300048915 Bacteria 3205
440 Ga0496113_0023845 3300048916 Bacteria 4343
441 Ga0496113_0051488 3300048916 Bacteria 3073
442 Ga0496114_0003919 3300048917 Bacteria 11481
443 Ga0501068_0041200 3300049584 Bacteria 2775
444 Ga0501068_0073850 3300049584 Bacteria 2084
445 Ga0466962_0015965 3300061719 Bacteria 3623
446 Ga0466962_0016022 3300061719 Bacteria 3616
447 Ga0070662_100023581
448 JGI24736J21556_1001200
449 JGI24740J21852_10001338
450 JGI24740J21852_10003040
451 JGI24737J22298_10000494
452 Ga0070658_10004662
453 Ga0070658_10007049
454 Ga0070658_10025966
455 Ga0070658_10049502
456 Ga0070658_10085102
457 Ga0070658_10110665
458 Ga0070676_10005538
459 Ga0070676_10138016
460 Ga0070683_100006282
461 Ga0070683_100013626
462 Ga0070683_100018574
463 Ga0070683_100055757
464 Ga0070683_100104783
465 Ga0070670_100010219
466 Ga0070670_100093614
467 Ga0070670_100129886
468 Ga0070666_10002901
469 Ga0070666_10004347
470 Ga0070666_10032989
471 Ga0070680_100002421
472 Ga0070680_100002872
473 Ga0070682_100031885
474 Ga0070682_100111346
475 Ga0070660_100003799
476 Ga0070660_100005974
477 Ga0070660_100008743
478 Ga0070660_100012232
479 Ga0070660_100028245
480 Ga0070660_100051068
481 Ga0070660_100189935
482 Ga0070661_100005963
483 Ga0070661_100037817
484 Ga0070661_100102041
485 Ga0070692_10042389
486 Ga0070668_100017977
487 Ga0070668_100032331
488 Ga0070669_100022422
489 Ga0070675_100111533
490 Ga0070671_100000773
491 Ga0070671_100018987
492 Ga0070671_100021351
493 Ga0070671_100030895
494 Ga0070671_100138574
495 Ga0070674_100069038
496 Ga0070674_100145931
497 Ga0070673_100026185
498 Ga0070659_100003299
499 Ga0070659_100010032
500 Ga0070659_100049220
501 Ga0070659_100055647
502 Ga0070659_100080045
503 Ga0070667_100001859
504 Ga0070667_100033862
505 Ga0070667_100068990
506 Ga0070714_100095205
507 Ga0070714_100164532
508 Ga0070663_100001512
509 Ga0070663_100004641
510 Ga0070663_100011231
511 Ga0070663_100026757
512 Ga0070663_100126683
513 Ga0070663_100136609
514 Ga0070678_100005924
515 Ga0070678_100009191
516 Ga0070662_100007074
517 Ga0070662_100039919
518 Ga0070662_100116343
519 Ga0070662_100148986
520 Ga0070662_100180786
521 Ga0070662_100236261
522 Ga0070662_100249554
523 Ga0070681_10039641
524 Ga0070681_10055825
525 Ga0070681_10125603
526 Ga0070681_10251811
527 Ga0068867_100071006
528 Ga0068867_100119554
529 Ga0070679_100027559
530 Ga0070679_100263844
531 Ga0070684_100007162
532 Ga0070684_100073715
533 Ga0070684_100145031
534 Ga0068853_100017381
535 Ga0068853_100030851
536 Ga0068853_100038450
537 Ga0068853_100105060
538 Ga0070672_100030117
539 Ga0070672_100037073
540 Ga0070672_100053474
541 Ga0070672_100072357
542 Ga0070665_100011428
543 Ga0068855_100016147
544 Ga0068855_100034793
545 Ga0070664_100001648
546 Ga0070664_100007048
547 Ga0070664_100008931
548 Ga0070664_100009914
549 Ga0070664_100074721
550 Ga0070664_100074818
551 Ga0070664_100105746
552 Ga0070664_100171993
553 Ga0068857_100005165
554 Ga0068857_100053229
555 Ga0068857_100112969
556 Ga0068854_100001158
557 Ga0068854_100024106
558 Ga0068854_100028565
559 Ga0068854_100035139
560 Ga0068854_100094207
561 Ga0068854_100168637
562 Ga0068856_100021660
563 Ga0068856_100061813
564 Ga0068856_100101998
565 Ga0068852_100003056
566 Ga0068852_100020813
567 Ga0068852_100039096
568 Ga0068852_100045233
569 Ga0068852_100058046
570 Ga0068852_100064810
571 Ga0068852_100336015
572 Ga0068864_100003609
573 Ga0068864_100074125
574 Ga0068864_100163170
575 Ga0068864_100282306
576 Ga0068851_10045662
577 Ga0068863_100004857
578 Ga0068863_100005862
579 Ga0068863_100038085
580 Ga0068858_100001758
581 Ga0068860_100132548
582 Ga0068862_100012929
583 Ga0097621_100011378
584 Ga0068865_100025419
585 Ga0105240_10014590
586 Ga0105240_10019486
587 Ga0105240_10199222
588 Ga0105243_10028352
589 Ga0105241_10071034
590 Ga0105241_10175692
591 Ga0105248_10011744
592 Ga0105237_10015914
593 Ga0105238_10005248
594 Ga0105238_10091345
595 Ga0105238_10242617
596 Ga0157373_10067813
597 Ga0157371_10001471
598 Ga0157371_10075157
599 Ga0157371_10087195
600 Ga0157371_10099932
601 Ga0157370_10002797
602 Ga0157370_10004977
603 Ga0157370_10057667
604 Ga0157370_10156842
605 Ga0157369_10002151
606 Ga0157369_10005379
607 Ga0157369_10017309
608 Ga0157369_10057169
609 Ga0157369_10065158
610 Ga0157369_10089668
611 Ga0157369_10097818
612 Ga0157369_10130557
613 Ga0157369_10252213
614 Ga0157374_10002218
615 Ga0157374_10071532
616 Ga0157374_10101855
617 Ga0163162_10021243
618 Ga0157372_10020920
619 Ga0157372_10021073
620 Ga0157372_10239955
621 Ga0157375_10000296
622 Ga0163163_10012757
623 Ga0163163_10060101
624 Ga0157380_10026190
625 Ga0182008_10012801
626 Ga0163161_10100373
627 Ga0206356_10318857
628 Ga0207642_10041001
629 Ga0207680_10012612
630 Ga0207680_10016215
631 Ga0207680_10022568
632 Ga0207647_10003096
633 Ga0207647_10009883
634 Ga0207647_10032456
635 Ga0207647_10041144
636 Ga0207647_10048745
637 Ga0207647_10057193
638 Ga0207647_10066772
639 Ga0207645_10041446
640 Ga0207645_10114036
641 Ga0207705_10000101
642 Ga0207705_10000205
643 Ga0207705_10001949
644 Ga0207705_10006298
645 Ga0207705_10007215
646 Ga0207705_10014989
647 Ga0207705_10036639
648 Ga0207705_10040664
649 Ga0207705_10071720
650 Ga0207705_10075381
651 Ga0207707_10063189
652 Ga0207707_10093841
653 Ga0207695_10006995
654 Ga0207695_10034740
655 Ga0207660_10018799
656 Ga0207657_10001024
657 Ga0207657_10002754
658 Ga0207657_10004300
659 Ga0207657_10007378
660 Ga0207657_10008816
661 Ga0207657_10018700
662 Ga0207657_10029066
663 Ga0207657_10032636
664 Ga0207657_10101765
665 Ga0207649_10000176
666 Ga0207649_10003830
667 Ga0207649_10033738
668 Ga0207649_10049028
669 Ga0207649_10051258
670 Ga0207649_10093375
671 Ga0207652_10000270
672 Ga0207652_10213578
673 Ga0207681_10085398
674 Ga0207681_10106841
675 Ga0207694_10004309
676 Ga0207694_10006910
677 Ga0207650_10005349
678 Ga0207650_10043611
679 Ga0207650_10086330
680 Ga0207650_10205258
681 Ga0207664_10146997
682 Ga0207644_10000571
683 Ga0207644_10008343
684 Ga0207644_10028462
685 Ga0207690_10002269
686 Ga0207690_10002525
687 Ga0207690_10009287
688 Ga0207690_10032506
689 Ga0207690_10036014
690 Ga0207690_10067119
691 Ga0207706_10011200
692 Ga0207706_10012016
693 Ga0207706_10015530
694 Ga0207706_10064073
695 Ga0207706_10082515
696 Ga0207706_10090802
697 Ga0207706_10116268
698 Ga0207706_10143525
699 Ga0207706_10257722
700 Ga0207706_10263774
701 Ga0207691_10003309
702 Ga0207691_10015595
703 Ga0207691_10096970
704 Ga0207711_10059271
705 Ga0207711_10061032
706 Ga0207711_10064791
707 Ga0207711_10087991
708 Ga0207711_10128973
709 Ga0207661_10006246
710 Ga0207661_10009301
711 Ga0207679_10001455
712 Ga0207679_10002144
713 Ga0207679_10026352
714 Ga0207667_10008756
715 Ga0207667_10021296
716 Ga0207667_10027130
717 Ga0207667_10065775
718 Ga0207667_10067438
719 Ga0207667_10111160
720 Ga0207667_10304190
721 Ga0207651_10048916
722 Ga0207668_10042101
723 Ga0207640_10000963
724 Ga0207640_10017297
725 Ga0207640_10017863
726 Ga0207640_10020387
727 Ga0207658_10040591
728 Ga0207639_10000444
729 Ga0207639_10026576
730 Ga0207639_10032788
731 Ga0207639_10057425
732 Ga0207678_10000745
733 Ga0207678_10000774
734 Ga0207678_10001279
735 Ga0207678_10009002
736 Ga0207678_10013690
737 Ga0207678_10024573
738 Ga0207678_10034249
739 Ga0207678_10035965
740 Ga0207678_10095501
741 Ga0207678_10098777
742 Ga0207702_10005019
743 Ga0207702_10015252
744 Ga0207702_10058050
745 Ga0207702_10067701
746 Ga0207702_10162701
747 Ga0207641_10027157
748 Ga0207641_10092766
749 Ga0207648_10048084
750 Ga0207648_10152124
751 Ga0207676_10053817
752 Ga0207676_10166609
753 Ga0207674_10000347
754 Ga0207674_10001873
755 Ga0207674_10015519
756 Ga0207674_10016538
757 Ga0207674_10020273
758 Ga0207683_10004977
759 Ga0207683_10010924
760 Ga0207698_10003914
761 Ga0207698_10010725
762 Ga0207698_10023631
763 Ga0207698_10067522
764 Ga0207698_10152266
765 Ga0207698_10268210
766 Ga0268266_10177846
767 Ga0268264_10104878
768 Ga0307405_10013091
769 Ga0307407_10095788
770 Ga0307409_100041395
771 Ga0307414_10033217
772 Ga0307411_10002581
773 Ga0307411_10098765
774 Ga0395899_0000548
775 Ga0395899_0000759
776 Ga0395899_0002057
777 Ga0395899_0002320
778 Ga0395899_0007086
779 Ga0395899_0018594
780 Ga0395899_0058839
781 Ga0395899_0089886
782 Ga0395899_0132877
783 Ga0395899_0184764
784 Ga0395900_0000036
785 Ga0395900_0000130
786 Ga0395900_0002993
787 Ga0395900_0007644
788 Ga0395900_0011832
789 Ga0395900_0015602
790 Ga0395900_0028632
791 Ga0395900_0041182
792 Ga0395900_0043360
793 Ga0395900_0061645
794 Ga0395900_0076927
795 Ga0395900_0083607
796 Ga0395900_0116207
797 Ga0395898_0000274
798 Ga0395898_0004303
799 Ga0395898_0004704
800 Ga0395898_0005531
801 Ga0395898_0006106
802 Ga0395898_0007446
803 Ga0395898_0010149
804 Ga0395898_0066265
805 Ga0395898_0077511
806 Ga0395898_0146553
807 Ga0395898_0176324
808 Ga0395898_0288493
809 Ga0395905_0000006
810 Ga0395905_0002188
811 Ga0395905_0003075
812 Ga0395905_0004506
813 Ga0395905_0006722
814 Ga0395905_0014050
815 Ga0395905_0033159
816 Ga0395905_0045078
817 Ga0395905_0052920
818 Ga0395905_0063393
819 Ga0395905_0080218
820 Ga0395905_0080388
821 Ga0395905_0090760
822 Ga0395905_0093682
823 Ga0395905_0131632
824 Ga0395905_0145050
825 Ga0395905_0154421
826 Ga0395901_0000036
827 Ga0395901_0003488
828 Ga0395901_0009176
829 Ga0395901_0012700
830 Ga0395901_0030523
831 Ga0395901_0033978
832 Ga0395901_0036123
833 Ga0395901_0063461
834 Ga0395901_0069413
835 Ga0395901_0077554
836 Ga0395901_0078112
837 Ga0395901_0079038
838 Ga0395901_0092515
839 Ga0395901_0095713
840 Ga0395901_0219692
841 Ga0436365_1435754
842 Ga0439448_0007522
843 Ga0439455_0020804
844 Ga0439458_0000433
845 Ga0439458_0000947
846 Ga0466966_0000004
847 Ga0466966_0001072
848 Ga0466966_0021955
849 Ga0466966_0077981
850 Ga0466961_0010542
851 Ga0466963_0016363
852 Ga0466963_0023836
853 Ga0466964_0002775
854 Ga0466971_0001014
855 Ga0466971_0003333
856 Ga0466968_0007636
857 Ga0466970_0016613
858 Ga0466970_0033478
859 Ga0466970_0065534
860 Ga0466957_0000979
861 Ga0466957_0012903
862 Ga0466959_0056084
863 Ga0466959_0086008
864 Ga0466958_0002974
865 Ga0466958_0028163
866 Ga0495642_0022255
867 Ga0495621_0001538
868 Ga0495621_0030276
869 Ga0495633_0007069
870 Ga0495669_0002673
871 Ga0495669_0003308
872 Ga0495669_0009457
873 Ga0495669_0010574
874 Ga0495669_0013855
875 Ga0495677_0006121
876 Ga0495677_0007334
877 Ga0496107_0012594
878 Ga0496107_0098574
879 Ga0496108_0000883
880 Ga0496108_0021979
881 Ga0496110_0008800
882 Ga0496110_0200646
883 Ga0496111_0008127
884 Ga0496112_0003475
885 Ga0496112_0081233
886 Ga0496113_0023845
887 Ga0496113_0051488
888 Ga0496114_0003919
889 Ga0501068_0041200
890 Ga0501068_0073850
891 Ga0466962_0015965
892 Ga0466962_0016022

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14667

Polysacc_synt_C

Polysaccharide biosynthesis C-terminal domain

354

442

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wag-assembly1.cif.gz_A crystal structure of murj squeezed form 0.8158 13 427
7waw-assembly1.cif.gz_A murj inward closed form 0.7944 16 427
6cc4-assembly1.cif.gz_A structure of murj from escherichia coli 0.7855 27 427
7wag-assembly1.cif.gz_A crystal structure of murj squeezed form 0.7832 13 427
7waw-assembly1.cif.gz_A murj inward closed form 0.7585 16 427
ID Description Score Start End Superfamily
af_Q2G0R7_343_485_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8799 348 431 1.10.1760.20
af_Q9JHZ2_346_492_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8417 330 432 1.10.1760.20
af_P58368_346_501_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8259 330 432 1.10.1760.20
af_Q2G140_246_407_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.806 238 383 1.10.1760.20
af_P0AAA7_285_416_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8048 305 427 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A7X6BGU0-F1-model_v4 O-antigen/teichoic acid export membrane protein 0.9503 1 428 GO:0005886
AF-A0A6G7ZNV4-F1-model_v4 Oligosaccharide flippase family protein 0.9458 1 432 GO:0005886
AF-A0A1L5KNL1-F1-model_v4 Polysaccharide biosynthesis protein 0.9435 2 232 GO:0005886
AF-A0A7X6BGU0-F1-model_v4 O-antigen/teichoic acid export membrane protein 0.9376 1 428 GO:0005886
AF-A0A0Q5R761-F1-model_v4 Polysaccharide biosynthesis protein C-terminal domain-containing protein 0.9362 1 432 GO:0005886

Map