F445678

General Info

Members Datasets Scaffolds Average Seq Length
446 277 892 907

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100009443|Ga0068855_1000094435
Length 1015
Sequence MDVTLSPQTEVNTMHHNGCASKAEAAATAPESRPTNLAMPDVESLLSKVYEFGYNYRYLSEWIFLRSAVPIHRRNSNLVRLPLRHLLRIKTIGFIACAVAGILPLRGQSHPAGRNARLAPMLDQGLVSYETPELRLRLVKSSGTVAGLEPRTQGTQGPDDFDFTPAELLAARSADGYYHLGDLDLRLRATGETDWHGYSSALERHPVSSLPPGPGELVRDDLKPTFPAGFPLLVTRVWAVANGNLVLRFILKNPGPRPIEIGALGIPLIFDNILSGKSLAEAHQVCSFSDPSIALDAGYVQVTRLNGHGPALVVIPDNNTPFEAYNPIPGPHGRGAHTQTLFEDRTPRNMTFEGFYEWMVASAAYQQNEWKRAQPWNLATSIVLQPGEERTVGLRLLVSDSIRDIEKTLIENGRPVAVGIPGYILPQDVEGSLFLKYGRPVKDLKIEPAGAIELRRVGNTQHGWTRYTVKGITWGRARLTITYADDLKETVQYRVIKPETTVMDDLGRFLFTKQWFDAVDDPFHRAPSVMSYDREANAIVTQDSRVWIAGLSDEAGAGSWLAAAMKEYGRPDKQQVEKLEQFVDGVLWGHLQFANGPKKYGVRKSLFYYEPDKLPAGYYRKDFDWSSXXXXNQEASEDVGRSFNYPHVVSAYWALYRLARDHQGLVTHHDWKWYLTQAYETSMAMTRYAHDLAQFGQMEGDIFVAVLDDLHREGMTSEASMLEASMRARADVWQKEQYPFGSEMPWDSTGQEEVYAWTTRFGMKDKAQVTLDAITGYMPAIPNWGYNGSARRYWDFLYGGKVQRLERQLHHYGSGINAIPVLDAYRRDPQDFYLLRIGYGGTMGAISGIDQDGFASAAFHSYPDRMSFDPYSGDYGPNFFGHAWTTATYVVKDPEFGWLAFGGNLKVEGNQVKIDPRDSFRQRIFVAPLAMWVTLDSGRLDQVTFDSVTNTVEVHLAPGDAFTSSALVRMEQTARIDGIGDLVPKETFAVERGAWVVPLASSGATLHFIMRPHSH

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
93 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
94 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
95 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
96 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
97 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
98 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
147 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
148 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
149 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
152 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
153 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
154 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
155 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
158 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
177 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
178 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
179 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
183 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
184 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
187 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
188 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
189 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
190 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
191 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
192 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
197 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
198 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
199 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
200 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
201 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
206 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
207 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
208 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
215 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
216 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
217 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
218 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
219 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
220 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
223 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
224 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
225 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
235 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
236 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
237 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
238 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
239 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
240 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
241 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
242 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
243 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
244 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
245 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
246 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
247 2643221584 Caulobacter sp. Root656 Isolate Unclassified
248 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
249 2738541283 Pedobacter sp. OK701 Isolate Unclassified
250 2738541297 Duganella sp. GV083 Isolate Unclassified
251 2738541302 Pedobacter sp. CF074 Isolate Unclassified
252 2738541357 Duganella sp. GV053 Isolate Unclassified
253 2738543003 Duganella sp. GV066 Isolate Unclassified
254 2738543026 Duganella sp. GV089 Isolate Unclassified
255 2738543029 Duganella sp. GV039 Isolate Unclassified
256 2739367651 Pedobacter sp. OK291 Isolate Unclassified
257 2739367656 Pedobacter sp. CF523 Isolate Unclassified
258 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
259 2818991435 Caulobacter henricii 536 Isolate Unclassified
260 2818991437 Pedobacter terrae 518 Isolate Unclassified
261 2818991444 Filimonas endophytica 3197 Isolate Unclassified
262 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
263 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
264 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
265 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
266 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
267 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
268 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
269 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
270 2904424332 Duganella sp. 1411 Isolate Rhizosphere
271 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
272 2914759650 Rhizosphaericola mali Isolate Rhizosphere
273 2919476304 Duganella sp. 3397 Isolate Unclassified
274 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
275 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
276 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
277 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.93
Metatranscriptomes 0.45
Isolates 7.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.99
Nodule 0
Rhizoplane 0.22
Rhizosphere 81.61
Stem 0
Stem Tuber 0
Unclassified 2.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100009443 3300005563 Bacteria 11786
2 JGI24744J21845_10000711 3300002077 Bacteria 6137
3 JGI24751J29686_10000047 3300002459 Bacteria 72878
4 JGI25152J39213_1000131 3300002773 Bacteria 50658
5 JGI25150J39212_1000001 3300002774 Bacteria 1318726
6 JGI25150J39212_1000269 3300002774 Bacteria 27675
7 JGI25151J46595_10000005 3300003187 Bacteria 431598
8 JGI25153J46596_10000018 3300003215 Bacteria 269774
9 JGI25153J46596_10000091 3300003215 Bacteria 105614
10 rootH2_10049198 3300003320 Bacteria 19913
11 rootH1_10001218 3300003323 Bacteria 18122
12 Ga0055524_1000460 3300003775 Bacteria 33120
13 Ga0055536_1000052 3300003781 Bacteria 111581
14 Ga0055536_1000068 3300003781 Bacteria 96642
15 Ga0055530_10000043 3300003791 Bacteria 111112
16 Ga0055530_10000795 3300003791 Bacteria 26252
17 Ga0055540_1000791 3300003792 Bacteria 21420
18 Ga0055531_10000008 3300003794 Bacteria 222269
19 Ga0065165_1000880 3300005262 Bacteria 38796
20 Ga0065714_10064508 3300005288 Bacteria 46035
21 Ga0070658_10000041 3300005327 Bacteria 134208
22 Ga0070658_10013645 3300005327 Bacteria 6519
23 Ga0070676_10000590 3300005328 Bacteria 17587
24 Ga0070683_100004685 3300005329 Bacteria 11301
25 Ga0070683_100009033 3300005329 Bacteria 8505
26 Ga0070683_100039457 3300005329 Bacteria 4335
27 Ga0070683_100053491 3300005329 Bacteria 3741
28 Ga0070690_100002887 3300005330 Bacteria 9268
29 Ga0070670_100000188 3300005331 Bacteria 56512
30 Ga0070670_100015198 3300005331 Bacteria 6607
31 Ga0070670_100044270 3300005331 Bacteria 3827
32 Ga0068869_100004984 3300005334 Bacteria 8311
33 Ga0068869_100012991 3300005334 Bacteria 5524
34 Ga0068869_100019074 3300005334 Bacteria 4679
35 Ga0068868_100000995 3300005338 Bacteria 19323
36 Ga0068868_100016066 3300005338 Bacteria 5551
37 Ga0070687_100001013 3300005343 Bacteria 9574
38 Ga0070669_100029169 3300005353 Bacteria 3976
39 Ga0070671_100020566 3300005355 Bacteria 5384
40 Ga0070674_100006215 3300005356 Bacteria 6952
41 Ga0070673_100008207 3300005364 Bacteria 6931
42 Ga0070673_100035530 3300005364 Unclassified 3780
43 Ga0070659_100012388 3300005366 Bacteria 6324
44 Ga0070667_100011899 3300005367 Bacteria 7197
45 Ga0070667_100037773 3300005367 Bacteria 4049
46 Ga0070709_10032670 3300005434 Bacteria 3140
47 Ga0070714_100000027 3300005435 Bacteria 141750
48 Ga0070714_100021455 3300005435 Bacteria 5285
49 Ga0070714_100061656 3300005435 Unclassified 3222
50 Ga0070711_100005999 3300005439 Bacteria 7294
51 Ga0070700_100009963 3300005441 Bacteria 5230
52 Ga0070700_100011046 3300005441 Bacteria 4994
53 Ga0070694_100006559 3300005444 Bacteria 7069
54 Ga0070708_100002565 3300005445 Bacteria 14059
55 Ga0070708_100036439 3300005445 Bacteria 4290
56 Ga0070678_100001871 3300005456 Bacteria 11360
57 Ga0070678_100037553 3300005456 Bacteria 3402
58 Ga0070662_100000117 3300005457 Bacteria 44433
59 Ga0070681_10000149 3300005458 Bacteria 53023
60 Ga0070681_10027703 3300005458 Bacteria 5696
61 Ga0068867_100002414 3300005459 Bacteria 13134
62 Ga0068867_100004843 3300005459 Bacteria 9468
63 Ga0068867_100015463 3300005459 Bacteria 5412
64 Ga0070706_100000445 3300005467 Bacteria 49819
65 Ga0070707_100003781 3300005468 Bacteria 14276
66 Ga0070707_100067647 3300005468 Bacteria 3437
67 Ga0070698_100028693 3300005471 Bacteria 5777
68 Ga0070698_100028769 3300005471 Bacteria 5769
69 Ga0070699_100052179 3300005518 Bacteria 3540
70 Ga0070679_100009893 3300005530 Bacteria 9023
71 Ga0070684_100011315 3300005535 Bacteria 7103
72 Ga0070697_100000400 3300005536 Bacteria 33575
73 Ga0068853_100056672 3300005539 Unclassified 3381
74 Ga0070665_100000573 3300005548 Bacteria 51436
75 Ga0068855_100000234 3300005563 Bacteria 70713
76 Ga0068855_100001150 3300005563 Bacteria 32765
77 Ga0068855_100010081 3300005563 Bacteria 11387
78 Ga0068855_100010834 3300005563 Bacteria 11010
79 Ga0070664_100001824 3300005564 Bacteria 17055
80 Ga0068857_100029364 3300005577 Bacteria 4852
81 Ga0068856_100000062 3300005614 Bacteria 100769
82 Ga0068856_100000179 3300005614 Bacteria 66149
83 Ga0068856_100000854 3300005614 Bacteria 32765
84 Ga0070702_100001376 3300005615 Bacteria 9921
85 Ga0068852_100001251 3300005616 Bacteria 16924
86 Ga0068859_100001235 3300005617 Bacteria 26117
87 Ga0068859_100021703 3300005617 Bacteria 6443
88 Ga0068864_100000129 3300005618 Bacteria 73206
89 Ga0068864_100014292 3300005618 Bacteria 6594
90 Ga0068861_100001530 3300005719 Bacteria 14649
91 Ga0068863_100012440 3300005841 Bacteria 8217
92 Ga0068863_100030889 3300005841 Bacteria 5116
93 Ga0068863_100045976 3300005841 Bacteria 4143
94 Ga0068858_100006877 3300005842 Bacteria 11055
95 Ga0068858_100015922 3300005842 Bacteria 7064
96 Ga0068858_100022840 3300005842 Bacteria 5834
97 Ga0068858_100048386 3300005842 Unclassified 3941
98 Ga0068860_100018302 3300005843 Bacteria 6817
99 Ga0081455_10004244 3300005937 Bacteria 16165
100 Ga0097621_100000007 3300006237 Bacteria 131146
101 Ga0097621_100000148 3300006237 Bacteria 42932
102 Ga0097621_100000493 3300006237 Bacteria 27679
103 Ga0097621_100000980 3300006237 Bacteria 20023
104 Ga0097621_100007133 3300006237 Bacteria 7966
105 Ga0068871_100000024 3300006358 Bacteria 82027
106 Ga0068871_100000049 3300006358 Bacteria 65954
107 Ga0068871_100000465 3300006358 Bacteria 27859
108 Ga0068871_100001251 3300006358 Bacteria 16982
109 Ga0075433_10002828 3300006852 Bacteria 13280
110 Ga0075433_10004469 3300006852 Bacteria 10895
111 Ga0075434_100003010 3300006871 Bacteria 14990
112 Ga0075434_100006289 3300006871 Bacteria 10881
113 Ga0075434_100007721 3300006871 Bacteria 9958
114 Ga0068865_100002704 3300006881 Bacteria 10515
115 Ga0068865_100008068 3300006881 Bacteria 6500
116 Ga0097620_100001235 3300006931 Bacteria 26117
117 Ga0097620_100021704 3300006931 Bacteria 6443
118 Ga0105244_10006243 3300009036 Bacteria 7763
119 Ga0105240_10004970 3300009093 Bacteria 19979
120 Ga0105240_10023653 3300009093 Bacteria 8116
121 Ga0111539_10007520 3300009094 Bacteria 13938
122 Ga0111539_10009533 3300009094 Bacteria 12254
123 Ga0111539_10117976 3300009094 Bacteria 3110
124 Ga0105245_10021052 3300009098 Bacteria 5721
125 Ga0105241_10000093 3300009174 Bacteria 67365
126 Ga0105241_10011122 3300009174 Bacteria 6600
127 Ga0105242_10000031 3300009176 Bacteria 98776
128 Ga0105242_10004114 3300009176 Bacteria 11318
129 Ga0105242_10021661 3300009176 Bacteria 5048
130 Ga0105248_10000004 3300009177 Bacteria 695244
131 Ga0105248_10001713 3300009177 Bacteria 24377
132 Ga0105248_10033633 3300009177 Bacteria 5728
133 Ga0105248_10063522 3300009177 Bacteria 4145
134 Ga0105237_10000584 3300009545 Bacteria 50910
135 Ga0105237_10000956 3300009545 Bacteria 38876
136 Ga0105237_10004138 3300009545 Bacteria 16899
137 Ga0105237_10013714 3300009545 Bacteria 8489
138 Ga0105238_10000609 3300009551 Bacteria 37550
139 Ga0105238_10000674 3300009551 Bacteria 35862
140 Ga0105238_10052668 3300009551 Bacteria 4091
141 Ga0105239_10018467 3300010375 Bacteria 7703
142 Ga0105246_10009420 3300011119 Bacteria 6018
143 Ga0105246_10017016 3300011119 Bacteria 4617
144 Ga0157373_10027452 3300013100 Bacteria 4107
145 Ga0157371_10004915 3300013102 Bacteria 11485
146 Ga0157370_10000299 3300013104 Bacteria 62891
147 Ga0157370_10002139 3300013104 Bacteria 24135
148 Ga0157370_10019441 3300013104 Bacteria 6813
149 Ga0157370_10063718 3300013104 Bacteria 3491
150 Ga0157369_10000004 3300013105 Bacteria 479764
151 Ga0157369_10000159 3300013105 Bacteria 95759
152 Ga0157369_10002695 3300013105 Bacteria 21178
153 Ga0157369_10021406 3300013105 Bacteria 7233
154 Ga0157369_10045241 3300013105 Bacteria 4789
155 Ga0157369_10054426 3300013105 Unclassified 4322
156 Ga0157374_10000062 3300013296 Bacteria 112028
157 Ga0157374_10000338 3300013296 Bacteria 43326
158 Ga0157374_10000454 3300013296 Bacteria 37339
159 Ga0157374_10001775 3300013296 Bacteria 18142
160 Ga0157374_10003787 3300013296 Bacteria 12726
161 Ga0157374_10009739 3300013296 Bacteria 8251
162 Ga0157374_10015524 3300013296 Bacteria 6681
163 Ga0157378_10000009 3300013297 Bacteria 161557
164 Ga0157378_10000899 3300013297 Bacteria 27398
165 Ga0157378_10008955 3300013297 Bacteria 8714
166 Ga0157378_10012940 3300013297 Bacteria 7299
167 Ga0163162_10016000 3300013306 Bacteria 7332
168 Ga0157372_10000140 3300013307 Bacteria 79310
169 Ga0157372_10000845 3300013307 Bacteria 33235
170 Ga0157372_10003387 3300013307 Bacteria 17201
171 Ga0157372_10003675 3300013307 Bacteria 16495
172 Ga0157372_10012378 3300013307 Bacteria 9092
173 Ga0157372_10045344 3300013307 Bacteria 4876
174 Ga0157372_10050090 3300013307 Bacteria 4646
175 Ga0157375_10001938 3300013308 Bacteria 17823
176 Ga0157375_10052690 3300013308 Bacteria 4001
177 Ga0163163_10000319 3300014325 Bacteria 46719
178 Ga0157380_10012360 3300014326 Bacteria 6193
179 Ga0182008_10006929 3300014497 Bacteria 6290
180 Ga0157376_10001674 3300014969 Bacteria 14724
181 Ga0182006_1000091 3300015261 Bacteria 109227
182 Ga0182006_1000134 3300015261 Bacteria 80259
183 Ga0182007_10000006 3300015262 Bacteria 427355
184 Ga0183373_1001 3300015682 Bacteria 1410374
185 Ga0228598_1001865 3300024227 Bacteria 4585
186 Ga0207425_1000002 3300025245 Bacteria 1362590
187 Ga0207425_1000049 3300025245 Bacteria 180735
188 Ga0209129_1000002 3300025258 Bacteria 1359086
189 Ga0209129_1001071 3300025258 Bacteria 16144
190 Ga0209565_1000012 3300025263 Bacteria 606500
191 Ga0209673_1002074 3300025273 Bacteria 15075
192 Ga0209675_1008373 3300025291 Bacteria 3812
193 Ga0209676_1000090 3300025292 Bacteria 256336
194 Ga0209676_1002472 3300025292 Bacteria 13036
195 Ga0209025_1000004 3300025294 Bacteria 1361782
196 Ga0209025_1000068 3300025294 Bacteria 294129
197 Ga0209564_1002359 3300025295 Bacteria 15198
198 Ga0209758_1000006 3300025297 Bacteria 1359562
199 Ga0209758_1000019 3300025297 Bacteria 743682
200 Ga0209050_1000001 3300025298 Bacteria 3563507
201 Ga0209050_1000026 3300025298 Bacteria 499134
202 Ga0209050_1000091 3300025298 Bacteria 253049
203 Ga0209050_1000108 3300025298 Bacteria 222534
204 Ga0209256_1000012 3300025299 Bacteria 790371
205 Ga0209256_1010988 3300025299 Bacteria 3694
206 Ga0209051_1000239 3300025303 Bacteria 92575
207 Ga0209257_1000009 3300025304 Bacteria 1205047
208 Ga0209257_1001066 3300025304 Bacteria 36225
209 Ga0209257_1001071 3300025304 Bacteria 36088
210 Ga0209257_1001493 3300025304 Bacteria 27470
211 Ga0207655_1003226 3300025728 Bacteria 12257
212 Ga0207647_10000021 3300025904 Bacteria 121592
213 Ga0207647_10001641 3300025904 Bacteria 17211
214 Ga0207647_10001931 3300025904 Bacteria 15845
215 Ga0207647_10006464 3300025904 Bacteria 8519
216 Ga0207647_10029787 3300025904 Unclassified 3526
217 Ga0207645_10000091 3300025907 Bacteria 65333
218 Ga0207705_10000068 3300025909 Bacteria 134316
219 Ga0207705_10005013 3300025909 Bacteria 9933
220 Ga0207654_10000439 3300025911 Bacteria 23836
221 Ga0207707_10003039 3300025912 Bacteria 14910
222 Ga0207695_10012755 3300025913 Bacteria 10061
223 Ga0207695_10018305 3300025913 Bacteria 8104
224 Ga0207695_10067852 3300025913 Bacteria 3656
225 Ga0207671_10000520 3300025914 Bacteria 52097
226 Ga0207671_10001509 3300025914 Bacteria 26781
227 Ga0207671_10010301 3300025914 Bacteria 7726
228 Ga0207662_10006650 3300025918 Bacteria 6248
229 Ga0207694_10004080 3300025924 Bacteria 11483
230 Ga0207694_10018785 3300025924 Bacteria 5225
231 Ga0207694_10063001 3300025924 Bacteria 2888
232 Ga0207650_10000007 3300025925 Bacteria 530810
233 Ga0207664_10000098 3300025929 Bacteria 80444
234 Ga0207664_10017069 3300025929 Bacteria 5309
235 Ga0207644_10014401 3300025931 Bacteria 5291
236 Ga0207706_10000088 3300025933 Bacteria 94903
237 Ga0207686_10003171 3300025934 Bacteria 8850
238 Ga0207670_10004272 3300025936 Bacteria 7668
239 Ga0207669_10006856 3300025937 Bacteria 5238
240 Ga0207711_10000008 3300025941 Bacteria 597686
241 Ga0207711_10000010 3300025941 Bacteria 557970
242 Ga0207711_10009518 3300025941 Bacteria 8104
243 Ga0207711_10018941 3300025941 Bacteria 5726
244 Ga0207689_10003340 3300025942 Bacteria 14703
245 Ga0207661_10001099 3300025944 Bacteria 17974
246 Ga0207661_10030824 3300025944 Bacteria 4135
247 Ga0207667_10000465 3300025949 Bacteria 54509
248 Ga0207667_10006033 3300025949 Bacteria 14744
249 Ga0207667_10008452 3300025949 Bacteria 12227
250 Ga0207667_10012826 3300025949 Bacteria 9630
251 Ga0207667_10018534 3300025949 Bacteria 7804
252 Ga0207667_10044756 3300025949 Unclassified 4689
253 Ga0207667_10066966 3300025949 Bacteria 3742
254 Ga0207640_10005099 3300025981 Bacteria 7142
255 Ga0207677_10002140 3300026023 Bacteria 10377
256 Ga0207678_10002405 3300026067 Bacteria 17010
257 Ga0207708_10000822 3300026075 Bacteria 23384
258 Ga0207708_10001041 3300026075 Bacteria 20762
259 Ga0207708_10011274 3300026075 Bacteria 6652
260 Ga0207702_10000458 3300026078 Bacteria 46107
261 Ga0207641_10008287 3300026088 Bacteria 8589
262 Ga0207648_10000528 3300026089 Bacteria 42826
263 Ga0207648_10020024 3300026089 Bacteria 6035
264 Ga0207676_10013353 3300026095 Bacteria 5899
265 Ga0207676_10043671 3300026095 Unclassified 3453
266 Ga0207674_10000763 3300026116 Bacteria 42020
267 Ga0207674_10004037 3300026116 Bacteria 17806
268 Ga0207674_10020570 3300026116 Bacteria 7125
269 Ga0207675_100003661 3300026118 Bacteria 14986
270 Ga0207675_100012178 3300026118 Bacteria 8035
271 Ga0207675_100029788 3300026118 Bacteria 5082
272 Ga0207683_10013741 3300026121 Bacteria 6902
273 Ga0207683_10024916 3300026121 Bacteria 5157
274 Ga0207698_10001966 3300026142 Bacteria 12082
275 Ga0207428_10014729 3300027907 Bacteria 6775
276 Ga0265356_1000013 3300028017 Bacteria 28815
277 Ga0268266_10000140 3300028379 Bacteria 140387
278 Ga0268264_10023319 3300028381 Bacteria 5049
279 Ga0268264_10030986 3300028381 Bacteria 4385
280 Ga0268264_10035434 3300028381 Unclassified 4109
281 Ga0268264_10043656 3300028381 Bacteria 3716
282 Ga0265337_1000220 3300028556 Bacteria 30437
283 Ga0265336_10001417 3300028666 Bacteria 11048
284 Ga0307517_10001242 3300028786 Bacteria 42752
285 Ga0307515_10049520 3300028794 Bacteria 6317
286 Ga0265338_10006919 3300028800 Bacteria 14272
287 Ga0265338_10027684 3300028800 Bacteria 5680
288 Ga0316177_1052738 3300030731 Bacteria 5061
289 Ga0316176_1211246 3300030732 Bacteria 18534
290 Ga0316183_1112716 3300030742 Bacteria 30420
291 Ga0316181_1233220 3300030744 Bacteria 6910
292 Ga0265762_1000051 3300030760 Bacteria 14462
293 Ga0265760_10000017 3300031090 Bacteria 89357
294 Ga0307508_10000812 3300031616 Bacteria 36575
295 Ga0316578_10000638 3300031728 Bacteria 12396
296 Ga0307405_10000012 3300031731 Bacteria 233774
297 Ga0307407_10000014 3300031903 Bacteria 156064
298 Ga0307416_100000007 3300032002 Bacteria 433284
299 Ga0307414_10005208 3300032004 Bacteria 7140
300 Ga0307510_10025337 3300033180 Bacteria 6841
301 Ga0373943_0000191 3300035170 Bacteria 24826
302 Ga0373946_0000397 3300035171 Bacteria 14161
303 Ga0373924_0006218 3300035410 Bacteria 4270
304 Ga0373935_0008151 3300035692 Bacteria 6280
305 Ga0373927_0000219 3300035695 Bacteria 45343
306 Ga0373927_0000399 3300035695 Bacteria 33596
307 Ga0373947_0000085 3300035725 Bacteria 46581
308 Ga0373925_0000225 3300037068 Bacteria 60424
309 Ga0373925_0001397 3300037068 Bacteria 21000
310 Ga0373925_0014025 3300037068 Bacteria 5801
311 Ga0395899_0000034 3300037312 Bacteria 302623
312 Ga0395899_0000185 3300037312 Bacteria 91682
313 Ga0395900_0000410 3300037418 Bacteria 62004
314 Ga0395900_0003846 3300037418 Bacteria 16045
315 Ga0395898_0004758 3300037466 Bacteria 14776
316 Ga0395898_0009091 3300037466 Bacteria 10465
317 Ga0395898_0027682 3300037466 Bacteria 5685
318 Ga0395905_0000203 3300037471 Bacteria 92320
319 Ga0395905_0017230 3300037471 Bacteria 6860
320 Ga0395901_0000262 3300038443 Bacteria 65898
321 Ga0439432_003766 3300042006 Bacteria 5599
322 Ga0439435_0001387 3300042436 Bacteria 4450
323 Ga0453683_0000010 3300044673 Bacteria 470890
324 Ga0466963_0013873 3300044694 Bacteria 4961
325 Ga0453684_0009892 3300044712 Bacteria 16467
326 Ga0453684_0039630 3300044712 Bacteria 6416
327 Ga0453684_0054434 3300044712 Bacteria 5211
328 Ga0451576_0011959 3300045051 Bacteria 9808
329 Ga0451576_0018259 3300045051 Bacteria 7692
330 Ga0495617_000006 3300046452 Bacteria 398279
331 Ga0495627_000486 3300046453 Bacteria 33391
332 Ga0495592_0000104 3300046454 Bacteria 75214
333 Ga0495592_0020932 3300046454 Unclassified 4975
334 Ga0495638_0001127 3300046460 Bacteria 25891
335 Ga0495638_0001320 3300046460 Bacteria 22822
336 Ga0495653_0000013 3300046463 Bacteria 250453
337 Ga0495650_0001770 3300046471 Bacteria 19610
338 Ga0495664_0016441 3300046477 Bacteria 4215
339 Ga0495596_0002045 3300046500 Bacteria 11076
340 Ga0495606_0008796 3300046507 Bacteria 8668
341 Ga0495610_0000003 3300046512 Bacteria 1203910
342 Ga0495610_0000089 3300046512 Bacteria 106925
343 Ga0495610_0001894 3300046512 Bacteria 18077
344 Ga0495610_0003974 3300046512 Bacteria 11176
345 Ga0495616_0000054 3300046513 Bacteria 104326
346 Ga0495618_0001095 3300046514 Bacteria 18354
347 Ga0495628_0000085 3300046516 Bacteria 73302
348 Ga0495630_0000583 3300046517 Bacteria 26620
349 Ga0495631_0011561 3300046518 Bacteria 4338
350 Ga0495632_0000947 3300046519 Bacteria 25354
351 Ga0495637_0011279 3300046520 Bacteria 4297
352 Ga0495648_0000122 3300046524 Bacteria 93823
353 Ga0495648_0010218 3300046524 Bacteria 7169
354 Ga0495663_0000364 3300046525 Bacteria 16763
355 Ga0495654_0013955 3300046530 Bacteria 4286
356 Ga0495586_0000080 3300046535 Bacteria 59410
357 Ga0495587_0009084 3300046536 Bacteria 6379
358 Ga0495587_0010458 3300046536 Bacteria 5904
359 Ga0495645_0002995 3300046543 Bacteria 11432
360 Ga0495645_0035110 3300046543 Bacteria 3656
361 Ga0495633_0000696 3300046558 Bacteria 30750
362 Ga0495668_0000923 3300046616 Bacteria 32775
363 Ga0495668_0003181 3300046616 Bacteria 12593
364 Ga0495668_0007495 3300046616 Bacteria 6967
365 Ga0495668_0010944 3300046616 Bacteria 5462
366 Ga0495611_0010383 3300046648 Bacteria 3941
367 Ga0495625_0000014 3300046660 Bacteria 323486
368 Ga0495625_0000249 3300046660 Bacteria 84097
369 Ga0495625_0000424 3300046660 Bacteria 63593
370 Ga0495635_0017525 3300046663 Bacteria 5002
371 Ga0495599_0016589 3300046678 Unclassified 4573
372 Ga0495658_0002920 3300046683 Bacteria 8579
373 Ga0495669_0000361 3300046684 Bacteria 23171
374 Ga0495613_0001568 3300046689 Bacteria 17334
375 Ga0495671_0000001 3300046692 Bacteria 1169494
376 Ga0495660_0000878 3300046810 Bacteria 22222
377 Ga0495660_0006090 3300046810 Bacteria 7161
378 Ga0495687_000089 3300047443 Bacteria 141448
379 Ga0495687_015383 3300047443 Bacteria 3894
380 Ga0495673_0000039 3300047469 Bacteria 301943
381 Ga0495673_0000141 3300047469 Bacteria 128600
382 Ga0495681_0001993 3300047470 Bacteria 14919
383 Ga0495686_0004441 3300047472 Bacteria 11550
384 Ga0495626_0001756 3300048091 Bacteria 16498
385 Ga0496112_0001787 3300048915 Bacteria 16907
386 Ga0496122_0001285 3300048925 Bacteria 41682
387 Ga0496123_0003994 3300048926 Bacteria 15964
388 Ga0496124_0001758 3300048927 Bacteria 30259
389 Ga0496125_0032315 3300048928 Bacteria 4650
390 Ga0496125_0037119 3300048928 Bacteria 4240
391 Ga0501032_0004849 3300049569 Bacteria 10080
392 Ga0501033_0000002 3300049570 Bacteria 668574
393 Ga0501269_000059 3300049766 Bacteria 34095
394 Ga0501044_0025649 3300049823 Bacteria 6249
395 nmdc:mga08y16_1416_c1 3300050511 Bacteria 24064
396 nmdc:mga08y16_46639_c1 3300050511 Bacteria 4537
397 nmdc:mga08y16_9969_c1 3300050511 Bacteria 9972
398 nmdc:mga0n895_13811_c1 3300050512 Bacteria 7305
399 nmdc:mga0n895_6966_c1 3300050512 Bacteria 9649
400 nmdc:mga0n895_7774_c1 3300050512 Bacteria 9236
401 nmdc:mga08x19_741_c1 3300050514 Bacteria 20847
402 nmdc:mga0a205_16387_c1 3300050515 Bacteria 6943
403 Ga0500610_0000350 3300053079 Bacteria 13946
404 Ga0500566_0000209 3300053094 Bacteria 30890
405 Ga0500608_007059 3300053122 Bacteria 4618
406 Ga0500618_000293 3300053125 Bacteria 38081
407 Ga0500642_0000827 3300053130 Bacteria 9051
408 Ga0500658_0001721 3300053134 Bacteria 8656
409 Ga0500568_0002190 3300053139 Bacteria 11754
410 Ga0500586_000990 3300053145 Bacteria 5863
411 Ga0500645_000008 3300053730 Bacteria 212254
412 Ga0500609_000131 3300053731 Bacteria 9886
413 2585155595 2582581280 Bacteria 5994497
414 2585199361 2582581293 Bacteria 5907401
415 2643781941 2643221552 Bacteria 5708754
416 2643929603 2643221584 Bacteria 5511711
417 2644129007 2643221622 Bacteria 4212502
418 2738759334 2738541283 Bacteria 7222293
419 2738824816 2738541297 Bacteria 6549566
420 2738855170 2738541302 Bacteria 5944758
421 2739148613 2738541357 Bacteria 6549408
422 2739190532 2738543003 Bacteria 6549560
423 2739317009 2738543026 Bacteria 6549408
424 2739335250 2738543029 Bacteria 6549249
425 2739586497 2739367651 Bacteria 6359826
426 2739614252 2739367656 Bacteria 5152243
427 2753765568 2751185897 Bacteria 5322941
428 2819536942 2818991435 Bacteria 5433759
429 2819547858 2818991437 Bacteria 5805520
430 2819590064 2818991444 Bacteria 6968812
431 2819645193 2818991454 Bacteria 5563326
432 2830077331 2830075706 Bacteria 3855215
433 2833643310 2833640130 Bacteria 4858325
434 2842725732 2842722452 Bacteria 6263924
435 2842907194 2842903701 Bacteria 6986368
436 2842914327 2842909656 Bacteria 6185908
437 2849284725 2849281842 Bacteria 6065644
438 2857632532 2857627736 Bacteria 5625397
439 2904426539 2904424332 Bacteria 7633521
440 2904447391 2904445276 Bacteria 5310396
441 2914761913 2914759650 Bacteria 4701441
442 2919481216 2919476304 Bacteria 5888696
443 2946001270 2945997725 Bacteria 6404843
444 2954018165 2954016120 Bacteria 6446024
445 3000868043 3000865235 Bacteria 3106258
446 8057102724 8057101203 Bacteria 5034064
447 Ga0068855_100009443
448 JGI24744J21845_10000711
449 JGI24751J29686_10000047
450 JGI25152J39213_1000131
451 JGI25150J39212_1000001
452 JGI25150J39212_1000269
453 JGI25151J46595_10000005
454 JGI25153J46596_10000018
455 JGI25153J46596_10000091
456 rootH2_10049198
457 rootH1_10001218
458 Ga0055524_1000460
459 Ga0055536_1000052
460 Ga0055536_1000068
461 Ga0055530_10000043
462 Ga0055530_10000795
463 Ga0055540_1000791
464 Ga0055531_10000008
465 Ga0065165_1000880
466 Ga0065714_10064508
467 Ga0070658_10000041
468 Ga0070658_10013645
469 Ga0070676_10000590
470 Ga0070683_100004685
471 Ga0070683_100009033
472 Ga0070683_100039457
473 Ga0070683_100053491
474 Ga0070690_100002887
475 Ga0070670_100000188
476 Ga0070670_100015198
477 Ga0070670_100044270
478 Ga0068869_100004984
479 Ga0068869_100012991
480 Ga0068869_100019074
481 Ga0068868_100000995
482 Ga0068868_100016066
483 Ga0070687_100001013
484 Ga0070669_100029169
485 Ga0070671_100020566
486 Ga0070674_100006215
487 Ga0070673_100008207
488 Ga0070673_100035530
489 Ga0070659_100012388
490 Ga0070667_100011899
491 Ga0070667_100037773
492 Ga0070709_10032670
493 Ga0070714_100000027
494 Ga0070714_100021455
495 Ga0070714_100061656
496 Ga0070711_100005999
497 Ga0070700_100009963
498 Ga0070700_100011046
499 Ga0070694_100006559
500 Ga0070708_100002565
501 Ga0070708_100036439
502 Ga0070678_100001871
503 Ga0070678_100037553
504 Ga0070662_100000117
505 Ga0070681_10000149
506 Ga0070681_10027703
507 Ga0068867_100002414
508 Ga0068867_100004843
509 Ga0068867_100015463
510 Ga0070706_100000445
511 Ga0070707_100003781
512 Ga0070707_100067647
513 Ga0070698_100028693
514 Ga0070698_100028769
515 Ga0070699_100052179
516 Ga0070679_100009893
517 Ga0070684_100011315
518 Ga0070697_100000400
519 Ga0068853_100056672
520 Ga0070665_100000573
521 Ga0068855_100000234
522 Ga0068855_100001150
523 Ga0068855_100010081
524 Ga0068855_100010834
525 Ga0070664_100001824
526 Ga0068857_100029364
527 Ga0068856_100000062
528 Ga0068856_100000179
529 Ga0068856_100000854
530 Ga0070702_100001376
531 Ga0068852_100001251
532 Ga0068859_100001235
533 Ga0068859_100021703
534 Ga0068864_100000129
535 Ga0068864_100014292
536 Ga0068861_100001530
537 Ga0068863_100012440
538 Ga0068863_100030889
539 Ga0068863_100045976
540 Ga0068858_100006877
541 Ga0068858_100015922
542 Ga0068858_100022840
543 Ga0068858_100048386
544 Ga0068860_100018302
545 Ga0081455_10004244
546 Ga0097621_100000007
547 Ga0097621_100000148
548 Ga0097621_100000493
549 Ga0097621_100000980
550 Ga0097621_100007133
551 Ga0068871_100000024
552 Ga0068871_100000049
553 Ga0068871_100000465
554 Ga0068871_100001251
555 Ga0075433_10002828
556 Ga0075433_10004469
557 Ga0075434_100003010
558 Ga0075434_100006289
559 Ga0075434_100007721
560 Ga0068865_100002704
561 Ga0068865_100008068
562 Ga0097620_100001235
563 Ga0097620_100021704
564 Ga0105244_10006243
565 Ga0105240_10004970
566 Ga0105240_10023653
567 Ga0111539_10007520
568 Ga0111539_10009533
569 Ga0111539_10117976
570 Ga0105245_10021052
571 Ga0105241_10000093
572 Ga0105241_10011122
573 Ga0105242_10000031
574 Ga0105242_10004114
575 Ga0105242_10021661
576 Ga0105248_10000004
577 Ga0105248_10001713
578 Ga0105248_10033633
579 Ga0105248_10063522
580 Ga0105237_10000584
581 Ga0105237_10000956
582 Ga0105237_10004138
583 Ga0105237_10013714
584 Ga0105238_10000609
585 Ga0105238_10000674
586 Ga0105238_10052668
587 Ga0105239_10018467
588 Ga0105246_10009420
589 Ga0105246_10017016
590 Ga0157373_10027452
591 Ga0157371_10004915
592 Ga0157370_10000299
593 Ga0157370_10002139
594 Ga0157370_10019441
595 Ga0157370_10063718
596 Ga0157369_10000004
597 Ga0157369_10000159
598 Ga0157369_10002695
599 Ga0157369_10021406
600 Ga0157369_10045241
601 Ga0157369_10054426
602 Ga0157374_10000062
603 Ga0157374_10000338
604 Ga0157374_10000454
605 Ga0157374_10001775
606 Ga0157374_10003787
607 Ga0157374_10009739
608 Ga0157374_10015524
609 Ga0157378_10000009
610 Ga0157378_10000899
611 Ga0157378_10008955
612 Ga0157378_10012940
613 Ga0163162_10016000
614 Ga0157372_10000140
615 Ga0157372_10000845
616 Ga0157372_10003387
617 Ga0157372_10003675
618 Ga0157372_10012378
619 Ga0157372_10045344
620 Ga0157372_10050090
621 Ga0157375_10001938
622 Ga0157375_10052690
623 Ga0163163_10000319
624 Ga0157380_10012360
625 Ga0182008_10006929
626 Ga0157376_10001674
627 Ga0182006_1000091
628 Ga0182006_1000134
629 Ga0182007_10000006
630 Ga0183373_1001
631 Ga0228598_1001865
632 Ga0207425_1000002
633 Ga0207425_1000049
634 Ga0209129_1000002
635 Ga0209129_1001071
636 Ga0209565_1000012
637 Ga0209673_1002074
638 Ga0209675_1008373
639 Ga0209676_1000090
640 Ga0209676_1002472
641 Ga0209025_1000004
642 Ga0209025_1000068
643 Ga0209564_1002359
644 Ga0209758_1000006
645 Ga0209758_1000019
646 Ga0209050_1000001
647 Ga0209050_1000026
648 Ga0209050_1000091
649 Ga0209050_1000108
650 Ga0209256_1000012
651 Ga0209256_1010988
652 Ga0209051_1000239
653 Ga0209257_1000009
654 Ga0209257_1001066
655 Ga0209257_1001071
656 Ga0209257_1001493
657 Ga0207655_1003226
658 Ga0207647_10000021
659 Ga0207647_10001641
660 Ga0207647_10001931
661 Ga0207647_10006464
662 Ga0207647_10029787
663 Ga0207645_10000091
664 Ga0207705_10000068
665 Ga0207705_10005013
666 Ga0207654_10000439
667 Ga0207707_10003039
668 Ga0207695_10012755
669 Ga0207695_10018305
670 Ga0207695_10067852
671 Ga0207671_10000520
672 Ga0207671_10001509
673 Ga0207671_10010301
674 Ga0207662_10006650
675 Ga0207694_10004080
676 Ga0207694_10018785
677 Ga0207694_10063001
678 Ga0207650_10000007
679 Ga0207664_10000098
680 Ga0207664_10017069
681 Ga0207644_10014401
682 Ga0207706_10000088
683 Ga0207686_10003171
684 Ga0207670_10004272
685 Ga0207669_10006856
686 Ga0207711_10000008
687 Ga0207711_10000010
688 Ga0207711_10009518
689 Ga0207711_10018941
690 Ga0207689_10003340
691 Ga0207661_10001099
692 Ga0207661_10030824
693 Ga0207667_10000465
694 Ga0207667_10006033
695 Ga0207667_10008452
696 Ga0207667_10012826
697 Ga0207667_10018534
698 Ga0207667_10044756
699 Ga0207667_10066966
700 Ga0207640_10005099
701 Ga0207677_10002140
702 Ga0207678_10002405
703 Ga0207708_10000822
704 Ga0207708_10001041
705 Ga0207708_10011274
706 Ga0207702_10000458
707 Ga0207641_10008287
708 Ga0207648_10000528
709 Ga0207648_10020024
710 Ga0207676_10013353
711 Ga0207676_10043671
712 Ga0207674_10000763
713 Ga0207674_10004037
714 Ga0207674_10020570
715 Ga0207675_100003661
716 Ga0207675_100012178
717 Ga0207675_100029788
718 Ga0207683_10013741
719 Ga0207683_10024916
720 Ga0207698_10001966
721 Ga0207428_10014729
722 Ga0265356_1000013
723 Ga0268266_10000140
724 Ga0268264_10023319
725 Ga0268264_10030986
726 Ga0268264_10035434
727 Ga0268264_10043656
728 Ga0265337_1000220
729 Ga0265336_10001417
730 Ga0307517_10001242
731 Ga0307515_10049520
732 Ga0265338_10006919
733 Ga0265338_10027684
734 Ga0316177_1052738
735 Ga0316176_1211246
736 Ga0316183_1112716
737 Ga0316181_1233220
738 Ga0265762_1000051
739 Ga0265760_10000017
740 Ga0307508_10000812
741 Ga0316578_10000638
742 Ga0307405_10000012
743 Ga0307407_10000014
744 Ga0307416_100000007
745 Ga0307414_10005208
746 Ga0307510_10025337
747 Ga0373943_0000191
748 Ga0373946_0000397
749 Ga0373924_0006218
750 Ga0373935_0008151
751 Ga0373927_0000219
752 Ga0373927_0000399
753 Ga0373947_0000085
754 Ga0373925_0000225
755 Ga0373925_0001397
756 Ga0373925_0014025
757 Ga0395899_0000034
758 Ga0395899_0000185
759 Ga0395900_0000410
760 Ga0395900_0003846
761 Ga0395898_0004758
762 Ga0395898_0009091
763 Ga0395898_0027682
764 Ga0395905_0000203
765 Ga0395905_0017230
766 Ga0395901_0000262
767 Ga0439432_003766
768 Ga0439435_0001387
769 Ga0453683_0000010
770 Ga0466963_0013873
771 Ga0453684_0009892
772 Ga0453684_0039630
773 Ga0453684_0054434
774 Ga0451576_0011959
775 Ga0451576_0018259
776 Ga0495617_000006
777 Ga0495627_000486
778 Ga0495592_0000104
779 Ga0495592_0020932
780 Ga0495638_0001127
781 Ga0495638_0001320
782 Ga0495653_0000013
783 Ga0495650_0001770
784 Ga0495664_0016441
785 Ga0495596_0002045
786 Ga0495606_0008796
787 Ga0495610_0000003
788 Ga0495610_0000089
789 Ga0495610_0001894
790 Ga0495610_0003974
791 Ga0495616_0000054
792 Ga0495618_0001095
793 Ga0495628_0000085
794 Ga0495630_0000583
795 Ga0495631_0011561
796 Ga0495632_0000947
797 Ga0495637_0011279
798 Ga0495648_0000122
799 Ga0495648_0010218
800 Ga0495663_0000364
801 Ga0495654_0013955
802 Ga0495586_0000080
803 Ga0495587_0009084
804 Ga0495587_0010458
805 Ga0495645_0002995
806 Ga0495645_0035110
807 Ga0495633_0000696
808 Ga0495668_0000923
809 Ga0495668_0003181
810 Ga0495668_0007495
811 Ga0495668_0010944
812 Ga0495611_0010383
813 Ga0495625_0000014
814 Ga0495625_0000249
815 Ga0495625_0000424
816 Ga0495635_0017525
817 Ga0495599_0016589
818 Ga0495658_0002920
819 Ga0495669_0000361
820 Ga0495613_0001568
821 Ga0495671_0000001
822 Ga0495660_0000878
823 Ga0495660_0006090
824 Ga0495687_000089
825 Ga0495687_015383
826 Ga0495673_0000039
827 Ga0495673_0000141
828 Ga0495681_0001993
829 Ga0495686_0004441
830 Ga0495626_0001756
831 Ga0496112_0001787
832 Ga0496122_0001285
833 Ga0496123_0003994
834 Ga0496124_0001758
835 Ga0496125_0032315
836 Ga0496125_0037119
837 Ga0501032_0004849
838 Ga0501033_0000002
839 Ga0501269_000059
840 Ga0501044_0025649
841 nmdc:mga08y16_1416_c1
842 nmdc:mga08y16_46639_c1
843 nmdc:mga08y16_9969_c1
844 nmdc:mga0n895_13811_c1
845 nmdc:mga0n895_6966_c1
846 nmdc:mga0n895_7774_c1
847 nmdc:mga08x19_741_c1
848 nmdc:mga0a205_16387_c1
849 Ga0500610_0000350
850 Ga0500566_0000209
851 Ga0500608_007059
852 Ga0500618_000293
853 Ga0500642_0000827
854 Ga0500658_0001721
855 Ga0500568_0002190
856 Ga0500586_000990
857 Ga0500645_000008
858 Ga0500609_000131
859 2585155595
860 2585199361
861 2643781941
862 2643929603
863 2644129007
864 2738759334
865 2738824816
866 2738855170
867 2739148613
868 2739190532
869 2739317009
870 2739335250
871 2739586497
872 2739614252
873 2753765568
874 2819536942
875 2819547858
876 2819590064
877 2819645193
878 2830077331
879 2833643310
880 2842725732
881 2842907194
882 2842914327
883 2849284725
884 2857632532
885 2904426539
886 2904447391
887 2914761913
888 2919481216
889 2946001270
890 2954018165
891 3000868043
892 8057102724

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18951

DUF5695

Family of unknown function (DUF5695)

137

1007

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nok-assembly2.cif.gz_B polysaccharide lyase baccell_00875 0.8522 60 778
5nok-assembly1.cif.gz_A polysaccharide lyase baccell_00875 0.8503 54 776
5nok-assembly2.cif.gz_B polysaccharide lyase baccell_00875 0.8451 60 778
5nok-assembly1.cif.gz_A polysaccharide lyase baccell_00875 0.8432 54 776
2d7o-assembly1.cif.gz_A solution structure of the 17th filamin domain from human filamin c 0.7518 324 406
ID Description Score Start End Superfamily
3gm8A05 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7871 326 406 2.60.40.10
af_F1QGL5_691_795_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7836 326 408 2.60.40.10
af_Q10SD2_84_328_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7667 51 80 3.40.50.150
af_U4PBJ9_1658_1748_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7663 324 397 2.60.40.10
af_P76347_1762_1853_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7466 327 403 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A849H0W7-F1-model_v4 Cellulase Ig-like domain-containing protein 0.9916 44 802
AF-A0A4U1CL58-F1-model_v4 Glycoside hydrolase 0.9913 36 903
AF-A0A2V9MTK9-F1-model_v4 Glycoside hydrolase 0.9912 191 903
AF-A0A4Q3U6C0-F1-model_v4 deleted 0.99 50 902
AF-A0A2V7XBD0-F1-model_v4 Uncharacterized protein 0.9898 52 742

Map