F445671

General Info

Members Datasets Scaffolds Average Seq Length
446 256 890 285

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100004166|Ga0070697_10000416613
Length 322
Sequence MTQHSHQTAPTQFVEANGIRFAYRRFGKTPDFDPNLFLDGIDPQYQAELNGSIGGVPLVFNQHFTGTMDHWDPAVTDGLAKDREVILFDNAGISSSSGEVPTTFEEMGANAIAFIKALGLKRVDLLGFSIGGFVAQEITLQAPKLVRRLVLVGTGPRGGQNMATLTPEAQQIFGATYKVPEELWLKVHFTDSEASQAAGREFLKRFLRRTENRDPEVNEKVAPAQIEAIGKWGVQREGSGEGSYGYLKTIKQPTLVVNGDNDVIIYSINSWILQQNIPNAQLIIYPDASHGSQYQYPERFVRHVSDFAAAPAIFESTEQSGS

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
11 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
77 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
78 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
121 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
122 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
128 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
129 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
130 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
131 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
132 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
139 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
140 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
141 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
145 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
146 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
147 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
148 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
149 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
150 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
153 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
154 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
155 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
156 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
157 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
158 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
159 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
163 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
180 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
187 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
190 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
191 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
204 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
210 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
223 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
224 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
225 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
226 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
227 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
228 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
229 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
230 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
231 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
232 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
233 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
234 2511231015 Pseudomonas sp. GM49 Isolate Nodule
235 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
236 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
237 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
238 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
239 2818991444 Filimonas endophytica 3197 Isolate Unclassified
240 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
241 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
242 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
243 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
244 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
245 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
246 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
247 2919404418 Luteibacter sp. 3190 Isolate Unclassified
248 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
249 2928037797 Variovorax sp. 1126 Isolate Unclassified
250 2928044640 Variovorax sp. 1128 Isolate Unclassified
251 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
252 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
253 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
254 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
255 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
256 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.5
Metatranscriptomes 0.22
Isolates 6.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.85
Nodule 2.02
Rhizoplane 3.14
Rhizosphere 75.78
Stem 0
Stem Tuber 0
Unclassified 1.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100004166 3300005536 Bacteria 11077
2 JGI25156J39149_1000295 3300002705 Bacteria 33633
3 JGI25156J39149_1001000 3300002705 Bacteria 13330
4 JGI25165J46597_1001890 3300003214 Bacteria 8455
5 rootH1_10097004 3300003316 Bacteria 1501
6 rootH2_10049941 3300003320 Bacteria 8709
7 rootH2_10159984 3300003320 Bacteria 3142
8 rootL2_10125244 3300003322 Bacteria 9830
9 rootH1_10101817 3300003323 Bacteria 2677
10 rootH1_10133041 3300003323 Bacteria 10864
11 rootH1_10183558 3300003323 Bacteria 2586
12 JGI25160J50197_1000208 3300003354 Bacteria 48426
13 Ga0055533_1000095 3300003756 Bacteria 114060
14 Ga0055532_1000010 3300003758 Bacteria 392055
15 Ga0055532_1000254 3300003758 Bacteria 36666
16 Ga0055527_1000008 3300003760 Bacteria 392055
17 Ga0055535_1000007 3300003761 Bacteria 392055
18 Ga0055542_1000011 3300003762 Bacteria 392055
19 Ga0055529_1000009 3300003763 Bacteria 392055
20 Ga0065165_1000119 3300005262 Bacteria 134464
21 Ga0065704_10025481 3300005289 Bacteria 1182
22 Ga0065704_10194441 3300005289 Bacteria 1174
23 Ga0068868_100449181 3300005338 Bacteria 1121
24 Ga0070661_100236917 3300005344 Bacteria 1404
25 Ga0070668_100000214 3300005347 Bacteria 37668
26 Ga0070668_100148575 3300005347 Bacteria 1893
27 Ga0070675_100106735 3300005354 Bacteria 2364
28 Ga0070675_100377323 3300005354 Bacteria 1261
29 Ga0070674_100209435 3300005356 Bacteria 1510
30 Ga0070667_100620870 3300005367 Bacteria 997
31 Ga0070703_10015819 3300005406 Bacteria 2161
32 Ga0070714_100468203 3300005435 Bacteria 1199
33 Ga0070713_100016740 3300005436 Bacteria 5520
34 Ga0070710_10097381 3300005437 Bacteria 1745
35 Ga0070711_100055892 3300005439 Bacteria 2728
36 Ga0070711_100334830 3300005439 Bacteria 1213
37 Ga0070708_100059309 3300005445 Bacteria 3412
38 Ga0070708_100068258 3300005445 Bacteria 3195
39 Ga0070708_100122166 3300005445 Bacteria 2403
40 Ga0070708_100153633 3300005445 Bacteria 2141
41 Ga0070708_100182581 3300005445 Bacteria 1961
42 Ga0070663_100242703 3300005455 Bacteria 1423
43 Ga0070678_100183973 3300005456 Bacteria 1713
44 Ga0070706_100042357 3300005467 Bacteria 4206
45 Ga0070706_100063198 3300005467 Bacteria 3421
46 Ga0070706_100125477 3300005467 Bacteria 2393
47 Ga0070707_100080333 3300005468 Bacteria 3147
48 Ga0070707_100573581 3300005468 Bacteria 1091
49 Ga0070707_100775356 3300005468 Bacteria 922
50 Ga0070698_100096179 3300005471 Bacteria 2938
51 Ga0070698_100523879 3300005471 Bacteria 1124
52 Ga0070699_100038630 3300005518 Bacteria 4133
53 Ga0070699_100085777 3300005518 Bacteria 2747
54 Ga0070697_100077083 3300005536 Bacteria 2742
55 Ga0070697_100258485 3300005536 Bacteria 1490
56 Ga0070697_100434790 3300005536 Bacteria 1141
57 Ga0070665_100178580 3300005548 Bacteria 2124
58 Ga0070704_100101758 3300005549 Bacteria 2166
59 Ga0068852_100487354 3300005616 Bacteria 1226
60 Ga0068864_100545833 3300005618 Bacteria 1120
61 Ga0068851_10027294 3300005834 Bacteria 2813
62 Ga0068863_100060278 3300005841 Bacteria 3589
63 Ga0068860_100000019 3300005843 Bacteria 299860
64 Ga0068860_100000458 3300005843 Bacteria 51184
65 Ga0068862_100325729 3300005844 Bacteria 1419
66 Ga0070717_10139332 3300006028 Bacteria 2091
67 Ga0070717_10156530 3300006028 Bacteria 1974
68 Ga0075365_10029914 3300006038 Bacteria 3484
69 Ga0070716_100074717 3300006173 Bacteria 2003
70 Ga0070716_100142153 3300006173 Bacteria 1532
71 Ga0070712_100001682 3300006175 Bacteria 13536
72 Ga0070712_100043812 3300006175 Bacteria 3082
73 Ga0068871_100014326 3300006358 Bacteria 5908
74 Ga0068871_100250778 3300006358 Bacteria 1542
75 Ga0075428_100049896 3300006844 Bacteria 4591
76 Ga0075428_100057837 3300006844 Bacteria 4244
77 Ga0075428_100565928 3300006844 Bacteria 1215
78 Ga0075430_100187366 3300006846 Bacteria 1720
79 Ga0075431_100052464 3300006847 Bacteria 4206
80 Ga0075431_100167791 3300006847 Bacteria 2256
81 Ga0075433_10021593 3300006852 Bacteria 5399
82 Ga0075433_10178630 3300006852 Bacteria 1889
83 Ga0075434_100068985 3300006871 Bacteria 3524
84 Ga0075434_100087950 3300006871 Bacteria 3108
85 Ga0075434_100113262 3300006871 Bacteria 2725
86 Ga0075434_100480508 3300006871 Bacteria 1263
87 Ga0075434_100688990 3300006871 Bacteria 1040
88 Ga0075436_100048207 3300006914 Bacteria 2939
89 Ga0075436_100157576 3300006914 Bacteria 1600
90 Ga0075435_100114912 3300007076 Bacteria 2241
91 Ga0075435_100284653 3300007076 Bacteria 1411
92 Ga0075435_100379115 3300007076 Bacteria 1215
93 Ga0075435_100415802 3300007076 Bacteria 1158
94 Ga0075435_100532574 3300007076 Bacteria 1016
95 Ga0099794_10001943 3300007265 Bacteria 7443
96 Ga0099794_10005352 3300007265 Bacteria 5138
97 Ga0099794_10016812 3300007265 Bacteria 3250
98 Ga0099794_10043256 3300007265 Bacteria 2149
99 Ga0099794_10048316 3300007265 Bacteria 2042
100 Ga0099794_10080991 3300007265 Bacteria 1601
101 Ga0099794_10085795 3300007265 Bacteria 1558
102 Ga0099794_10101922 3300007265 Bacteria 1433
103 Ga0099794_10124302 3300007265 Bacteria 1300
104 Ga0099795_10003046 3300007788 Bacteria 4086
105 Ga0099795_10014412 3300007788 Bacteria 2451
106 Ga0099795_10049921 3300007788 Bacteria 1520
107 Ga0099795_10050217 3300007788 Bacteria 1516
108 Ga0099795_10056118 3300007788 Bacteria 1448
109 Ga0105251_10001427 3300009011 Bacteria 20595
110 Ga0105251_10089530 3300009011 Bacteria 1415
111 Ga0105240_10039922 3300009093 Bacteria 6007
112 Ga0111539_10489313 3300009094 Bacteria 1433
113 Ga0111539_10723361 3300009094 Bacteria 1159
114 Ga0111539_10918518 3300009094 Bacteria 1018
115 Ga0105245_10203752 3300009098 Bacteria 1901
116 Ga0105245_10647589 3300009098 Bacteria 1087
117 Ga0114129_10056121 3300009147 Bacteria 5518
118 Ga0114129_10167612 3300009147 Bacteria 2996
119 Ga0114129_10331987 3300009147 Bacteria 2019
120 Ga0105243_10585337 3300009148 Bacteria 1072
121 Ga0105242_10073089 3300009176 Bacteria 2850
122 Ga0105248_10010338 3300009177 Bacteria 10271
123 Ga0105248_10593054 3300009177 Bacteria 1250
124 Ga0105248_10618087 3300009177 Bacteria 1222
125 Ga0105237_10003419 3300009545 Bacteria 18876
126 Ga0105237_10404501 3300009545 Bacteria 1370
127 Ga0105238_10377481 3300009551 Bacteria 1409
128 Ga0099796_10010075 3300010159 Bacteria 2584
129 Ga0099796_10054209 3300010159 Bacteria 1401
130 Ga0105239_10248539 3300010375 Bacteria 1998
131 Ga0157378_10070885 3300013297 Bacteria 3129
132 Ga0157378_10258693 3300013297 Bacteria 1669
133 Ga0157378_10281431 3300013297 Bacteria 1603
134 Ga0163162_10019574 3300013306 Bacteria 6644
135 Ga0163162_10343878 3300013306 Bacteria 1624
136 Ga0163162_10732429 3300013306 Bacteria 1109
137 Ga0157375_10616943 3300013308 Bacteria 1243
138 Ga0157380_10314250 3300014326 Bacteria 1449
139 Ga0157379_10102287 3300014968 Bacteria 2572
140 Ga0157376_10030855 3300014969 Bacteria 4285
141 Ga0163161_10124434 3300017792 Bacteria 1940
142 Ga0213872_10000910 3300021361 Bacteria 21167
143 Ga0213872_10016823 3300021361 Bacteria 3389
144 Ga0213872_10025288 3300021361 Bacteria 2730
145 Ga0213872_10027117 3300021361 Bacteria 2630
146 Ga0213872_10064005 3300021361 Bacteria 1661
147 Ga0213872_10065409 3300021361 Bacteria 1641
148 Ga0213872_10077216 3300021361 Bacteria 1497
149 Ga0228598_1006416 3300024227 Bacteria 2435
150 Ga0209674_100022 3300025226 Bacteria 563656
151 Ga0209672_100001 3300025228 Bacteria 2828210
152 Ga0209147_100001 3300025229 Bacteria 2384371
153 Ga0209147_100021 3300025229 Bacteria 464719
154 Ga0209563_102365 3300025230 Bacteria 4307
155 Ga0207427_101741 3300025231 Bacteria 7122
156 Ga0209258_100001 3300025242 Bacteria 2384269
157 Ga0209148_1000003 3300025254 Bacteria 2384288
158 Ga0209759_1000082 3300025256 Bacteria 169562
159 Ga0209759_1000097 3300025256 Bacteria 157627
160 Ga0209759_1000101 3300025256 Bacteria 155034
161 Ga0209233_1000061 3300025261 Bacteria 406211
162 Ga0209455_1000001 3300025272 Bacteria 2384278
163 Ga0209564_1019243 3300025295 Bacteria 2562
164 Ga0207426_1000215 3300025302 Bacteria 136757
165 Ga0207656_10017113 3300025321 Bacteria 2835
166 Ga0207655_1007094 3300025728 Bacteria 7320
167 Ga0207713_1024092 3300025735 Bacteria 2846
168 Ga0207653_10077582 3300025885 Bacteria 1145
169 Ga0207642_10065820 3300025899 Bacteria 1704
170 Ga0207685_10021413 3300025905 Bacteria 2166
171 Ga0207685_10082881 3300025905 Bacteria 1332
172 Ga0207645_10090926 3300025907 Bacteria 1963
173 Ga0207684_10018295 3300025910 Bacteria 5997
174 Ga0207684_10239207 3300025910 Bacteria 1566
175 Ga0207695_10011702 3300025913 Bacteria 10602
176 Ga0207695_10095531 3300025913 Bacteria 2976
177 Ga0207695_10374541 3300025913 Bacteria 1310
178 Ga0207671_10003470 3300025914 Bacteria 15686
179 Ga0207693_10001311 3300025915 Bacteria 22068
180 Ga0207693_10011178 3300025915 Bacteria 7268
181 Ga0207693_10028001 3300025915 Bacteria 4454
182 Ga0207693_10053864 3300025915 Bacteria 3157
183 Ga0207693_10090378 3300025915 Bacteria 2400
184 Ga0207693_10277744 3300025915 Bacteria 1313
185 Ga0207646_10010524 3300025922 Bacteria 9027
186 Ga0207646_10012321 3300025922 Bacteria 8223
187 Ga0207646_10165865 3300025922 Bacteria 1994
188 Ga0207646_10234687 3300025922 Bacteria 1657
189 Ga0207659_10082451 3300025926 Bacteria 2381
190 Ga0207664_10088963 3300025929 Bacteria 2528
191 Ga0207664_10198214 3300025929 Bacteria 1732
192 Ga0207706_10034210 3300025933 Bacteria 4521
193 Ga0207669_10188931 3300025937 Bacteria 1484
194 Ga0207665_10016434 3300025939 Bacteria 4858
195 Ga0207665_10032366 3300025939 Bacteria 3462
196 Ga0207665_10045460 3300025939 Bacteria 2940
197 Ga0207665_10046474 3300025939 Bacteria 2908
198 Ga0207665_10262967 3300025939 Bacteria 1279
199 Ga0207711_10024147 3300025941 Bacteria 5088
200 Ga0207711_10328457 3300025941 Bacteria 1414
201 Ga0207689_10094808 3300025942 Bacteria 2451
202 Ga0207689_10151659 3300025942 Bacteria 1910
203 Ga0207668_10000257 3300025972 Bacteria 35322
204 Ga0207668_10129538 3300025972 Bacteria 1924
205 Ga0207703_10207624 3300026035 Bacteria 1744
206 Ga0207678_10417730 3300026067 Bacteria 1163
207 Ga0207708_10130491 3300026075 Bacteria 1964
208 Ga0207641_10283823 3300026088 Bacteria 1558
209 Ga0207674_10334616 3300026116 Bacteria 1464
210 Ga0209179_1007505 3300027512 Bacteria 1804
211 Ga0209179_1024042 3300027512 Bacteria 1207
212 Ga0209588_1000435 3300027671 Bacteria 10726
213 Ga0209588_1011393 3300027671 Bacteria 2685
214 Ga0209588_1011749 3300027671 Bacteria 2650
215 Ga0209588_1012749 3300027671 Bacteria 2556
216 Ga0209588_1017679 3300027671 Bacteria 2212
217 Ga0209588_1028252 3300027671 Bacteria 1785
218 Ga0209588_1044358 3300027671 Bacteria 1438
219 Ga0209588_1048312 3300027671 Bacteria 1377
220 Ga0207428_10041871 3300027907 Bacteria 3706
221 Ga0268265_10071394 3300028380 Bacteria 2704
222 Ga0268264_10000642 3300028381 Bacteria 41302
223 Ga0307517_10132139 3300028786 Bacteria 1792
224 Ga0307515_10052334 3300028794 Bacteria 6058
225 Ga0265760_10088276 3300031090 Bacteria 968
226 Ga0265327_10000776 3300031251 Bacteria 49288
227 Ga0265327_10006581 3300031251 Bacteria 9235
228 Ga0307513_10148199 3300031456 Unclassified 2261
229 Ga0307408_100002870 3300031548 Bacteria 11937
230 Ga0265314_10024135 3300031711 Bacteria 4618
231 Ga0307510_10008632 3300033180 Bacteria 12144
232 Ga0373948_0008171 3300034817 Bacteria 1777
233 Ga0373951_0025395 3300035091 Bacteria 1376
234 Ga0373952_0004250 3300035092 Bacteria 2590
235 Ga0373939_0018537 3300035114 Bacteria 1866
236 Ga0373943_0137827 3300035170 Bacteria 1312
237 Ga0373931_0003658 3300035691 Bacteria 6951
238 Ga0373935_0258187 3300035692 Bacteria 1221
239 Ga0373927_0027052 3300035695 Bacteria 3748
240 Ga0373927_0301442 3300035695 Bacteria 1054
241 Ga0373947_0021113 3300035725 Bacteria 3767
242 Ga0373925_0376529 3300037068 Bacteria 1155
243 Ga0436361_0020532 3300039447 Bacteria 44080
244 Ga0436361_0029438 3300039447 Bacteria 10221
245 Ga0436361_0093516 3300039447 Bacteria 1420
246 Ga0436361_0296376 3300039447 Bacteria 2655
247 Ga0436361_0298003 3300039447 Bacteria 15847
248 Ga0436361_0326225 3300039447 Bacteria 5067
249 Ga0436361_0530782 3300039447 Bacteria 6456
250 Ga0436361_0545213 3300039447 Bacteria 2122
251 Ga0436361_1062103 3300039447 Bacteria 1800
252 Ga0436361_1109977 3300039447 Bacteria 2514
253 Ga0453683_0023760 3300044673 Bacteria 3905
254 Ga0495617_001570 3300046452 Bacteria 9879
255 Ga0495590_0014308 3300046457 Bacteria 2897
256 Ga0495590_0066287 3300046457 Bacteria 1264
257 Ga0495653_0005512 3300046463 Bacteria 10308
258 Ga0495653_0239578 3300046463 Bacteria 1210
259 Ga0495580_0008442 3300046472 Bacteria 8194
260 Ga0495580_0397401 3300046472 Bacteria 930
261 Ga0495605_0013923 3300046474 Unclassified 4418
262 Ga0495605_0026565 3300046474 Bacteria 3008
263 Ga0495605_0029885 3300046474 Bacteria 2798
264 Ga0495584_0053808 3300046491 Bacteria 2026
265 Ga0495585_0001103 3300046492 Bacteria 22231
266 Ga0495607_0019132 3300046501 Bacteria 4354
267 Ga0495583_0000005 3300046506 Bacteria 636894
268 Ga0495583_0004547 3300046506 Bacteria 9865
269 Ga0495583_0015927 3300046506 Bacteria 4065
270 Ga0495583_0058514 3300046506 Bacteria 1730
271 Ga0495606_0000409 3300046507 Bacteria 72543
272 Ga0495606_0001267 3300046507 Bacteria 35115
273 Ga0495606_0039628 3300046507 Bacteria 3172
274 Ga0495616_0007389 3300046513 Bacteria 6573
275 Ga0495616_0025680 3300046513 Bacteria 3144
276 Ga0495630_0001745 3300046517 Bacteria 15181
277 Ga0495631_0006184 3300046518 Bacteria 6202
278 Ga0495631_0091429 3300046518 Bacteria 1310
279 Ga0495632_0134241 3300046519 Bacteria 1150
280 Ga0495648_0008962 3300046524 Bacteria 7815
281 Ga0495648_0029200 3300046524 Bacteria 3663
282 Ga0495648_0171423 3300046524 Bacteria 1112
283 Ga0495666_0093396 3300046526 Bacteria 1419
284 Ga0495642_0000614 3300046528 Bacteria 17935
285 Ga0495642_0008131 3300046528 Bacteria 4015
286 Ga0495642_0098658 3300046528 Bacteria 1242
287 Ga0495652_0002141 3300046529 Bacteria 20814
288 Ga0495654_0045078 3300046530 Bacteria 2177
289 Ga0495665_0000898 3300046531 Bacteria 15647
290 Ga0495586_0190252 3300046535 Bacteria 1162
291 Ga0495587_0038295 3300046536 Bacteria 2876
292 Ga0495609_0000318 3300046538 Bacteria 43149
293 Ga0495656_0086446 3300046615 Bacteria 1426
294 Ga0495668_0001366 3300046616 Bacteria 23914
295 Ga0495668_0010239 3300046616 Bacteria 5691
296 Ga0495668_0204619 3300046616 Bacteria 1081
297 Ga0495668_0261011 3300046616 Bacteria 948
298 Ga0495634_0208210 3300046642 Bacteria 1212
299 Ga0495611_0018915 3300046648 Bacteria 2956
300 Ga0495611_0044257 3300046648 Bacteria 1991
301 Ga0495625_0012262 3300046660 Bacteria 6951
302 Ga0495625_0033148 3300046660 Bacteria 3822
303 Ga0495625_0188136 3300046660 Bacteria 1369
304 Ga0495635_0005151 3300046663 Bacteria 9103
305 Ga0495635_0411962 3300046663 Unclassified 897
306 Ga0495659_0004339 3300046664 Bacteria 4463
307 Ga0495657_0191191 3300046675 Bacteria 1251
308 Ga0495599_0070701 3300046678 Bacteria 2178
309 Ga0495623_0000953 3300046679 Bacteria 19514
310 Ga0495646_0002066 3300046680 Bacteria 12176
311 Ga0495669_0004781 3300046684 Bacteria 5619
312 Ga0495624_0000522 3300046690 Bacteria 30099
313 Ga0495670_0009718 3300046691 Bacteria 4727
314 Ga0495670_0127312 3300046691 Bacteria 1326
315 Ga0495671_0006501 3300046692 Bacteria 6747
316 Ga0495671_0147212 3300046692 Bacteria 1147
317 Ga0495649_0022581 3300046694 Bacteria 3520
318 Ga0495600_0136658 3300046809 Bacteria 1592
319 Ga0495660_0001339 3300046810 Bacteria 16963
320 Ga0495604_0012060 3300047317 Bacteria 6872
321 Ga0495604_0028118 3300047317 Bacteria 4473
322 Ga0495604_0033951 3300047317 Bacteria 4036
323 Ga0495636_0120165 3300047318 Bacteria 1162
324 Ga0495674_0011202 3300047319 Bacteria 8468
325 Ga0495672_0003345 3300047320 Bacteria 13817
326 Ga0495672_0015871 3300047320 Bacteria 5099
327 Ga0495672_0030565 3300047320 Bacteria 3376
328 Ga0495680_0001635 3300047322 Bacteria 23829
329 Ga0495680_0106434 3300047322 Bacteria 2084
330 Ga0495683_0064869 3300047323 Bacteria 1802
331 Ga0495687_005564 3300047443 Bacteria 7985
332 Ga0495675_0032387 3300047444 Bacteria 3336
333 Ga0495677_0010421 3300047445 Bacteria 3414
334 Ga0495677_0012891 3300047445 Bacteria 3044
335 Ga0495673_0005404 3300047469 Bacteria 7733
336 Ga0495673_0005808 3300047469 Bacteria 7382
337 Ga0495673_0006862 3300047469 Bacteria 6636
338 Ga0495673_0032792 3300047469 Unclassified 2417
339 Ga0495686_0000162 3300047472 Bacteria 126699
340 Ga0495602_0002334 3300048088 Bacteria 19195
341 Ga0495602_0204368 3300048088 Bacteria 1504
342 Ga0495626_0009005 3300048091 Bacteria 5412
343 Ga0495626_0027316 3300048091 Bacteria 2776
344 Ga0496100_0107512 3300048903 Bacteria 1932
345 Ga0496100_0283604 3300048903 Bacteria 1235
346 Ga0496101_0341169 3300048904 Bacteria 1177
347 Ga0496102_0001539 3300048905 Bacteria 20355
348 Ga0496103_0000371 3300048906 Bacteria 40307
349 Ga0496104_0023369 3300048907 Bacteria 5683
350 Ga0496105_0088836 3300048908 Bacteria 2553
351 Ga0496105_0210044 3300048908 Bacteria 1587
352 Ga0496106_0204756 3300048909 Bacteria 1571
353 Ga0496106_0333554 3300048909 Bacteria 1218
354 Ga0496106_0333803 3300048909 Bacteria 1217
355 Ga0496110_0446428 3300048913 Bacteria 1179
356 Ga0496112_0108823 3300048915 Bacteria 2742
357 Ga0496112_0115704 3300048915 Bacteria 2652
358 Ga0496117_0002705 3300048920 Bacteria 21898
359 Ga0496117_0006550 3300048920 Bacteria 11723
360 Ga0496117_0142734 3300048920 Bacteria 1431
361 Ga0496118_0000698 3300048921 Bacteria 54435
362 Ga0496118_0004083 3300048921 Bacteria 17705
363 Ga0496121_0000021 3300048924 Bacteria 478544
364 Ga0496121_0001198 3300048924 Bacteria 45422
365 Ga0496121_0001778 3300048924 Bacteria 34958
366 Ga0496121_0003399 3300048924 Bacteria 22766
367 Ga0496121_0010421 3300048924 Bacteria 10487
368 Ga0496122_0039884 3300048925 Bacteria 3739
369 Ga0496124_0108698 3300048927 Bacteria 2236
370 Ga0496124_0205114 3300048927 Bacteria 1496
371 Ga0496126_0001141 3300048929 Bacteria 44182
372 Ga0496126_0001647 3300048929 Bacteria 33697
373 Ga0496126_0001679 3300048929 Bacteria 33125
374 Ga0496126_0134723 3300048929 Bacteria 2132
375 Ga0496126_0448109 3300048929 Bacteria 1039
376 Ga0495678_023494 3300049459 Bacteria 2678
377 Ga0495682_0002622 3300049460 Bacteria 8418
378 Ga0495682_0003355 3300049460 Bacteria 7146
379 Ga0495682_0044301 3300049460 Bacteria 1628
380 Ga0501067_0077564 3300049583 Bacteria 1841
381 nmdc:mga0yw44_20130_c1 3300050492 Bacteria 3697
382 nmdc:mga05p37_1017_c1 3300050507 Bacteria 31916
383 nmdc:mga05p37_156898_c1 3300050507 Bacteria 2781
384 nmdc:mga05p37_21325_c1 3300050507 Bacteria 7843
385 nmdc:mga05p37_324324_c1 3300050507 Bacteria 1822
386 nmdc:mga05p37_392247_c1 3300050507 Bacteria 1623
387 nmdc:mga05p37_552074_c1 3300050507 Bacteria 1311
388 nmdc:mga05p37_84292_c1 3300050507 Bacteria 3916
389 nmdc:mga09592_371540_c1 3300050508 Bacteria 1237
390 nmdc:mga0qj67_3704_c1 3300050509 Bacteria 11031
391 nmdc:mga0qj67_432656_c1 3300050509 Bacteria 1061
392 nmdc:mga06r32_1053_c1 3300050510 Bacteria 24905
393 nmdc:mga06r32_324276_c1 3300050510 Bacteria 1525
394 nmdc:mga08y16_220852_c1 3300050511 Bacteria 1962
395 nmdc:mga08y16_741355_c1 3300050511 Bacteria 979
396 nmdc:mga08y16_76079_c1 3300050511 Bacteria 3499
397 nmdc:mga0n895_287843_c1 3300050512 Bacteria 1666
398 nmdc:mga0n895_339909_c1 3300050512 Bacteria 1520
399 nmdc:mga0n895_86991_c1 3300050512 Bacteria 3122
400 nmdc:mga0rr50_154904_c1 3300050513 Bacteria 1855
401 nmdc:mga0rr50_93557_c1 3300050513 Bacteria 2345
402 nmdc:mga08x19_230131_c1 3300050514 Bacteria 1276
403 nmdc:mga0a205_122358_c1 3300050515 Bacteria 2502
404 nmdc:mga0a205_39090_c1 3300050515 Bacteria 4566
405 nmdc:mga0a205_65414_c1 3300050515 Bacteria 3513
406 nmdc:mga0a205_77225_c1 3300050515 Bacteria 3218
407 Ga0500610_0091567 3300053079 Unclassified 1579
408 Ga0500578_0091681 3300053086 Bacteria 1928
409 Ga0500644_0018688 3300053088 Bacteria 2035
410 Ga0500583_0005010 3300053092 Unclassified 4390
411 Ga0500651_0071350 3300053093 Bacteria 2161
412 Ga0500557_057401 3300053105 Bacteria 1259
413 Ga0500618_000306 3300053125 Bacteria 36367
414 Ga0500658_0010993 3300053134 Bacteria 3337
415 Ga0500577_0100824 3300053142 Bacteria 1180
416 Ga0500645_001535 3300053730 Bacteria 11537
417 Ga0500645_001875 3300053730 Bacteria 10051
418 2501407788 2501025504 Bacteria 8008976
419 2501407804 2501025504 Bacteria 8008976
420 2511097665 2510917014 Bacteria 8296963
421 2511097680 2510917014 Bacteria 8296963
422 2511322330 2511231015 Bacteria 6598026
423 2513558199 2513237082 Bacteria 8640282
424 2513671844 2513237098 Bacteria 9902361
425 2563065062 2562617112 Bacteria 10918404
426 2713481950 2711768613 Bacteria 11048459
427 2819587225 2818991444 Bacteria 6968812
428 2842326980 2842324504 Bacteria 9364110
429 2842350585 2842348783 Bacteria 9002918
430 2852390642 2852387548 Bacteria 8025568
431 2883091765 2883087390 Bacteria 9532701
432 2885272700 2885270888 Bacteria 9831543
433 2904485506 2904483920 Bacteria 7545285
434 2909399565 2909399089 Bacteria 3922598
435 2919406403 2919404418 Bacteria 4232372
436 2921645194 2921643360 Bacteria 11448031
437 2928043144 2928037797 Bacteria 7273642
438 2928050197 2928044640 Bacteria 7271509
439 2928070600 2928064002 Bacteria 7419480
440 2937827978 2937822353 Bacteria 7290551
441 642615224 642555113 Bacteria 8214658
442 642617684 642555113 Bacteria 8214658
443 8046768989 8046767195 Bacteria 7547379
444 8055304903 8055301274 Bacteria 8587385
445 8057582469 8057575449 Bacteria 7367519
446 Ga0070697_100004166
447 JGI25156J39149_1000295
448 JGI25156J39149_1001000
449 JGI25165J46597_1001890
450 rootH1_10097004
451 rootH2_10049941
452 rootH2_10159984
453 rootL2_10125244
454 rootH1_10101817
455 rootH1_10133041
456 rootH1_10183558
457 JGI25160J50197_1000208
458 Ga0055533_1000095
459 Ga0055532_1000010
460 Ga0055532_1000254
461 Ga0055527_1000008
462 Ga0055535_1000007
463 Ga0055542_1000011
464 Ga0055529_1000009
465 Ga0065165_1000119
466 Ga0065704_10025481
467 Ga0065704_10194441
468 Ga0068868_100449181
469 Ga0070661_100236917
470 Ga0070668_100000214
471 Ga0070668_100148575
472 Ga0070675_100106735
473 Ga0070675_100377323
474 Ga0070674_100209435
475 Ga0070667_100620870
476 Ga0070703_10015819
477 Ga0070714_100468203
478 Ga0070713_100016740
479 Ga0070710_10097381
480 Ga0070711_100055892
481 Ga0070711_100334830
482 Ga0070708_100059309
483 Ga0070708_100068258
484 Ga0070708_100122166
485 Ga0070708_100153633
486 Ga0070708_100182581
487 Ga0070663_100242703
488 Ga0070678_100183973
489 Ga0070706_100042357
490 Ga0070706_100063198
491 Ga0070706_100125477
492 Ga0070707_100080333
493 Ga0070707_100573581
494 Ga0070707_100775356
495 Ga0070698_100096179
496 Ga0070698_100523879
497 Ga0070699_100038630
498 Ga0070699_100085777
499 Ga0070697_100077083
500 Ga0070697_100258485
501 Ga0070697_100434790
502 Ga0070665_100178580
503 Ga0070704_100101758
504 Ga0068852_100487354
505 Ga0068864_100545833
506 Ga0068851_10027294
507 Ga0068863_100060278
508 Ga0068860_100000019
509 Ga0068860_100000458
510 Ga0068862_100325729
511 Ga0070717_10139332
512 Ga0070717_10156530
513 Ga0075365_10029914
514 Ga0070716_100074717
515 Ga0070716_100142153
516 Ga0070712_100001682
517 Ga0070712_100043812
518 Ga0068871_100014326
519 Ga0068871_100250778
520 Ga0075428_100049896
521 Ga0075428_100057837
522 Ga0075428_100565928
523 Ga0075430_100187366
524 Ga0075431_100052464
525 Ga0075431_100167791
526 Ga0075433_10021593
527 Ga0075433_10178630
528 Ga0075434_100068985
529 Ga0075434_100087950
530 Ga0075434_100113262
531 Ga0075434_100480508
532 Ga0075434_100688990
533 Ga0075436_100048207
534 Ga0075436_100157576
535 Ga0075435_100114912
536 Ga0075435_100284653
537 Ga0075435_100379115
538 Ga0075435_100415802
539 Ga0075435_100532574
540 Ga0099794_10001943
541 Ga0099794_10005352
542 Ga0099794_10016812
543 Ga0099794_10043256
544 Ga0099794_10048316
545 Ga0099794_10080991
546 Ga0099794_10085795
547 Ga0099794_10101922
548 Ga0099794_10124302
549 Ga0099795_10003046
550 Ga0099795_10014412
551 Ga0099795_10049921
552 Ga0099795_10050217
553 Ga0099795_10056118
554 Ga0105251_10001427
555 Ga0105251_10089530
556 Ga0105240_10039922
557 Ga0111539_10489313
558 Ga0111539_10723361
559 Ga0111539_10918518
560 Ga0105245_10203752
561 Ga0105245_10647589
562 Ga0114129_10056121
563 Ga0114129_10167612
564 Ga0114129_10331987
565 Ga0105243_10585337
566 Ga0105242_10073089
567 Ga0105248_10010338
568 Ga0105248_10593054
569 Ga0105248_10618087
570 Ga0105237_10003419
571 Ga0105237_10404501
572 Ga0105238_10377481
573 Ga0099796_10010075
574 Ga0099796_10054209
575 Ga0105239_10248539
576 Ga0157378_10070885
577 Ga0157378_10258693
578 Ga0157378_10281431
579 Ga0163162_10019574
580 Ga0163162_10343878
581 Ga0163162_10732429
582 Ga0157375_10616943
583 Ga0157380_10314250
584 Ga0157379_10102287
585 Ga0157376_10030855
586 Ga0163161_10124434
587 Ga0213872_10000910
588 Ga0213872_10016823
589 Ga0213872_10025288
590 Ga0213872_10027117
591 Ga0213872_10064005
592 Ga0213872_10065409
593 Ga0213872_10077216
594 Ga0228598_1006416
595 Ga0209674_100022
596 Ga0209672_100001
597 Ga0209147_100001
598 Ga0209147_100021
599 Ga0209563_102365
600 Ga0207427_101741
601 Ga0209258_100001
602 Ga0209148_1000003
603 Ga0209759_1000082
604 Ga0209759_1000097
605 Ga0209759_1000101
606 Ga0209233_1000061
607 Ga0209455_1000001
608 Ga0209564_1019243
609 Ga0207426_1000215
610 Ga0207656_10017113
611 Ga0207655_1007094
612 Ga0207713_1024092
613 Ga0207653_10077582
614 Ga0207642_10065820
615 Ga0207685_10021413
616 Ga0207685_10082881
617 Ga0207645_10090926
618 Ga0207684_10018295
619 Ga0207684_10239207
620 Ga0207695_10011702
621 Ga0207695_10095531
622 Ga0207695_10374541
623 Ga0207671_10003470
624 Ga0207693_10001311
625 Ga0207693_10011178
626 Ga0207693_10028001
627 Ga0207693_10053864
628 Ga0207693_10090378
629 Ga0207693_10277744
630 Ga0207646_10010524
631 Ga0207646_10012321
632 Ga0207646_10165865
633 Ga0207646_10234687
634 Ga0207659_10082451
635 Ga0207664_10088963
636 Ga0207664_10198214
637 Ga0207706_10034210
638 Ga0207669_10188931
639 Ga0207665_10016434
640 Ga0207665_10032366
641 Ga0207665_10045460
642 Ga0207665_10046474
643 Ga0207665_10262967
644 Ga0207711_10024147
645 Ga0207711_10328457
646 Ga0207689_10094808
647 Ga0207689_10151659
648 Ga0207668_10000257
649 Ga0207668_10129538
650 Ga0207703_10207624
651 Ga0207678_10417730
652 Ga0207708_10130491
653 Ga0207641_10283823
654 Ga0207674_10334616
655 Ga0209179_1007505
656 Ga0209179_1024042
657 Ga0209588_1000435
658 Ga0209588_1011393
659 Ga0209588_1011749
660 Ga0209588_1012749
661 Ga0209588_1017679
662 Ga0209588_1028252
663 Ga0209588_1044358
664 Ga0209588_1048312
665 Ga0207428_10041871
666 Ga0268265_10071394
667 Ga0268264_10000642
668 Ga0307517_10132139
669 Ga0307515_10052334
670 Ga0265760_10088276
671 Ga0265327_10000776
672 Ga0265327_10006581
673 Ga0307513_10148199
674 Ga0307408_100002870
675 Ga0265314_10024135
676 Ga0307510_10008632
677 Ga0373948_0008171
678 Ga0373951_0025395
679 Ga0373952_0004250
680 Ga0373939_0018537
681 Ga0373943_0137827
682 Ga0373931_0003658
683 Ga0373935_0258187
684 Ga0373927_0027052
685 Ga0373927_0301442
686 Ga0373947_0021113
687 Ga0373925_0376529
688 Ga0436361_0020532
689 Ga0436361_0029438
690 Ga0436361_0093516
691 Ga0436361_0296376
692 Ga0436361_0298003
693 Ga0436361_0326225
694 Ga0436361_0530782
695 Ga0436361_0545213
696 Ga0436361_1062103
697 Ga0436361_1109977
698 Ga0453683_0023760
699 Ga0495617_001570
700 Ga0495590_0014308
701 Ga0495590_0066287
702 Ga0495653_0005512
703 Ga0495653_0239578
704 Ga0495580_0008442
705 Ga0495580_0397401
706 Ga0495605_0013923
707 Ga0495605_0026565
708 Ga0495605_0029885
709 Ga0495584_0053808
710 Ga0495585_0001103
711 Ga0495607_0019132
712 Ga0495583_0000005
713 Ga0495583_0004547
714 Ga0495583_0015927
715 Ga0495583_0058514
716 Ga0495606_0000409
717 Ga0495606_0001267
718 Ga0495606_0039628
719 Ga0495616_0007389
720 Ga0495616_0025680
721 Ga0495630_0001745
722 Ga0495631_0006184
723 Ga0495631_0091429
724 Ga0495632_0134241
725 Ga0495648_0008962
726 Ga0495648_0029200
727 Ga0495648_0171423
728 Ga0495666_0093396
729 Ga0495642_0000614
730 Ga0495642_0008131
731 Ga0495642_0098658
732 Ga0495652_0002141
733 Ga0495654_0045078
734 Ga0495665_0000898
735 Ga0495586_0190252
736 Ga0495587_0038295
737 Ga0495609_0000318
738 Ga0495656_0086446
739 Ga0495668_0001366
740 Ga0495668_0010239
741 Ga0495668_0204619
742 Ga0495668_0261011
743 Ga0495634_0208210
744 Ga0495611_0018915
745 Ga0495611_0044257
746 Ga0495625_0012262
747 Ga0495625_0033148
748 Ga0495625_0188136
749 Ga0495635_0005151
750 Ga0495635_0411962
751 Ga0495659_0004339
752 Ga0495657_0191191
753 Ga0495599_0070701
754 Ga0495623_0000953
755 Ga0495646_0002066
756 Ga0495669_0004781
757 Ga0495624_0000522
758 Ga0495670_0009718
759 Ga0495670_0127312
760 Ga0495671_0006501
761 Ga0495671_0147212
762 Ga0495649_0022581
763 Ga0495600_0136658
764 Ga0495660_0001339
765 Ga0495604_0012060
766 Ga0495604_0028118
767 Ga0495604_0033951
768 Ga0495636_0120165
769 Ga0495674_0011202
770 Ga0495672_0003345
771 Ga0495672_0015871
772 Ga0495672_0030565
773 Ga0495680_0001635
774 Ga0495680_0106434
775 Ga0495683_0064869
776 Ga0495687_005564
777 Ga0495675_0032387
778 Ga0495677_0010421
779 Ga0495677_0012891
780 Ga0495673_0005404
781 Ga0495673_0005808
782 Ga0495673_0006862
783 Ga0495673_0032792
784 Ga0495686_0000162
785 Ga0495602_0002334
786 Ga0495602_0204368
787 Ga0495626_0009005
788 Ga0495626_0027316
789 Ga0496100_0107512
790 Ga0496100_0283604
791 Ga0496101_0341169
792 Ga0496102_0001539
793 Ga0496103_0000371
794 Ga0496104_0023369
795 Ga0496105_0088836
796 Ga0496105_0210044
797 Ga0496106_0204756
798 Ga0496106_0333554
799 Ga0496106_0333803
800 Ga0496110_0446428
801 Ga0496112_0108823
802 Ga0496112_0115704
803 Ga0496117_0002705
804 Ga0496117_0006550
805 Ga0496117_0142734
806 Ga0496118_0000698
807 Ga0496118_0004083
808 Ga0496121_0000021
809 Ga0496121_0001198
810 Ga0496121_0001778
811 Ga0496121_0003399
812 Ga0496121_0010421
813 Ga0496122_0039884
814 Ga0496124_0108698
815 Ga0496124_0205114
816 Ga0496126_0001141
817 Ga0496126_0001647
818 Ga0496126_0001679
819 Ga0496126_0134723
820 Ga0496126_0448109
821 Ga0495678_023494
822 Ga0495682_0002622
823 Ga0495682_0003355
824 Ga0495682_0044301
825 Ga0501067_0077564
826 nmdc:mga0yw44_20130_c1
827 nmdc:mga05p37_1017_c1
828 nmdc:mga05p37_156898_c1
829 nmdc:mga05p37_21325_c1
830 nmdc:mga05p37_324324_c1
831 nmdc:mga05p37_392247_c1
832 nmdc:mga05p37_552074_c1
833 nmdc:mga05p37_84292_c1
834 nmdc:mga09592_371540_c1
835 nmdc:mga0qj67_3704_c1
836 nmdc:mga0qj67_432656_c1
837 nmdc:mga06r32_1053_c1
838 nmdc:mga06r32_324276_c1
839 nmdc:mga08y16_220852_c1
840 nmdc:mga08y16_741355_c1
841 nmdc:mga08y16_76079_c1
842 nmdc:mga0n895_287843_c1
843 nmdc:mga0n895_339909_c1
844 nmdc:mga0n895_86991_c1
845 nmdc:mga0rr50_154904_c1
846 nmdc:mga0rr50_93557_c1
847 nmdc:mga08x19_230131_c1
848 nmdc:mga0a205_122358_c1
849 nmdc:mga0a205_39090_c1
850 nmdc:mga0a205_65414_c1
851 nmdc:mga0a205_77225_c1
852 Ga0500610_0091567
853 Ga0500578_0091681
854 Ga0500644_0018688
855 Ga0500583_0005010
856 Ga0500651_0071350
857 Ga0500557_057401
858 Ga0500618_000306
859 Ga0500658_0010993
860 Ga0500577_0100824
861 Ga0500645_001535
862 Ga0500645_001875
863 2501407788
864 2501407804
865 2511097665
866 2511097680
867 2511322330
868 2513558199
869 2513671844
870 2563065062
871 2713481950
872 2819587225
873 2842326980
874 2842350585
875 2852390642
876 2883091765
877 2885272700
878 2904485506
879 2909399565
880 2919406403
881 2921645194
882 2928043144
883 2928050197
884 2928070600
885 2937827978
886 642615224
887 642617684
888 8046768989
889 8055304903
890 8057582469

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

56

297

0.78

PF12146

Hydrolase_4

Serine aminopeptidase, S33

68

294

0.76

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

49

303

0.64

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pw0-assembly1.cif.gz_A-2 alpha/beta hydrolase fold protein from chitinophaga pinensis 0.9339 4 278
4pw0-assembly1.cif.gz_A-2 alpha/beta hydrolase fold protein from chitinophaga pinensis 0.9274 4 278
6eb3-assembly3.cif.gz_C structural and enzymatic characterization of an esterase from a metagenomic library 0.8892 12 277
6eb3-assembly1.cif.gz_A structural and enzymatic characterization of an esterase from a metagenomic library 0.8776 12 277
8b6n-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) 0.8716 9 127
ID Description Score Start End Superfamily
4pw0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9266 4 278 3.40.50.1820
af_O53327_8_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.922 4 276 3.40.50.1820
4pw0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9199 4 278 3.40.50.1820
af_Q4CQ94_14_186_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9011 19 130 3.40.50.12270
3bdiA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8521 9 276 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A6P2ZTK3-F1-model_v4 Alpha/beta hydrolase 0.9798 10 131 GO:0016787
AF-A0A2V5A7J7-F1-model_v4 deleted 0.9762 3 131
AF-A0A2P8G2C1-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.969 2 278
AF-A0A2P8G2C1-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.9622 2 278
AF-A0A0K2RDB7-F1-model_v4 Putative aminoacrylate hydrolase RutD 0.9597 2 138 GO:0016787

Map