F445681

General Info

Members Datasets Scaffolds Average Seq Length
446 235 893 227

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100000632|Ga0068856_10000063214
Length 245
Sequence LAIGRCEVSISMNILITGASSGIGFEAALELTMSGKHKVTALARSQDKLEKLLEIAHGLNPEAEIYALAFDIVHDDYADLQQFIKGNLDNRVDILINNAGVLINKPFTELKEMDFVEMLQSNFIGHVRMIRAMIDLMPQNSHIVNIGSMGGYQGSVKFSGLSAYSASKAALHTLTECLALELADREIKVNCLALGSAQTEMLEEAFPGYQSPVMAFEMGKYIADFSITGQRFFNGKVLPVAGTAP

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
73 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
74 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
79 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
80 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
81 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
82 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
83 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
87 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
117 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
120 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
121 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
122 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
123 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
132 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
138 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
139 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
140 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
141 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
151 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
152 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
153 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
157 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
158 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
159 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
160 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
161 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
162 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
163 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
164 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
170 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
173 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
174 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
175 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
176 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
179 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
180 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
181 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
182 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
183 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
184 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
185 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
186 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
187 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
188 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
189 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
190 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
191 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
192 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
193 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
194 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
195 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
196 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
197 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
198 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
199 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
200 2738541283 Pedobacter sp. OK701 Isolate Unclassified
201 2738541284 Pedobacter sp. YR016 Isolate Unclassified
202 2738541302 Pedobacter sp. CF074 Isolate Unclassified
203 2738543023 Pedobacter sp. OK628 Isolate Unclassified
204 2739367651 Pedobacter sp. OK291 Isolate Unclassified
205 2739367656 Pedobacter sp. CF523 Isolate Unclassified
206 2739367663 Pedobacter sp. YR510 Isolate Unclassified
207 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
208 2818991437 Pedobacter terrae 518 Isolate Unclassified
209 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
210 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
211 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
212 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
213 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
214 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
215 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
216 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
217 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
218 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
219 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
220 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
221 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
222 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
223 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
224 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
225 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
226 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
227 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
228 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
229 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
230 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
231 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
232 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
233 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
234 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
235 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.81
Metatranscriptomes 0.45
Isolates 8.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.52
Nodule 0
Rhizoplane 1.57
Rhizosphere 80.04
Stem 0
Stem Tuber 0
Unclassified 3.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100000632 3300005614 Bacteria 38363
2 SwRhRL2b_contig_1882371 2162886007 Bacteria 10404
3 SwRhRL2b_contig_3624265 2162886007 Bacteria 3525
4 JGI24736J21556_1002956 3300001904 Unclassified 2975
5 JGI24736J21556_1004046 3300001904 Bacteria 2522
6 JGI24740J21852_10019183 3300001979 Bacteria 2413
7 JGI24739J22299_10020440 3300001989 Bacteria 2365
8 JGI24739J22299_10023026 3300001989 Bacteria 2205
9 JGI24737J22298_10004388 3300001990 Bacteria 4923
10 JGI24737J22298_10007026 3300001990 Bacteria 3816
11 JGI24735J21928_10000038 3300002067 Bacteria 64134
12 JGI24744J21845_10013058 3300002077 Bacteria 1677
13 JGI25162J39368_1000047 3300002737 Viruses 167507
14 JGI25162J39368_1000688 3300002737 Bacteria 23552
15 JGI25164J39214_1001174 3300002772 Bacteria 7159
16 JGI25152J39213_1000049 3300002773 Bacteria 83240
17 JGI25150J39212_1000001 3300002774 Bacteria 1318726
18 JGI25151J46595_10000001 3300003187 Bacteria 887211
19 JGI25165J46597_1000846 3300003214 Bacteria 22324
20 JGI25153J46596_10000001 3300003215 Bacteria 748985
21 rootH1_10019583 3300003316 Bacteria 4207
22 rootH1_10044616 3300003316 Bacteria 1462
23 rootH2_10002560 3300003320 Bacteria 75599
24 rootH2_10043887 3300003320 Unclassified 3477
25 rootH2_10099422 3300003320 Bacteria 5927
26 rootH2_10108608 3300003320 Bacteria 7646
27 rootH2_10111502 3300003320 Bacteria 1548
28 rootL2_10145585 3300003322 Bacteria 3623
29 rootL2_10201716 3300003322 Bacteria 1026
30 rootH1_10001276 3300003316 Bacteria 3262
31 rootH1_10001276 3300003323 Bacteria 38627
32 rootH1_10081775 3300003323 Bacteria 11329
33 rootH1_10234911 3300003323 Bacteria 2727
34 Ga0055536_1000001 3300003781 Bacteria 630663
35 Ga0055530_10002341 3300003791 Bacteria 12353
36 Ga0058863_11864228 3300004799 Bacteria 2569
37 Ga0065714_10002322 3300005288 Bacteria 24622
38 Ga0065714_10008040 3300005288 Bacteria 6854
39 Ga0065714_10024530 3300005288 Bacteria 1591
40 Ga0065714_10030216 3300005288 Bacteria 898
41 Ga0065714_10064659 3300005288 Bacteria 25309
42 Ga0065714_10075040 3300005288 Bacteria 2955
43 Ga0065714_10143683 3300005288 Bacteria 1153
44 Ga0065704_10000210 3300005289 Bacteria 93612
45 Ga0065704_10001507 3300005289 Bacteria 12195
46 Ga0065704_10077587 3300005289 Bacteria 4680
47 Ga0070658_10046465 3300005327 Bacteria 3513
48 Ga0070658_10086276 3300005327 Bacteria 2582
49 Ga0070676_10000269 3300005328 Bacteria 22806
50 Ga0070680_100026816 3300005336 Bacteria 4609
51 Ga0068868_100018019 3300005338 Bacteria 5270
52 Ga0068868_100033727 3300005338 Bacteria 3948
53 Ga0070660_100005601 3300005339 Bacteria 8707
54 Ga0070671_100014610 3300005355 Bacteria 6349
55 Ga0070674_100006492 3300005356 Bacteria 6828
56 Ga0070673_100003206 3300005364 Bacteria 10139
57 Ga0070673_100317605 3300005364 Bacteria 1375
58 Ga0070659_100000107 3300005366 Bacteria 61453
59 Ga0070659_100008023 3300005366 Bacteria 7696
60 Ga0070659_100113866 3300005366 Unclassified 2185
61 Ga0070663_100024126 3300005455 Bacteria 4088
62 Ga0070678_100157451 3300005456 Bacteria 1836
63 Ga0070662_100000192 3300005457 Bacteria 35614
64 Ga0070662_100170051 3300005457 Bacteria 1711
65 Ga0070681_10012744 3300005458 Bacteria 8346
66 Ga0068867_100006330 3300005459 Bacteria 8375
67 Ga0070679_100015549 3300005530 Bacteria 7312
68 Ga0070684_100032405 3300005535 Bacteria 4454
69 Ga0068853_100007060 3300005539 Bacteria 8981
70 Ga0068853_100063549 3300005539 Bacteria 3198
71 Ga0068853_100085457 3300005539 Bacteria 2766
72 Ga0068853_100281178 3300005539 Bacteria 1534
73 Ga0070665_100000032 3300005548 Bacteria 333352
74 Ga0068855_100000041 3300005563 Bacteria 151653
75 Ga0068855_100000043 3300005563 Bacteria 149118
76 Ga0068855_100016434 3300005563 Bacteria 8896
77 Ga0068855_100635262 3300005563 Bacteria 1148
78 Ga0068855_100665316 3300005563 Unclassified 1117
79 Ga0068855_100741475 3300005563 Bacteria 1048
80 Ga0068855_101212871 3300005563 Bacteria 784
81 Ga0068857_100030310 3300005577 Bacteria 4776
82 Ga0068856_100007961 3300005614 Bacteria 10350
83 Ga0068852_100002279 3300005616 Bacteria 13188
84 Ga0068852_100661865 3300005616 Unclassified 1052
85 Ga0068858_100048311 3300005842 Bacteria 3944
86 Ga0075366_10003370 3300006195 Bacteria 8415
87 Ga0075366_10006278 3300006195 Bacteria 6501
88 Ga0097621_100000579 3300006237 Bacteria 25795
89 Ga0068871_100000212 3300006358 Bacteria 40531
90 Ga0068865_100003908 3300006881 Bacteria 8938
91 Ga0105244_10008612 3300009036 Bacteria 6352
92 Ga0105240_10000104 3300009093 Bacteria 172082
93 Ga0105240_10003876 3300009093 Bacteria 23102
94 Ga0105240_10007920 3300009093 Bacteria 15325
95 Ga0105240_10018782 3300009093 Bacteria 9262
96 Ga0105240_10064959 3300009093 Bacteria 4531
97 Ga0105240_10080924 3300009093 Bacteria 3993
98 Ga0105240_10084927 3300009093 Bacteria 3880
99 Ga0105240_10162252 3300009093 Unclassified 2654
100 Ga0105240_10268288 3300009093 Bacteria 1966
101 Ga0105240_10429080 3300009093 Bacteria 1483
102 Ga0105243_10000009 3300009148 Bacteria 354419
103 Ga0105243_10073140 3300009148 Bacteria 2777
104 Ga0105241_10000609 3300009174 Bacteria 26925
105 Ga0105241_10009620 3300009174 Bacteria 7102
106 Ga0105241_10012144 3300009174 Bacteria 6322
107 Ga0105241_10025722 3300009174 Bacteria 4375
108 Ga0105241_10098912 3300009174 Bacteria 2315
109 Ga0105242_10734754 3300009176 Bacteria 970
110 Ga0105237_10003047 3300009545 Bacteria 20209
111 Ga0105237_10005338 3300009545 Bacteria 14538
112 Ga0105237_10015783 3300009545 Bacteria 7854
113 Ga0105237_10019614 3300009545 Bacteria 6982
114 Ga0105237_10021435 3300009545 Bacteria 6643
115 Ga0105237_10063999 3300009545 Bacteria 3675
116 Ga0105237_10078080 3300009545 Bacteria 3301
117 Ga0105237_10078785 3300009545 Bacteria 3284
118 Ga0105237_10396884 3300009545 Bacteria 1384
119 Ga0105238_10104113 3300009551 Bacteria 2819
120 Ga0105249_10090151 3300009553 Bacteria 2866
121 Ga0105239_10000015 3300010375 Bacteria 319892
122 Ga0105239_10000017 3300010375 Bacteria 290760
123 Ga0105239_10003346 3300010375 Bacteria 19705
124 Ga0105239_10012887 3300010375 Bacteria 9302
125 Ga0105239_10025903 3300010375 Bacteria 6459
126 Ga0105239_10038181 3300010375 Bacteria 5263
127 Ga0105239_10059858 3300010375 Bacteria 4179
128 Ga0105239_10073649 3300010375 Bacteria 3755
129 Ga0105239_10130448 3300010375 Bacteria 2795
130 Ga0105239_10158805 3300010375 Bacteria 2526
131 Ga0105246_10244733 3300011119 Bacteria 1420
132 Ga0157373_10000034 3300013100 Bacteria 124053
133 Ga0157373_10000276 3300013100 Bacteria 41315
134 Ga0157373_10001240 3300013100 Bacteria 19499
135 Ga0157373_10001688 3300013100 Bacteria 16840
136 Ga0157373_10014659 3300013100 Bacteria 5748
137 Ga0157373_10026840 3300013100 Bacteria 4156
138 Ga0157371_10000016 3300013102 Bacteria 330495
139 Ga0157371_10002507 3300013102 Bacteria 17449
140 Ga0157371_10002545 3300013102 Bacteria 17319
141 Ga0157371_10004475 3300013102 Bacteria 12191
142 Ga0157371_10007186 3300013102 Bacteria 9045
143 Ga0157371_10040903 3300013102 Bacteria 3309
144 Ga0157370_10000350 3300013104 Bacteria 58500
145 Ga0157370_10000562 3300013104 Bacteria 46367
146 Ga0157370_10012309 3300013104 Bacteria 8879
147 Ga0157370_10019635 3300013104 Bacteria 6769
148 Ga0157370_10042420 3300013104 Bacteria 4385
149 Ga0157370_10043674 3300013104 Bacteria 4312
150 Ga0157370_10091200 3300013104 Bacteria 2861
151 Ga0157370_10099670 3300013104 Bacteria 2723
152 Ga0157370_10126125 3300013104 Bacteria 2389
153 Ga0157370_10200554 3300013104 Bacteria 1851
154 Ga0157370_10305802 3300013104 Bacteria 1467
155 Ga0157370_10446747 3300013104 Bacteria 1189
156 Ga0157370_10469352 3300013104 Bacteria 1157
157 Ga0157370_10576211 3300013104 Bacteria 1031
158 Ga0157369_10000129 3300013105 Bacteria 108473
159 Ga0157369_10000566 3300013105 Bacteria 48674
160 Ga0157369_10075848 3300013105 Bacteria 3604
161 Ga0157369_10084435 3300013105 Bacteria 3394
162 Ga0157369_10464503 3300013105 Bacteria 1310
163 Ga0157369_10955406 3300013105 Bacteria 878
164 Ga0157374_10001177 3300013296 Bacteria 22312
165 Ga0157374_10018262 3300013296 Bacteria 6188
166 Ga0157374_10117698 3300013296 Bacteria 2561
167 Ga0157374_10299074 3300013296 Bacteria 1592
168 Ga0157374_10639963 3300013296 Unclassified 1075
169 Ga0157378_10001918 3300013297 Bacteria 18667
170 Ga0157378_10725874 3300013297 Bacteria 1015
171 Ga0163162_10000358 3300013306 Bacteria 41309
172 Ga0163162_10003406 3300013306 Bacteria 15182
173 Ga0163162_10005327 3300013306 Bacteria 12411
174 Ga0163162_10062177 3300013306 Bacteria 3774
175 Ga0157372_10000020 3300013307 Bacteria 208056
176 Ga0157372_10001414 3300013307 Bacteria 25877
177 Ga0157372_10005311 3300013307 Bacteria 13682
178 Ga0157372_10027413 3300013307 Bacteria 6203
179 Ga0157372_10038668 3300013307 Bacteria 5265
180 Ga0157372_10080435 3300013307 Bacteria 3687
181 Ga0157372_10132252 3300013307 Bacteria 2871
182 Ga0157375_10054378 3300013308 Bacteria 3942
183 Ga0157375_10090056 3300013308 Bacteria 3125
184 Ga0157375_10344613 3300013308 Bacteria 1655
185 Ga0182008_10000006 3300014497 Bacteria 378521
186 Ga0182008_10000283 3300014497 Bacteria 39715
187 Ga0182008_10001167 3300014497 Bacteria 18123
188 Ga0182008_10007214 3300014497 Bacteria 6147
189 Ga0182008_10023457 3300014497 Bacteria 3151
190 Ga0182008_10236918 3300014497 Bacteria 938
191 Ga0157376_10039451 3300014969 Bacteria 3851
192 Ga0182006_1000068 3300015261 Bacteria 144823
193 Ga0182006_1001702 3300015261 Bacteria 12842
194 Ga0182006_1006371 3300015261 Bacteria 5496
195 Ga0182006_1018986 3300015261 Bacteria 2899
196 Ga0182006_1039023 3300015261 Unclassified 1876
197 Ga0182007_10000003 3300015262 Bacteria 548244
198 Ga0182007_10001782 3300015262 Bacteria 11241
199 Ga0182007_10018328 3300015262 Unclassified 2538
200 Ga0183373_1001 3300015682 Bacteria 1410374
201 Ga0163161_10000074 3300017792 Bacteria 101784
202 Ga0163161_10000085 3300017792 Bacteria 93534
203 Ga0163161_10000159 3300017792 Bacteria 62460
204 Ga0163161_10044207 3300017792 Bacteria 3208
205 Ga0163161_10064857 3300017792 Bacteria 2665
206 Ga0163161_10637853 3300017792 Bacteria 882
207 Ga0206350_10075760 3300020080 Bacteria 1666
208 Ga0207427_100138 3300025231 Bacteria 86499
209 Ga0209437_100010 3300025233 Bacteria 838447
210 Ga0209437_100089 3300025233 Bacteria 250476
211 Ga0207425_1000002 3300025245 Bacteria 1362590
212 Ga0209026_1000225 3300025250 Bacteria 77234
213 Ga0209026_1003175 3300025250 Bacteria 5568
214 Ga0209026_1004294 3300025250 Bacteria 4294
215 Ga0209129_1000002 3300025258 Bacteria 1359086
216 Ga0209233_1000017 3300025261 Bacteria 898076
217 Ga0209233_1000655 3300025261 Bacteria 16841
218 Ga0209233_1046679 3300025261 Unclassified 904
219 Ga0209455_1003350 3300025272 Bacteria 5727
220 Ga0209676_1000008 3300025292 Bacteria 991778
221 Ga0209025_1000004 3300025294 Bacteria 1361782
222 Ga0209758_1000006 3300025297 Bacteria 1359562
223 Ga0209050_1000045 3300025298 Bacteria 388022
224 Ga0207647_10000169 3300025904 Bacteria 52146
225 Ga0207647_10000206 3300025904 Bacteria 48374
226 Ga0207705_10000043 3300025909 Bacteria 181491
227 Ga0207705_10200231 3300025909 Unclassified 1513
228 Ga0207705_10418715 3300025909 Bacteria 1037
229 Ga0207654_10000940 3300025911 Bacteria 16008
230 Ga0207654_10002291 3300025911 Bacteria 9812
231 Ga0207654_10047402 3300025911 Bacteria 2455
232 Ga0207654_10117408 3300025911 Bacteria 1665
233 Ga0207707_10099895 3300025912 Bacteria 2536
234 Ga0207695_10000048 3300025913 Bacteria 421800
235 Ga0207695_10008731 3300025913 Bacteria 12637
236 Ga0207695_10010497 3300025913 Bacteria 11329
237 Ga0207695_10015096 3300025913 Bacteria 9112
238 Ga0207695_10078060 3300025913 Bacteria 3360
239 Ga0207695_10178177 3300025913 Unclassified 2047
240 Ga0207695_10185056 3300025913 Bacteria 2002
241 Ga0207671_10004077 3300025914 Bacteria 14142
242 Ga0207671_10008774 3300025914 Bacteria 8516
243 Ga0207671_10012113 3300025914 Bacteria 6963
244 Ga0207671_10014744 3300025914 Bacteria 6162
245 Ga0207671_10022717 3300025914 Bacteria 4739
246 Ga0207671_10032647 3300025914 Bacteria 3873
247 Ga0207671_10051950 3300025914 Bacteria 3036
248 Ga0207671_10061309 3300025914 Bacteria 2790
249 Ga0207671_10250824 3300025914 Bacteria 1391
250 Ga0207660_10114376 3300025917 Bacteria 2035
251 Ga0207657_10030236 3300025919 Bacteria 4918
252 Ga0207657_10040598 3300025919 Bacteria 4121
253 Ga0207694_10080890 3300025924 Bacteria 2550
254 Ga0207644_10004906 3300025931 Bacteria 8720
255 Ga0207690_10000147 3300025932 Bacteria 56329
256 Ga0207690_10014393 3300025932 Bacteria 4778
257 Ga0207690_10086425 3300025932 Bacteria 2204
258 Ga0207706_10000167 3300025933 Bacteria 72622
259 Ga0207706_10044049 3300025933 Bacteria 3955
260 Ga0207686_10017926 3300025934 Bacteria 4000
261 Ga0207709_10000026 3300025935 Bacteria 354467
262 Ga0207669_10044012 3300025937 Bacteria 2619
263 Ga0207704_10000042 3300025938 Bacteria 89683
264 Ga0207667_10000015 3300025949 Bacteria 417534
265 Ga0207667_10000404 3300025949 Bacteria 58450
266 Ga0207667_10018601 3300025949 Bacteria 7786
267 Ga0207667_10075388 3300025949 Bacteria 3503
268 Ga0207667_10399870 3300025949 Unclassified 1399
269 Ga0207667_10615084 3300025949 Bacteria 1094
270 Ga0207667_10658043 3300025949 Bacteria 1053
271 Ga0207651_10320432 3300025960 Bacteria 1295
272 Ga0207712_10470803 3300025961 Bacteria 1069
273 Ga0207677_10033613 3300026023 Bacteria 3311
274 Ga0207639_10014921 3300026041 Bacteria 5473
275 Ga0207639_10056606 3300026041 Bacteria 3006
276 Ga0207639_10090273 3300026041 Bacteria 2450
277 Ga0207639_10929275 3300026041 Bacteria 813
278 Ga0207678_10035786 3300026067 Bacteria 4323
279 Ga0207702_10002240 3300026078 Bacteria 18551
280 Ga0207702_10022575 3300026078 Bacteria 5218
281 Ga0207648_10003557 3300026089 Bacteria 16296
282 Ga0207674_10425650 3300026116 Bacteria 1283
283 Ga0207674_10963584 3300026116 Bacteria 822
284 Ga0207683_10002545 3300026121 Bacteria 15908
285 Ga0207698_10001222 3300026142 Bacteria 15005
286 Ga0207698_10604156 3300026142 Unclassified 1082
287 Ga0268266_10000030 3300028379 Bacteria 417120
288 Ga0307517_10026831 3300028786 Bacteria 6952
289 Ga0307515_10000226 3300028794 Bacteria 139533
290 Ga0307515_10000507 3300028794 Bacteria 93166
291 Ga0307515_10026751 3300028794 Bacteria 9906
292 Ga0265338_10101862 3300028800 Bacteria 2337
293 Ga0316177_1069120 3300030731 Bacteria 11325
294 Ga0316176_1198627 3300030732 Bacteria 17963
295 Ga0316183_1107442 3300030742 Bacteria 17978
296 Ga0316181_1162221 3300030744 Bacteria 9555
297 Ga0307509_10067548 3300031507 Bacteria 3745
298 Ga0307405_10000003 3300031731 Bacteria 569064
299 Ga0307413_10352735 3300031824 Bacteria 1136
300 Ga0307407_10000030 3300031903 Bacteria 97416
301 Ga0307412_10000055 3300031911 Bacteria 147100
302 Ga0307412_10077510 3300031911 Bacteria 2286
303 Ga0307412_10122314 3300031911 Bacteria 1876
304 Ga0307416_100000175 3300032002 Bacteria 35927
305 Ga0307414_10000796 3300032004 Bacteria 16147
306 Ga0307414_10001474 3300032004 Bacteria 12241
307 Ga0307414_10003994 3300032004 Bacteria 7961
308 Ga0307414_10019982 3300032004 Bacteria 4164
309 Ga0307414_10037378 3300032004 Bacteria 3250
310 Ga0307414_10070517 3300032004 Bacteria 2517
311 Ga0307414_10941195 3300032004 Bacteria 793
312 Ga0307411_10347408 3300032005 Bacteria 1208
313 Ga0307507_10000152 3300033179 Bacteria 122095
314 Ga0307510_10000147 3300033180 Bacteria 58704
315 Ga0395899_0000002 3300037312 Bacteria 1324310
316 Ga0395899_0000136 3300037312 Bacteria 112112
317 Ga0395899_0000286 3300037312 Bacteria 65138
318 Ga0395900_0000115 3300037418 Bacteria 138474
319 Ga0395900_0000285 3300037418 Bacteria 75772
320 Ga0395900_0438011 3300037418 Bacteria 1265
321 Ga0395898_0005702 3300037466 Bacteria 13415
322 Ga0395905_0000045 3300037471 Bacteria 241370
323 Ga0395905_0533215 3300037471 Bacteria 1075
324 Ga0436361_0782466 3300039447 Bacteria 4631
325 Ga0451793_0632478 3300041452 Bacteria 829
326 Ga0451802_1196253 3300041460 Bacteria 1221
327 Ga0451806_075872 3300041462 Bacteria 1032
328 Ga0439448_0017957 3300042005 Bacteria 2163
329 Ga0466966_0019492 3300044684 Bacteria 4463
330 Ga0466961_0043617 3300044693 Bacteria 2872
331 Ga0466959_0478937 3300045049 Bacteria 842
332 Ga0451576_0000002 3300045051 Bacteria 1670975
333 Ga0466958_0135185 3300045836 Bacteria 1550
334 Ga0495627_070624 3300046453 Bacteria 1021
335 Ga0495629_0452248 3300046459 Bacteria 869
336 Ga0495651_0236431 3300046462 Bacteria 1255
337 Ga0495650_0000198 3300046471 Bacteria 130455
338 Ga0495650_0059949 3300046471 Bacteria 1530
339 Ga0495584_0103601 3300046491 Bacteria 1439
340 Ga0495585_0000391 3300046492 Bacteria 42399
341 Ga0495585_0006258 3300046492 Bacteria 7410
342 Ga0495583_0085999 3300046506 Bacteria 1360
343 Ga0495606_0000003 3300046507 Bacteria 449402
344 Ga0495606_0023417 3300046507 Bacteria 4474
345 Ga0495608_0378045 3300046511 Bacteria 869
346 Ga0495610_0000271 3300046512 Bacteria 54071
347 Ga0495610_0000825 3300046512 Bacteria 28988
348 Ga0495610_0027103 3300046512 Bacteria 3051
349 Ga0495616_0003274 3300046513 Bacteria 10418
350 Ga0495616_0006818 3300046513 Bacteria 6884
351 Ga0495631_0029713 3300046518 Bacteria 2483
352 Ga0495631_0091475 3300046518 Bacteria 1310
353 Ga0495632_0167313 3300046519 Bacteria 1011
354 Ga0495637_0035984 3300046520 Bacteria 2160
355 Ga0495644_0041178 3300046523 Unclassified 1740
356 Ga0495648_0018945 3300046524 Bacteria 4856
357 Ga0495648_0088765 3300046524 Bacteria 1737
358 Ga0495609_0009040 3300046538 Bacteria 4844
359 Ga0495609_0061349 3300046538 Bacteria 1661
360 Ga0495633_0000267 3300046558 Bacteria 61184
361 Ga0495633_0026147 3300046558 Bacteria 2866
362 Ga0495633_0066520 3300046558 Bacteria 1683
363 Ga0495668_0000010 3300046616 Bacteria 487308
364 Ga0495668_0098538 3300046616 Bacteria 1600
365 Ga0495625_0000456 3300046660 Bacteria 61289
366 Ga0495625_0000524 3300046660 Bacteria 56526
367 Ga0495625_0003704 3300046660 Bacteria 14924
368 Ga0495625_0019475 3300046660 Bacteria 5263
369 Ga0495625_0346287 3300046660 Bacteria 940
370 Ga0495661_0000924 3300046665 Bacteria 26810
371 Ga0495661_0104273 3300046665 Bacteria 1590
372 Ga0495658_0010384 3300046683 Bacteria 4658
373 Ga0495671_0033803 3300046692 Bacteria 2603
374 Ga0495671_0303116 3300046692 Bacteria 768
375 Ga0495649_0000168 3300046694 Bacteria 57053
376 Ga0495600_0104055 3300046809 Bacteria 1850
377 Ga0495660_0007737 3300046810 Bacteria 6314
378 Ga0495687_001739 3300047443 Bacteria 19268
379 Ga0495687_041519 3300047443 Bacteria 2017
380 Ga0495681_0106918 3300047470 Bacteria 1216
381 Ga0495686_0000845 3300047472 Bacteria 39321
382 Ga0495686_0000974 3300047472 Bacteria 35181
383 Ga0495686_0033459 3300047472 Bacteria 3319
384 Ga0495614_0008704 3300048089 Bacteria 4513
385 Ga0496115_0062288 3300048918 Bacteria 3009
386 Ga0496115_0429967 3300048918 Bacteria 1069
387 Ga0496115_0524766 3300048918 Bacteria 949
388 Ga0496116_0127224 3300048919 Bacteria 1461
389 Ga0496117_0012827 3300048920 Bacteria 7349
390 Ga0496122_0000404 3300048925 Bacteria 91618
391 Ga0496122_0028983 3300048925 Bacteria 4681
392 Ga0496123_0001627 3300048926 Bacteria 30246
393 Ga0496125_0223563 3300048928 Bacteria 1211
394 Ga0495678_027186 3300049459 Bacteria 2430
395 Ga0501241_037636 3300049758 Bacteria 930
396 nmdc:mga0k408_156_c2 3300050493 Bacteria 15182
397 nmdc:mga0k408_6061_c1 3300050493 Bacteria 6444
398 nmdc:mga07m45_408489_c1 3300050496 Bacteria 788
399 Ga0500635_0012239 3300053080 Bacteria 2459
400 Ga0500651_0000537 3300053093 Bacteria 19292
401 Ga0500608_002183 3300053122 Bacteria 7042
402 Ga0500614_054758 3300053123 Bacteria 1057
403 Ga0500618_002267 3300053125 Bacteria 7473
404 Ga0500642_0028250 3300053130 Bacteria 2311
405 Ga0500568_0079531 3300053139 Bacteria 1246
406 Ga0500622_0008830 3300053156 Bacteria 5611
407 Ga0500624_000278 3300053157 Bacteria 17649
408 Ga0500634_0050164 3300053161 Bacteria 2249
409 2586207702 2585427687 Bacteria 5544917
410 2599479071 2599185184 Bacteria 6430550
411 2722726208 2721755487 Bacteria 6357185
412 2738757005 2738541283 Bacteria 7222293
413 2738760330 2738541284 Bacteria 5199923
414 2738851866 2738541302 Bacteria 5944758
415 2739302441 2738543023 Bacteria 6767879
416 2739590764 2739367651 Bacteria 6359826
417 2739617870 2739367656 Bacteria 5152243
418 2739644181 2739367663 Bacteria 5040914
419 2776612389 2775506987 Bacteria 5373360
420 2819546425 2818991437 Bacteria 5805520
421 2842725120 2842722452 Bacteria 6263924
422 2842908857 2842903701 Bacteria 6986368
423 2842914285 2842909656 Bacteria 6185908
424 2849285874 2849281842 Bacteria 6065644
425 2852626788 2852623160 Bacteria 4376875
426 2852631487 2852627209 Bacteria 5896285
427 2857631064 2857627736 Bacteria 5625397
428 2884938164 2884933994 Bacteria 4535041
429 2890737788 2890737413 Bacteria 4269751
430 2896320809 2896317667 Bacteria 4606601
431 2896344295 2896344016 Bacteria 3811746
432 2898713719 2898713307 Bacteria 4110805
433 2902050175 2902048731 Bacteria 4976191
434 2904448735 2904445276 Bacteria 5310396
435 2904782818 2904780799 Bacteria 5840761
436 2919180429 2919177583 Bacteria 5641607
437 2919189595 2919186247 Bacteria 6244071
438 2919442744 2919437846 Bacteria 6199444
439 2928082615 2928078545 Bacteria 6534839
440 2928148796 2928147474 Bacteria 6512076
441 2932086403 2932082852 Bacteria 6563563
442 2939667821 2939664404 Bacteria 6364494
443 2946002046 2945997725 Bacteria 6404843
444 2954018939 2954016120 Bacteria 6446024
445 2958513739 2958512119 Bacteria 4528530
446 3003235917 3003233435 Bacteria 4458031
447 8055590986 8055588893 Bacteria 3619545
448 Ga0068856_100000632
449 SwRhRL2b_contig_1882371
450 SwRhRL2b_contig_3624265
451 JGI24736J21556_1002956
452 JGI24736J21556_1004046
453 JGI24740J21852_10019183
454 JGI24739J22299_10020440
455 JGI24739J22299_10023026
456 JGI24737J22298_10004388
457 JGI24737J22298_10007026
458 JGI24735J21928_10000038
459 JGI24744J21845_10013058
460 JGI25162J39368_1000047
461 JGI25162J39368_1000688
462 JGI25164J39214_1001174
463 JGI25152J39213_1000049
464 JGI25150J39212_1000001
465 JGI25151J46595_10000001
466 JGI25165J46597_1000846
467 JGI25153J46596_10000001
468 rootH1_10019583
469 rootH1_10044616
470 rootH2_10002560
471 rootH2_10043887
472 rootH2_10099422
473 rootH2_10108608
474 rootH2_10111502
475 rootL2_10145585
476 rootL2_10201716
477 rootH1_10001276
478 rootH1_10081775
479 rootH1_10234911
480 Ga0055536_1000001
481 Ga0055530_10002341
482 Ga0058863_11864228
483 Ga0065714_10002322
484 Ga0065714_10008040
485 Ga0065714_10024530
486 Ga0065714_10030216
487 Ga0065714_10064659
488 Ga0065714_10075040
489 Ga0065714_10143683
490 Ga0065704_10000210
491 Ga0065704_10001507
492 Ga0065704_10077587
493 Ga0070658_10046465
494 Ga0070658_10086276
495 Ga0070676_10000269
496 Ga0070680_100026816
497 Ga0068868_100018019
498 Ga0068868_100033727
499 Ga0070660_100005601
500 Ga0070671_100014610
501 Ga0070674_100006492
502 Ga0070673_100003206
503 Ga0070673_100317605
504 Ga0070659_100000107
505 Ga0070659_100008023
506 Ga0070659_100113866
507 Ga0070663_100024126
508 Ga0070678_100157451
509 Ga0070662_100000192
510 Ga0070662_100170051
511 Ga0070681_10012744
512 Ga0068867_100006330
513 Ga0070679_100015549
514 Ga0070684_100032405
515 Ga0068853_100007060
516 Ga0068853_100063549
517 Ga0068853_100085457
518 Ga0068853_100281178
519 Ga0070665_100000032
520 Ga0068855_100000041
521 Ga0068855_100000043
522 Ga0068855_100016434
523 Ga0068855_100635262
524 Ga0068855_100665316
525 Ga0068855_100741475
526 Ga0068855_101212871
527 Ga0068857_100030310
528 Ga0068856_100007961
529 Ga0068852_100002279
530 Ga0068852_100661865
531 Ga0068858_100048311
532 Ga0075366_10003370
533 Ga0075366_10006278
534 Ga0097621_100000579
535 Ga0068871_100000212
536 Ga0068865_100003908
537 Ga0105244_10008612
538 Ga0105240_10000104
539 Ga0105240_10003876
540 Ga0105240_10007920
541 Ga0105240_10018782
542 Ga0105240_10064959
543 Ga0105240_10080924
544 Ga0105240_10084927
545 Ga0105240_10162252
546 Ga0105240_10268288
547 Ga0105240_10429080
548 Ga0105243_10000009
549 Ga0105243_10073140
550 Ga0105241_10000609
551 Ga0105241_10009620
552 Ga0105241_10012144
553 Ga0105241_10025722
554 Ga0105241_10098912
555 Ga0105242_10734754
556 Ga0105237_10003047
557 Ga0105237_10005338
558 Ga0105237_10015783
559 Ga0105237_10019614
560 Ga0105237_10021435
561 Ga0105237_10063999
562 Ga0105237_10078080
563 Ga0105237_10078785
564 Ga0105237_10396884
565 Ga0105238_10104113
566 Ga0105249_10090151
567 Ga0105239_10000015
568 Ga0105239_10000017
569 Ga0105239_10003346
570 Ga0105239_10012887
571 Ga0105239_10025903
572 Ga0105239_10038181
573 Ga0105239_10059858
574 Ga0105239_10073649
575 Ga0105239_10130448
576 Ga0105239_10158805
577 Ga0105246_10244733
578 Ga0157373_10000034
579 Ga0157373_10000276
580 Ga0157373_10001240
581 Ga0157373_10001688
582 Ga0157373_10014659
583 Ga0157373_10026840
584 Ga0157371_10000016
585 Ga0157371_10002507
586 Ga0157371_10002545
587 Ga0157371_10004475
588 Ga0157371_10007186
589 Ga0157371_10040903
590 Ga0157370_10000350
591 Ga0157370_10000562
592 Ga0157370_10012309
593 Ga0157370_10019635
594 Ga0157370_10042420
595 Ga0157370_10043674
596 Ga0157370_10091200
597 Ga0157370_10099670
598 Ga0157370_10126125
599 Ga0157370_10200554
600 Ga0157370_10305802
601 Ga0157370_10446747
602 Ga0157370_10469352
603 Ga0157370_10576211
604 Ga0157369_10000129
605 Ga0157369_10000566
606 Ga0157369_10075848
607 Ga0157369_10084435
608 Ga0157369_10464503
609 Ga0157369_10955406
610 Ga0157374_10001177
611 Ga0157374_10018262
612 Ga0157374_10117698
613 Ga0157374_10299074
614 Ga0157374_10639963
615 Ga0157378_10001918
616 Ga0157378_10725874
617 Ga0163162_10000358
618 Ga0163162_10003406
619 Ga0163162_10005327
620 Ga0163162_10062177
621 Ga0157372_10000020
622 Ga0157372_10001414
623 Ga0157372_10005311
624 Ga0157372_10027413
625 Ga0157372_10038668
626 Ga0157372_10080435
627 Ga0157372_10132252
628 Ga0157375_10054378
629 Ga0157375_10090056
630 Ga0157375_10344613
631 Ga0182008_10000006
632 Ga0182008_10000283
633 Ga0182008_10001167
634 Ga0182008_10007214
635 Ga0182008_10023457
636 Ga0182008_10236918
637 Ga0157376_10039451
638 Ga0182006_1000068
639 Ga0182006_1001702
640 Ga0182006_1006371
641 Ga0182006_1018986
642 Ga0182006_1039023
643 Ga0182007_10000003
644 Ga0182007_10001782
645 Ga0182007_10018328
646 Ga0183373_1001
647 Ga0163161_10000074
648 Ga0163161_10000085
649 Ga0163161_10000159
650 Ga0163161_10044207
651 Ga0163161_10064857
652 Ga0163161_10637853
653 Ga0206350_10075760
654 Ga0207427_100138
655 Ga0209437_100010
656 Ga0209437_100089
657 Ga0207425_1000002
658 Ga0209026_1000225
659 Ga0209026_1003175
660 Ga0209026_1004294
661 Ga0209129_1000002
662 Ga0209233_1000017
663 Ga0209233_1000655
664 Ga0209233_1046679
665 Ga0209455_1003350
666 Ga0209676_1000008
667 Ga0209025_1000004
668 Ga0209758_1000006
669 Ga0209050_1000045
670 Ga0207647_10000169
671 Ga0207647_10000206
672 Ga0207705_10000043
673 Ga0207705_10200231
674 Ga0207705_10418715
675 Ga0207654_10000940
676 Ga0207654_10002291
677 Ga0207654_10047402
678 Ga0207654_10117408
679 Ga0207707_10099895
680 Ga0207695_10000048
681 Ga0207695_10008731
682 Ga0207695_10010497
683 Ga0207695_10015096
684 Ga0207695_10078060
685 Ga0207695_10178177
686 Ga0207695_10185056
687 Ga0207671_10004077
688 Ga0207671_10008774
689 Ga0207671_10012113
690 Ga0207671_10014744
691 Ga0207671_10022717
692 Ga0207671_10032647
693 Ga0207671_10051950
694 Ga0207671_10061309
695 Ga0207671_10250824
696 Ga0207660_10114376
697 Ga0207657_10030236
698 Ga0207657_10040598
699 Ga0207694_10080890
700 Ga0207644_10004906
701 Ga0207690_10000147
702 Ga0207690_10014393
703 Ga0207690_10086425
704 Ga0207706_10000167
705 Ga0207706_10044049
706 Ga0207686_10017926
707 Ga0207709_10000026
708 Ga0207669_10044012
709 Ga0207704_10000042
710 Ga0207667_10000015
711 Ga0207667_10000404
712 Ga0207667_10018601
713 Ga0207667_10075388
714 Ga0207667_10399870
715 Ga0207667_10615084
716 Ga0207667_10658043
717 Ga0207651_10320432
718 Ga0207712_10470803
719 Ga0207677_10033613
720 Ga0207639_10014921
721 Ga0207639_10056606
722 Ga0207639_10090273
723 Ga0207639_10929275
724 Ga0207678_10035786
725 Ga0207702_10002240
726 Ga0207702_10022575
727 Ga0207648_10003557
728 Ga0207674_10425650
729 Ga0207674_10963584
730 Ga0207683_10002545
731 Ga0207698_10001222
732 Ga0207698_10604156
733 Ga0268266_10000030
734 Ga0307517_10026831
735 Ga0307515_10000226
736 Ga0307515_10000507
737 Ga0307515_10026751
738 Ga0265338_10101862
739 Ga0316177_1069120
740 Ga0316176_1198627
741 Ga0316183_1107442
742 Ga0316181_1162221
743 Ga0307509_10067548
744 Ga0307405_10000003
745 Ga0307413_10352735
746 Ga0307407_10000030
747 Ga0307412_10000055
748 Ga0307412_10077510
749 Ga0307412_10122314
750 Ga0307416_100000175
751 Ga0307414_10000796
752 Ga0307414_10001474
753 Ga0307414_10003994
754 Ga0307414_10019982
755 Ga0307414_10037378
756 Ga0307414_10070517
757 Ga0307414_10941195
758 Ga0307411_10347408
759 Ga0307507_10000152
760 Ga0307510_10000147
761 Ga0395899_0000002
762 Ga0395899_0000136
763 Ga0395899_0000286
764 Ga0395900_0000115
765 Ga0395900_0000285
766 Ga0395900_0438011
767 Ga0395898_0005702
768 Ga0395905_0000045
769 Ga0395905_0533215
770 Ga0436361_0782466
771 Ga0451793_0632478
772 Ga0451802_1196253
773 Ga0451806_075872
774 Ga0439448_0017957
775 Ga0466966_0019492
776 Ga0466961_0043617
777 Ga0466959_0478937
778 Ga0451576_0000002
779 Ga0466958_0135185
780 Ga0495627_070624
781 Ga0495629_0452248
782 Ga0495651_0236431
783 Ga0495650_0000198
784 Ga0495650_0059949
785 Ga0495584_0103601
786 Ga0495585_0000391
787 Ga0495585_0006258
788 Ga0495583_0085999
789 Ga0495606_0000003
790 Ga0495606_0023417
791 Ga0495608_0378045
792 Ga0495610_0000271
793 Ga0495610_0000825
794 Ga0495610_0027103
795 Ga0495616_0003274
796 Ga0495616_0006818
797 Ga0495631_0029713
798 Ga0495631_0091475
799 Ga0495632_0167313
800 Ga0495637_0035984
801 Ga0495644_0041178
802 Ga0495648_0018945
803 Ga0495648_0088765
804 Ga0495609_0009040
805 Ga0495609_0061349
806 Ga0495633_0000267
807 Ga0495633_0026147
808 Ga0495633_0066520
809 Ga0495668_0000010
810 Ga0495668_0098538
811 Ga0495625_0000456
812 Ga0495625_0000524
813 Ga0495625_0003704
814 Ga0495625_0019475
815 Ga0495625_0346287
816 Ga0495661_0000924
817 Ga0495661_0104273
818 Ga0495658_0010384
819 Ga0495671_0033803
820 Ga0495671_0303116
821 Ga0495649_0000168
822 Ga0495600_0104055
823 Ga0495660_0007737
824 Ga0495687_001739
825 Ga0495687_041519
826 Ga0495681_0106918
827 Ga0495686_0000845
828 Ga0495686_0000974
829 Ga0495686_0033459
830 Ga0495614_0008704
831 Ga0496115_0062288
832 Ga0496115_0429967
833 Ga0496115_0524766
834 Ga0496116_0127224
835 Ga0496117_0012827
836 Ga0496122_0000404
837 Ga0496122_0028983
838 Ga0496123_0001627
839 Ga0496125_0223563
840 Ga0495678_027186
841 Ga0501241_037636
842 nmdc:mga0k408_156_c2
843 nmdc:mga0k408_6061_c1
844 nmdc:mga07m45_408489_c1
845 Ga0500635_0012239
846 Ga0500651_0000537
847 Ga0500608_002183
848 Ga0500614_054758
849 Ga0500618_002267
850 Ga0500642_0028250
851 Ga0500568_0079531
852 Ga0500622_0008830
853 Ga0500624_000278
854 Ga0500634_0050164
855 2586207702
856 2599479071
857 2722726208
858 2738757005
859 2738760330
860 2738851866
861 2739302441
862 2739590764
863 2739617870
864 2739644181
865 2776612389
866 2819546425
867 2842725120
868 2842908857
869 2842914285
870 2849285874
871 2852626788
872 2852631487
873 2857631064
874 2884938164
875 2890737788
876 2896320809
877 2896344295
878 2898713719
879 2902050175
880 2904448735
881 2904782818
882 2919180429
883 2919189595
884 2919442744
885 2928082615
886 2928148796
887 2932086403
888 2939667821
889 2946002046
890 2954018939
891 2958513739
892 3003235917
893 8055590986

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

12

210

0.92

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

18

220

0.87

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

14

188

0.83

PF08659

KR

KR domain

13

204

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fgs-assembly1.cif.gz_B crystal structure of a probable dehydrogenase protein 0.9099 2 228
4bmn-assembly1.cif.gz_B apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9068 2 228
4bmn-assembly1.cif.gz_A apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9038 2 228
4bmn-assembly1.cif.gz_D apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9036 2 228
7djs-assembly1.cif.gz_C crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.8995 1 228
ID Description Score Start End Superfamily
af_Q54QN6_1_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9102 2 228 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9063 2 181 3.40.50.720
4bmnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9038 2 228 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9019 2 192 3.40.50.720
af_C0P944_2_268_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9012 2 228 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7Y6XVQ3-F1-model_v4 deleted 0.9507 2 233
AF-G8R130-F1-model_v4 Short-chain alcohol dehydrogenase 0.9505 2 233 GO:0016020
GO:0016491
AF-A0A7V4IB07-F1-model_v4 SDR family oxidoreductase 0.9452 1 233 GO:0016491
AF-A0A7V4IB07-F1-model_v4 SDR family oxidoreductase 0.9412 1 233 GO:0016491
AF-A0A7Y6XVQ3-F1-model_v4 deleted 0.9385 2 233

Map