F445703

General Info

Members Datasets Scaffolds Average Seq Length
446 236 892 180

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10049282|Ga0105240_100492823
Length 198
Sequence LEPDSGWKQKLIQPKLASMNLVHLLPVGNIDRALLESISRALPESLPVRCEILACRLDPAAAYHAERQQFHSSEILQRMQPLATPCWRLLAIADVDLYIPILTYVFGEAQIAGVCAVVSAFRFRQEFYGLDGDEDLLRERLLKECVHELGHTLDLRHCQDYRCAMASSHAVEWIDLRGSTLCESCRSQLEAGRAFQLA

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
170 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
171 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
172 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
173 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
174 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
175 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
180 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
181 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
184 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
195 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
196 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
197 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
198 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
199 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
200 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
201 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
208 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
209 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
212 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
236 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.95
Rhizosphere 92.83
Stem 0
Stem Tuber 0
Unclassified 24.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10049282 3300009093 Bacteria 5318
2 JGI24752J21851_1006134 3300001976 Unclassified 1571
3 JGI24737J22298_10096936 3300001990 Unclassified 874
4 JGI24743J22301_10032784 3300001991 Unclassified 1027
5 JGI24748J21848_1006896 3300002074 Unclassified 1327
6 JGI24034J26672_10002281 3300002239 Unclassified 2623
7 JGI24751J29686_10001601 3300002459 Bacteria 4675
8 Ga0065712_10383564 3300005290 Unclassified 749
9 Ga0065715_10328902 3300005293 Unclassified 981
10 Ga0065715_10383203 3300005293 Bacteria 892
11 Ga0070658_10087249 3300005327 Bacteria 2568
12 Ga0070683_100017661 3300005329 Bacteria 6303
13 Ga0070683_101214890 3300005329 Unclassified 724
14 Ga0070670_100363113 3300005331 Bacteria 1274
15 Ga0070670_100493305 3300005331 Unclassified 1088
16 Ga0068869_100049535 3300005334 Unclassified 3041
17 Ga0068869_100312501 3300005334 Bacteria 1272
18 Ga0070666_10216035 3300005335 Unclassified 1351
19 Ga0070682_100072540 3300005337 Unclassified 2207
20 Ga0068868_100003132 3300005338 Bacteria 11511
21 Ga0068868_100028678 3300005338 Unclassified 4258
22 Ga0068868_100130258 3300005338 Bacteria 2058
23 Ga0068868_100160007 3300005338 Bacteria 1859
24 Ga0070660_100031857 3300005339 Bacteria 3963
25 Ga0070660_100155154 3300005339 Bacteria 1843
26 Ga0070660_100157937 3300005339 Unclassified 1826
27 Ga0070689_100013238 3300005340 Bacteria 5964
28 Ga0070687_100006689 3300005343 Bacteria 4745
29 Ga0070661_100010692 3300005344 Bacteria 6386
30 Ga0070692_10287414 3300005345 Unclassified 999
31 Ga0070668_100875779 3300005347 Unclassified 801
32 Ga0070669_100008760 3300005353 Bacteria 7219
33 Ga0070675_100010707 3300005354 Bacteria 7173
34 Ga0070675_100279395 3300005354 Bacteria 1467
35 Ga0070671_100433328 3300005355 Bacteria 1127
36 Ga0070671_100607227 3300005355 Bacteria 946
37 Ga0070671_100746470 3300005355 Unclassified 850
38 Ga0070674_100814351 3300005356 Unclassified 807
39 Ga0070673_100018214 3300005364 Bacteria 5013
40 Ga0070688_100012217 3300005365 Bacteria 4806
41 Ga0070659_100038103 3300005366 Bacteria 3748
42 Ga0070659_100269104 3300005366 Unclassified 1415
43 Ga0070709_10050587 3300005434 Bacteria 2604
44 Ga0070709_10096616 3300005434 Bacteria 1959
45 Ga0070709_10253273 3300005434 Bacteria 1269
46 Ga0070714_100000101 3300005435 Bacteria 71577
47 Ga0070714_100001746 3300005435 Bacteria 15844
48 Ga0070714_100113440 3300005435 Bacteria 2403
49 Ga0070714_101492184 3300005435 Unclassified 660
50 Ga0070713_100000675 3300005436 Bacteria 21861
51 Ga0070713_100003078 3300005436 Bacteria 10964
52 Ga0070713_100095360 3300005436 Bacteria 2566
53 Ga0070713_100225307 3300005436 Bacteria 1702
54 Ga0070710_10010586 3300005437 Bacteria 4533
55 Ga0070710_10020932 3300005437 Bacteria 3401
56 Ga0070710_10154923 3300005437 Unclassified 1416
57 Ga0070711_100000076 3300005439 Bacteria 55974
58 Ga0070711_100013225 3300005439 Bacteria 5179
59 Ga0070711_100024970 3300005439 Bacteria 3906
60 Ga0070711_100067912 3300005439 Bacteria 2503
61 Ga0070700_100219078 3300005441 Unclassified 1347
62 Ga0070694_100772777 3300005444 Unclassified 786
63 Ga0070708_100097568 3300005445 Bacteria 2687
64 Ga0070708_100488108 3300005445 Bacteria 1162
65 Ga0070663_100193688 3300005455 Bacteria 1583
66 Ga0070678_100231647 3300005456 Bacteria 1540
67 Ga0070662_100009605 3300005457 Bacteria 6329
68 Ga0070662_100036149 3300005457 Bacteria 3492
69 Ga0070681_10060099 3300005458 Bacteria 3779
70 Ga0070681_10148926 3300005458 Bacteria 2268
71 Ga0070681_10688129 3300005458 Bacteria 938
72 Ga0068867_100008660 3300005459 Bacteria 7184
73 Ga0070685_10004250 3300005466 Bacteria 7225
74 Ga0070707_100035240 3300005468 Bacteria 4774
75 Ga0070707_100284494 3300005468 Bacteria 1607
76 Ga0070698_101125257 3300005471 Bacteria 734
77 Ga0070679_100021973 3300005530 Bacteria 6233
78 Ga0070679_100107120 3300005530 Bacteria 2781
79 Ga0070684_100000472 3300005535 Bacteria 27450
80 Ga0070684_100284314 3300005535 Bacteria 1516
81 Ga0068853_100017617 3300005539 Bacteria 5895
82 Ga0070672_100001294 3300005543 Bacteria 15407
83 Ga0070672_101525415 3300005543 Unclassified 599
84 Ga0070686_100002087 3300005544 Bacteria 11028
85 Ga0070693_100026965 3300005547 Bacteria 3107
86 Ga0070693_100109246 3300005547 Bacteria 1698
87 Ga0068855_100003807 3300005563 Bacteria 18448
88 Ga0068855_100077109 3300005563 Bacteria 3867
89 Ga0070664_100010359 3300005564 Bacteria 7564
90 Ga0070664_100080129 3300005564 Unclassified 2812
91 Ga0068857_100010855 3300005577 Bacteria 7929
92 Ga0068857_100049542 3300005577 Unclassified 3726
93 Ga0068857_100153153 3300005577 Bacteria 2089
94 Ga0068854_100008487 3300005578 Bacteria 6609
95 Ga0068856_100004472 3300005614 Bacteria 13911
96 Ga0068856_100045661 3300005614 Bacteria 4314
97 Ga0068856_100074256 3300005614 Unclassified 3366
98 Ga0070702_100058301 3300005615 Bacteria 2236
99 Ga0068852_100003760 3300005616 Bacteria 10642
100 Ga0068852_100568805 3300005616 Bacteria 1135
101 Ga0068859_100249758 3300005617 Unclassified 1864
102 Ga0068864_100017143 3300005618 Bacteria 6040
103 Ga0068864_100038185 3300005618 Bacteria 4099
104 Ga0068864_100712711 3300005618 Unclassified 981
105 Ga0068866_10000493 3300005718 Bacteria 18141
106 Ga0068861_100188243 3300005719 Bacteria 1723
107 Ga0068851_10012281 3300005834 Bacteria 4033
108 Ga0068851_10016063 3300005834 Bacteria 3577
109 Ga0068870_10003777 3300005840 Bacteria 6442
110 Ga0068863_100047499 3300005841 Bacteria 4071
111 Ga0068863_100265176 3300005841 Unclassified 1661
112 Ga0068863_100446367 3300005841 Bacteria 1269
113 Ga0068858_100025230 3300005842 Bacteria 5532
114 Ga0068860_100231674 3300005843 Unclassified 1795
115 Ga0068862_100012739 3300005844 Bacteria 6960
116 Ga0068862_100691424 3300005844 Unclassified 987
117 Ga0070717_10013204 3300006028 Bacteria 6319
118 Ga0070717_10029343 3300006028 Bacteria 4412
119 Ga0070717_11461280 3300006028 Unclassified 620
120 Ga0070715_10003961 3300006163 Bacteria 4795
121 Ga0070715_10017865 3300006163 Bacteria 2692
122 Ga0070716_100126244 3300006173 Bacteria 1610
123 Ga0070712_100000105 3300006175 Bacteria 43144
124 Ga0070712_100000506 3300006175 Bacteria 22281
125 Ga0070712_101351303 3300006175 Bacteria 621
126 Ga0097621_100073008 3300006237 Bacteria 2839
127 Ga0097621_100468287 3300006237 Bacteria 1137
128 Ga0097621_100905651 3300006237 Unclassified 822
129 Ga0068871_100217518 3300006358 Bacteria 1654
130 Ga0068871_100255497 3300006358 Unclassified 1527
131 Ga0068865_100024696 3300006881 Bacteria 3946
132 Ga0097620_100249750 3300006931 Unclassified 1864
133 Ga0105251_10140365 3300009011 Unclassified 1093
134 Ga0105250_10039110 3300009092 Bacteria 1902
135 Ga0105250_10087702 3300009092 Bacteria 1264
136 Ga0105240_10024763 3300009093 Bacteria 7904
137 Ga0105245_10023261 3300009098 Bacteria 5440
138 Ga0105241_10006198 3300009174 Bacteria 8820
139 Ga0105241_10071223 3300009174 Bacteria 2698
140 Ga0105241_10074474 3300009174 Bacteria 2644
141 Ga0105241_10160840 3300009174 Bacteria 1846
142 Ga0105241_10275236 3300009174 Bacteria 1436
143 Ga0105241_10631344 3300009174 Bacteria 971
144 Ga0105242_10058840 3300009176 Unclassified 3152
145 Ga0105248_10033302 3300009177 Bacteria 5755
146 Ga0105248_10080585 3300009177 Bacteria 3659
147 Ga0105248_10816343 3300009177 Bacteria 1053
148 Ga0105248_11091871 3300009177 Unclassified 902
149 Ga0105237_10045001 3300009545 Bacteria 4443
150 Ga0105238_10289876 3300009551 Bacteria 1619
151 Ga0105238_10696608 3300009551 Unclassified 1028
152 Ga0105249_10026889 3300009553 Bacteria 5188
153 Ga0105249_10125764 3300009553 Bacteria 2441
154 Ga0105239_10079328 3300010375 Unclassified 3612
155 Ga0105239_10378493 3300010375 Bacteria 1600
156 Ga0105239_11528751 3300010375 Unclassified 771
157 Ga0105246_10000935 3300011119 Bacteria 16720
158 Ga0157373_10025035 3300013100 Bacteria 4320
159 Ga0157373_10029545 3300013100 Bacteria 3948
160 Ga0157373_10125013 3300013100 Bacteria 1808
161 Ga0157371_10013625 3300013102 Bacteria 6170
162 Ga0157369_10031061 3300013105 Bacteria 5887
163 Ga0157369_10055261 3300013105 Bacteria 4286
164 Ga0157374_10022579 3300013296 Bacteria 5614
165 Ga0157374_10111825 3300013296 Bacteria 2628
166 Ga0157374_10202122 3300013296 Unclassified 1946
167 Ga0157374_10252586 3300013296 Bacteria 1735
168 Ga0157374_10584604 3300013296 Bacteria 1126
169 Ga0157378_10607820 3300013297 Unclassified 1105
170 Ga0163162_10078233 3300013306 Unclassified 3372
171 Ga0157372_10039871 3300013307 Bacteria 5186
172 Ga0157372_10114715 3300013307 Bacteria 3088
173 Ga0157375_10185469 3300013308 Unclassified 2233
174 Ga0163163_10001888 3300014325 Bacteria 17719
175 Ga0163163_10029419 3300014325 Bacteria 5284
176 Ga0163163_10073991 3300014325 Bacteria 3398
177 Ga0163163_10222922 3300014325 Bacteria 1934
178 Ga0163163_10286594 3300014325 Bacteria 1699
179 Ga0157380_10045649 3300014326 Bacteria 3439
180 Ga0182008_10022217 3300014497 Bacteria 3250
181 Ga0157377_10012137 3300014745 Bacteria 4324
182 Ga0157379_10082119 3300014968 Unclassified 2888
183 Ga0157376_10143127 3300014969 Bacteria 2147
184 Ga0182005_1023414 3300015265 Bacteria 1688
185 Ga0163161_10001198 3300017792 Bacteria 19518
186 Ga0207697_10006536 3300025315 Bacteria 5261
187 Ga0207656_10012602 3300025321 Bacteria 3218
188 Ga0207656_10104487 3300025321 Bacteria 1302
189 Ga0207682_10016969 3300025893 Unclassified 2843
190 Ga0207692_10013400 3300025898 Bacteria 3556
191 Ga0207692_10020798 3300025898 Bacteria 2992
192 Ga0207692_10068348 3300025898 Unclassified 1863
193 Ga0207642_10142576 3300025899 Unclassified 1265
194 Ga0207688_10022246 3300025901 Unclassified 3467
195 Ga0207680_10058398 3300025903 Unclassified 2338
196 Ga0207647_10002605 3300025904 Bacteria 13637
197 Ga0207685_10009485 3300025905 Bacteria 2829
198 Ga0207699_10003382 3300025906 Bacteria 7604
199 Ga0207699_10008682 3300025906 Bacteria 5026
200 Ga0207699_10019119 3300025906 Bacteria 3646
201 Ga0207699_10225208 3300025906 Bacteria 1282
202 Ga0207699_10321796 3300025906 Bacteria 1085
203 Ga0207645_10002044 3300025907 Bacteria 16175
204 Ga0207643_10000248 3300025908 Bacteria 37691
205 Ga0207705_10130702 3300025909 Bacteria 1869
206 Ga0207654_10008437 3300025911 Bacteria 5209
207 Ga0207654_10051806 3300025911 Bacteria 2364
208 Ga0207654_10207600 3300025911 Bacteria 1293
209 Ga0207654_10261478 3300025911 Unclassified 1164
210 Ga0207707_10117743 3300025912 Unclassified 2322
211 Ga0207707_10227573 3300025912 Bacteria 1623
212 Ga0207707_10412863 3300025912 Bacteria 1158
213 Ga0207695_10077432 3300025913 Unclassified 3378
214 Ga0207693_10000016 3300025915 Bacteria 145892
215 Ga0207693_10000065 3300025915 Bacteria 91476
216 Ga0207693_10050443 3300025915 Bacteria 3268
217 Ga0207663_10001491 3300025916 Bacteria 10914
218 Ga0207663_10041900 3300025916 Bacteria 2794
219 Ga0207663_10057661 3300025916 Bacteria 2448
220 Ga0207660_10762127 3300025917 Unclassified 790
221 Ga0207662_10012154 3300025918 Bacteria 4792
222 Ga0207657_10000404 3300025919 Bacteria 45859
223 Ga0207657_10002209 3300025919 Bacteria 21110
224 Ga0207657_10299206 3300025919 Unclassified 1275
225 Ga0207649_10001159 3300025920 Bacteria 15875
226 Ga0207652_10168731 3300025921 Bacteria 1963
227 Ga0207652_10564649 3300025921 Bacteria 1022
228 Ga0207646_10064559 3300025922 Bacteria 3268
229 Ga0207646_10938893 3300025922 Unclassified 766
230 Ga0207681_10127018 3300025923 Bacteria 1879
231 Ga0207694_10187412 3300025924 Bacteria 1680
232 Ga0207650_10000036 3300025925 Bacteria 214579
233 Ga0207650_10329791 3300025925 Unclassified 1251
234 Ga0207650_10331848 3300025925 Bacteria 1247
235 Ga0207659_10019911 3300025926 Bacteria 4426
236 Ga0207687_10121529 3300025927 Unclassified 1954
237 Ga0207700_10000132 3300025928 Bacteria 44689
238 Ga0207700_10000988 3300025928 Bacteria 16396
239 Ga0207700_10094351 3300025928 Bacteria 2371
240 Ga0207700_10566609 3300025928 Bacteria 1009
241 Ga0207700_11505484 3300025928 Unclassified 597
242 Ga0207664_10000111 3300025929 Bacteria 72075
243 Ga0207664_10012656 3300025929 Bacteria 6036
244 Ga0207664_10314419 3300025929 Unclassified 1381
245 Ga0207664_10655698 3300025929 Unclassified 943
246 Ga0207664_10994533 3300025929 Unclassified 752
247 Ga0207644_10048543 3300025931 Unclassified 3035
248 Ga0207644_10674493 3300025931 Bacteria 861
249 Ga0207690_10017756 3300025932 Bacteria 4351
250 Ga0207706_10000301 3300025933 Bacteria 53614
251 Ga0207706_10078195 3300025933 Bacteria 2910
252 Ga0207670_10016460 3300025936 Bacteria 4444
253 Ga0207665_10017293 3300025939 Bacteria 4738
254 Ga0207665_10026475 3300025939 Bacteria 3828
255 Ga0207665_10090926 3300025939 Bacteria 2116
256 Ga0207691_10002309 3300025940 Bacteria 18684
257 Ga0207711_10004607 3300025941 Bacteria 11725
258 Ga0207689_10000669 3300025942 Bacteria 32690
259 Ga0207661_10011380 3300025944 Bacteria 6444
260 Ga0207661_10441041 3300025944 Bacteria 1185
261 Ga0207679_10000162 3300025945 Bacteria 55471
262 Ga0207667_10237004 3300025949 Bacteria 1868
263 Ga0207667_10358771 3300025949 Bacteria 1486
264 Ga0207667_10388919 3300025949 Bacteria 1420
265 Ga0207651_10013663 3300025960 Bacteria 4655
266 Ga0207712_10031706 3300025961 Bacteria 3562
267 Ga0207712_10608712 3300025961 Unclassified 946
268 Ga0207668_10030040 3300025972 Bacteria 3568
269 Ga0207640_10017402 3300025981 Bacteria 4205
270 Ga0207640_10358861 3300025981 Unclassified 1173
271 Ga0207658_10098328 3300025986 Unclassified 2286
272 Ga0207658_10732286 3300025986 Bacteria 895
273 Ga0207677_10083624 3300026023 Bacteria 2298
274 Ga0207677_10379780 3300026023 Bacteria 1192
275 Ga0207703_10068589 3300026035 Bacteria 2922
276 Ga0207639_10042754 3300026041 Bacteria 3398
277 Ga0207678_10021507 3300026067 Bacteria 5656
278 Ga0207678_10415993 3300026067 Bacteria 1165
279 Ga0207708_10176804 3300026075 Bacteria 1693
280 Ga0207702_10002936 3300026078 Bacteria 15945
281 Ga0207702_10023424 3300026078 Bacteria 5121
282 Ga0207702_10049945 3300026078 Bacteria 3530
283 Ga0207641_10000153 3300026088 Bacteria 97933
284 Ga0207641_10022260 3300026088 Bacteria 5216
285 Ga0207641_10072423 3300026088 Bacteria 2967
286 Ga0207641_10106566 3300026088 Bacteria 2478
287 Ga0207648_10000069 3300026089 Bacteria 95981
288 Ga0207676_10000311 3300026095 Bacteria 41694
289 Ga0207676_10058035 3300026095 Bacteria 3051
290 Ga0207674_10000016 3300026116 Bacteria 182470
291 Ga0207674_10007195 3300026116 Bacteria 12991
292 Ga0207674_10112609 3300026116 Bacteria 2695
293 Ga0207675_100039482 3300026118 Bacteria 4405
294 Ga0207683_10000176 3300026121 Bacteria 54804
295 Ga0207683_10135772 3300026121 Bacteria 2214
296 Ga0207698_10152062 3300026142 Bacteria 2010
297 Ga0268266_10001571 3300028379 Bacteria 26702
298 Ga0268264_10090242 3300028381 Bacteria 2641
299 Ga0268264_10164402 3300028381 Unclassified 2002
300 Ga0265336_10142818 3300028666 Bacteria 712
301 Ga0265338_10005376 3300028800 Bacteria 16738
302 Ga0265338_10007981 3300028800 Bacteria 12957
303 Ga0265338_10044756 3300028800 Bacteria 4080
304 Ga0265338_10156884 3300028800 Unclassified 1762
305 Ga0265338_10375831 3300028800 Bacteria 1017
306 Ga0265338_10381109 3300028800 Unclassified 1008
307 Ga0265760_10000582 3300031090 Bacteria 10360
308 Ga0265328_10093485 3300031239 Unclassified 1111
309 Ga0265325_10013227 3300031241 Bacteria 4703
310 Ga0265325_10216704 3300031241 Unclassified 877
311 Ga0265339_10042361 3300031249 Bacteria 2521
312 Ga0265339_10075639 3300031249 Bacteria 1787
313 Ga0265327_10162595 3300031251 Bacteria 1030
314 Ga0265316_10022177 3300031344 Bacteria 5362
315 Ga0265316_10038756 3300031344 Bacteria 3835
316 Ga0265313_10031807 3300031595 Bacteria 2702
317 Ga0265314_10005392 3300031711 Bacteria 11559
318 Ga0265314_10069139 3300031711 Bacteria 2371
319 Ga0265314_10129519 3300031711 Bacteria 1576
320 Ga0265314_10156757 3300031711 Bacteria 1390
321 Ga0307410_10138314 3300031852 Unclassified 1798
322 Ga0307410_10168867 3300031852 Bacteria 1646
323 Ga0307409_100015418 3300031995 Bacteria 5017
324 Ga0307409_100114160 3300031995 Bacteria 2272
325 Ga0307409_100804085 3300031995 Unclassified 948
326 Ga0307416_101560658 3300032002 Unclassified 766
327 Ga0373926_0035937 3300035083 Bacteria 1759
328 Ga0373926_0038890 3300035083 Bacteria 1695
329 Ga0373934_0016766 3300035086 Bacteria 2788
330 Ga0373923_0003346 3300035111 Bacteria 5124
331 Ga0373923_0141963 3300035111 Unclassified 1086
332 Ga0373923_0147946 3300035111 Bacteria 1065
333 Ga0373936_0022356 3300035113 Bacteria 2462
334 Ga0373936_0034995 3300035113 Bacteria 1998
335 Ga0373945_0002730 3300035116 Bacteria 5542
336 Ga0373954_0192556 3300035118 Bacteria 1001
337 Ga0373943_0001484 3300035170 Bacteria 10628
338 Ga0373943_0094508 3300035170 Bacteria 1554
339 Ga0373943_0184536 3300035170 Bacteria 1148
340 Ga0373943_0269158 3300035170 Unclassified 961
341 Ga0373955_0069027 3300035172 Bacteria 1971
342 Ga0373955_0073940 3300035172 Bacteria 1911
343 Ga0373955_0131681 3300035172 Bacteria 1460
344 Ga0373955_0484267 3300035172 Unclassified 755
345 Ga0373924_0116894 3300035410 Unclassified 1156
346 Ga0373924_0328462 3300035410 Unclassified 681
347 Ga0373935_0013771 3300035692 Bacteria 4884
348 Ga0373935_0024666 3300035692 Bacteria 3703
349 Ga0373935_0426094 3300035692 Unclassified 956
350 Ga0373935_0584808 3300035692 Unclassified 816
351 Ga0373935_0757394 3300035692 Unclassified 716
352 Ga0373927_0000016 3300035695 Bacteria 154151
353 Ga0373933_0007417 3300035724 Bacteria 5982
354 Ga0373933_0022212 3300035724 Bacteria 3611
355 Ga0373933_0044419 3300035724 Bacteria 2632
356 Ga0373933_0134238 3300035724 Bacteria 1558
357 Ga0373947_0000154 3300035725 Bacteria 36195
358 Ga0373947_0189308 3300035725 Bacteria 1342
359 Ga0373947_0195140 3300035725 Bacteria 1322
360 Ga0373947_0241610 3300035725 Bacteria 1192
361 Ga0373937_0003309 3300036401 Bacteria 13536
362 Ga0373937_0178760 3300036401 Bacteria 1992
363 Ga0373937_0809061 3300036401 Bacteria 885
364 Ga0373925_0023299 3300037068 Bacteria 4518
365 Ga0373925_0425777 3300037068 Bacteria 1085
366 Ga0373925_0585520 3300037068 Unclassified 918
367 Ga0436360_0045224 3300039438 Unclassified 733
368 Ga0436362_0664754 3300039453 Unclassified 596
369 Ga0451839_0003877 3300041496 Bacteria 594
370 Ga0451577_0445601 3300042876 Bacteria 1176
371 Ga0451577_1289203 3300042876 Unclassified 650
372 Ga0453683_0732660 3300044673 Unclassified 649
373 Ga0466963_0427932 3300044694 Bacteria 933
374 Ga0453684_0188194 3300044712 Bacteria 2417
375 Ga0453684_1141461 3300044712 Unclassified 821
376 Ga0466968_0211793 3300044735 Bacteria 911
377 Ga0451576_0034165 3300045051 Bacteria 5401
378 Ga0451576_0571072 3300045051 Unclassified 1188
379 Ga0451576_1063944 3300045051 Unclassified 847
380 Ga0466967_0030433 3300045976 Bacteria 4530
381 Ga0466967_0510544 3300045976 Bacteria 1180
382 Ga0466967_0846582 3300045976 Unclassified 909
383 Ga0495629_0013591 3300046459 Bacteria 5874
384 Ga0495651_0241480 3300046462 Unclassified 1239
385 Ga0495580_0000243 3300046472 Bacteria 43209
386 Ga0495580_0004718 3300046472 Bacteria 11424
387 Ga0495580_0072028 3300046472 Bacteria 2414
388 Ga0495580_0288477 3300046472 Unclassified 1119
389 Ga0495580_0371675 3300046472 Bacteria 967
390 Ga0495580_0429789 3300046472 Unclassified 888
391 Ga0495580_0573834 3300046472 Unclassified 747
392 Ga0495582_0040561 3300046473 Bacteria 2564
393 Ga0495584_0111842 3300046491 Unclassified 1382
394 Ga0495594_0361969 3300046499 Unclassified 826
395 Ga0495630_0016908 3300046517 Bacteria 5338
396 Ga0495630_0518746 3300046517 Unclassified 914
397 Ga0495666_0101179 3300046526 Unclassified 1358
398 Ga0495665_0078001 3300046531 Bacteria 1743
399 Ga0495665_0157133 3300046531 Bacteria 1186
400 Ga0495658_0078865 3300046683 Bacteria 1928
401 Ga0495669_0009246 3300046684 Bacteria 4153
402 Ga0495669_0198032 3300046684 Bacteria 960
403 Ga0495613_0383975 3300046689 Unclassified 960
404 Ga0495674_0029805 3300047319 Bacteria 4965
405 Ga0495674_0032544 3300047319 Bacteria 4729
406 Ga0495674_0241027 3300047319 Bacteria 1490
407 Ga0495674_0911333 3300047319 Bacteria 678
408 Ga0495602_1130466 3300048088 Unclassified 512
409 Ga0496101_0143466 3300048904 Bacteria 1822
410 Ga0496101_0632714 3300048904 Bacteria 846
411 Ga0496102_0302464 3300048905 Bacteria 1508
412 Ga0496102_0514763 3300048905 Unclassified 1119
413 Ga0496103_0019225 3300048906 Bacteria 4102
414 Ga0496103_0217162 3300048906 Bacteria 1230
415 Ga0496104_0053923 3300048907 Bacteria 3800
416 Ga0496104_0329983 3300048907 Bacteria 1439
417 Ga0496105_0032445 3300048908 Bacteria 4286
418 Ga0496105_0125545 3300048908 Bacteria 2115
419 Ga0496107_0161482 3300048910 Bacteria 1661
420 Ga0496107_0194777 3300048910 Bacteria 1506
421 Ga0496108_0000119 3300048911 Bacteria 77850
422 Ga0496109_0000020 3300048912 Bacteria 189962
423 Ga0496109_0012174 3300048912 Bacteria 7421
424 Ga0496109_0049380 3300048912 Bacteria 3830
425 Ga0496109_1852289 3300048912 Unclassified 536
426 Ga0496110_0015709 3300048913 Bacteria 6307
427 Ga0496110_0078237 3300048913 Unclassified 2944
428 Ga0496111_0005944 3300048914 Bacteria 7872
429 Ga0496111_0017341 3300048914 Bacteria 4978
430 Ga0496111_0662614 3300048914 Bacteria 761
431 Ga0496112_0000490 3300048915 Bacteria 26576
432 Ga0496112_0029257 3300048915 Bacteria 5326
433 Ga0496112_0188378 3300048915 Bacteria 2026
434 Ga0496112_0223933 3300048915 Bacteria 1836
435 Ga0496112_0562233 3300048915 Unclassified 1074
436 Ga0496112_0612753 3300048915 Bacteria 1020
437 Ga0496112_0625739 3300048915 Unclassified 1007
438 Ga0496113_0030923 3300048916 Bacteria 3881
439 Ga0496115_0021346 3300048918 Bacteria 5002
440 Ga0501297_020730 3300049520 Unclassified 821
441 Ga0501067_0320594 3300049583 Unclassified 863
442 Ga0501073_0000938 3300049589 Bacteria 20944
443 Ga0501080_0262336 3300049742 Bacteria 1574
444 Ga0495601_0318333 3300053077 Bacteria 1013
445 Ga0495619_0243474 3300053085 Bacteria 1246
446 Ga0495619_0287147 3300053085 Bacteria 1140
447 Ga0105240_10049282
448 JGI24752J21851_1006134
449 JGI24737J22298_10096936
450 JGI24743J22301_10032784
451 JGI24748J21848_1006896
452 JGI24034J26672_10002281
453 JGI24751J29686_10001601
454 Ga0065712_10383564
455 Ga0065715_10328902
456 Ga0065715_10383203
457 Ga0070658_10087249
458 Ga0070683_100017661
459 Ga0070683_101214890
460 Ga0070670_100363113
461 Ga0070670_100493305
462 Ga0068869_100049535
463 Ga0068869_100312501
464 Ga0070666_10216035
465 Ga0070682_100072540
466 Ga0068868_100003132
467 Ga0068868_100028678
468 Ga0068868_100130258
469 Ga0068868_100160007
470 Ga0070660_100031857
471 Ga0070660_100155154
472 Ga0070660_100157937
473 Ga0070689_100013238
474 Ga0070687_100006689
475 Ga0070661_100010692
476 Ga0070692_10287414
477 Ga0070668_100875779
478 Ga0070669_100008760
479 Ga0070675_100010707
480 Ga0070675_100279395
481 Ga0070671_100433328
482 Ga0070671_100607227
483 Ga0070671_100746470
484 Ga0070674_100814351
485 Ga0070673_100018214
486 Ga0070688_100012217
487 Ga0070659_100038103
488 Ga0070659_100269104
489 Ga0070709_10050587
490 Ga0070709_10096616
491 Ga0070709_10253273
492 Ga0070714_100000101
493 Ga0070714_100001746
494 Ga0070714_100113440
495 Ga0070714_101492184
496 Ga0070713_100000675
497 Ga0070713_100003078
498 Ga0070713_100095360
499 Ga0070713_100225307
500 Ga0070710_10010586
501 Ga0070710_10020932
502 Ga0070710_10154923
503 Ga0070711_100000076
504 Ga0070711_100013225
505 Ga0070711_100024970
506 Ga0070711_100067912
507 Ga0070700_100219078
508 Ga0070694_100772777
509 Ga0070708_100097568
510 Ga0070708_100488108
511 Ga0070663_100193688
512 Ga0070678_100231647
513 Ga0070662_100009605
514 Ga0070662_100036149
515 Ga0070681_10060099
516 Ga0070681_10148926
517 Ga0070681_10688129
518 Ga0068867_100008660
519 Ga0070685_10004250
520 Ga0070707_100035240
521 Ga0070707_100284494
522 Ga0070698_101125257
523 Ga0070679_100021973
524 Ga0070679_100107120
525 Ga0070684_100000472
526 Ga0070684_100284314
527 Ga0068853_100017617
528 Ga0070672_100001294
529 Ga0070672_101525415
530 Ga0070686_100002087
531 Ga0070693_100026965
532 Ga0070693_100109246
533 Ga0068855_100003807
534 Ga0068855_100077109
535 Ga0070664_100010359
536 Ga0070664_100080129
537 Ga0068857_100010855
538 Ga0068857_100049542
539 Ga0068857_100153153
540 Ga0068854_100008487
541 Ga0068856_100004472
542 Ga0068856_100045661
543 Ga0068856_100074256
544 Ga0070702_100058301
545 Ga0068852_100003760
546 Ga0068852_100568805
547 Ga0068859_100249758
548 Ga0068864_100017143
549 Ga0068864_100038185
550 Ga0068864_100712711
551 Ga0068866_10000493
552 Ga0068861_100188243
553 Ga0068851_10012281
554 Ga0068851_10016063
555 Ga0068870_10003777
556 Ga0068863_100047499
557 Ga0068863_100265176
558 Ga0068863_100446367
559 Ga0068858_100025230
560 Ga0068860_100231674
561 Ga0068862_100012739
562 Ga0068862_100691424
563 Ga0070717_10013204
564 Ga0070717_10029343
565 Ga0070717_11461280
566 Ga0070715_10003961
567 Ga0070715_10017865
568 Ga0070716_100126244
569 Ga0070712_100000105
570 Ga0070712_100000506
571 Ga0070712_101351303
572 Ga0097621_100073008
573 Ga0097621_100468287
574 Ga0097621_100905651
575 Ga0068871_100217518
576 Ga0068871_100255497
577 Ga0068865_100024696
578 Ga0097620_100249750
579 Ga0105251_10140365
580 Ga0105250_10039110
581 Ga0105250_10087702
582 Ga0105240_10024763
583 Ga0105245_10023261
584 Ga0105241_10006198
585 Ga0105241_10071223
586 Ga0105241_10074474
587 Ga0105241_10160840
588 Ga0105241_10275236
589 Ga0105241_10631344
590 Ga0105242_10058840
591 Ga0105248_10033302
592 Ga0105248_10080585
593 Ga0105248_10816343
594 Ga0105248_11091871
595 Ga0105237_10045001
596 Ga0105238_10289876
597 Ga0105238_10696608
598 Ga0105249_10026889
599 Ga0105249_10125764
600 Ga0105239_10079328
601 Ga0105239_10378493
602 Ga0105239_11528751
603 Ga0105246_10000935
604 Ga0157373_10025035
605 Ga0157373_10029545
606 Ga0157373_10125013
607 Ga0157371_10013625
608 Ga0157369_10031061
609 Ga0157369_10055261
610 Ga0157374_10022579
611 Ga0157374_10111825
612 Ga0157374_10202122
613 Ga0157374_10252586
614 Ga0157374_10584604
615 Ga0157378_10607820
616 Ga0163162_10078233
617 Ga0157372_10039871
618 Ga0157372_10114715
619 Ga0157375_10185469
620 Ga0163163_10001888
621 Ga0163163_10029419
622 Ga0163163_10073991
623 Ga0163163_10222922
624 Ga0163163_10286594
625 Ga0157380_10045649
626 Ga0182008_10022217
627 Ga0157377_10012137
628 Ga0157379_10082119
629 Ga0157376_10143127
630 Ga0182005_1023414
631 Ga0163161_10001198
632 Ga0207697_10006536
633 Ga0207656_10012602
634 Ga0207656_10104487
635 Ga0207682_10016969
636 Ga0207692_10013400
637 Ga0207692_10020798
638 Ga0207692_10068348
639 Ga0207642_10142576
640 Ga0207688_10022246
641 Ga0207680_10058398
642 Ga0207647_10002605
643 Ga0207685_10009485
644 Ga0207699_10003382
645 Ga0207699_10008682
646 Ga0207699_10019119
647 Ga0207699_10225208
648 Ga0207699_10321796
649 Ga0207645_10002044
650 Ga0207643_10000248
651 Ga0207705_10130702
652 Ga0207654_10008437
653 Ga0207654_10051806
654 Ga0207654_10207600
655 Ga0207654_10261478
656 Ga0207707_10117743
657 Ga0207707_10227573
658 Ga0207707_10412863
659 Ga0207695_10077432
660 Ga0207693_10000016
661 Ga0207693_10000065
662 Ga0207693_10050443
663 Ga0207663_10001491
664 Ga0207663_10041900
665 Ga0207663_10057661
666 Ga0207660_10762127
667 Ga0207662_10012154
668 Ga0207657_10000404
669 Ga0207657_10002209
670 Ga0207657_10299206
671 Ga0207649_10001159
672 Ga0207652_10168731
673 Ga0207652_10564649
674 Ga0207646_10064559
675 Ga0207646_10938893
676 Ga0207681_10127018
677 Ga0207694_10187412
678 Ga0207650_10000036
679 Ga0207650_10329791
680 Ga0207650_10331848
681 Ga0207659_10019911
682 Ga0207687_10121529
683 Ga0207700_10000132
684 Ga0207700_10000988
685 Ga0207700_10094351
686 Ga0207700_10566609
687 Ga0207700_11505484
688 Ga0207664_10000111
689 Ga0207664_10012656
690 Ga0207664_10314419
691 Ga0207664_10655698
692 Ga0207664_10994533
693 Ga0207644_10048543
694 Ga0207644_10674493
695 Ga0207690_10017756
696 Ga0207706_10000301
697 Ga0207706_10078195
698 Ga0207670_10016460
699 Ga0207665_10017293
700 Ga0207665_10026475
701 Ga0207665_10090926
702 Ga0207691_10002309
703 Ga0207711_10004607
704 Ga0207689_10000669
705 Ga0207661_10011380
706 Ga0207661_10441041
707 Ga0207679_10000162
708 Ga0207667_10237004
709 Ga0207667_10358771
710 Ga0207667_10388919
711 Ga0207651_10013663
712 Ga0207712_10031706
713 Ga0207712_10608712
714 Ga0207668_10030040
715 Ga0207640_10017402
716 Ga0207640_10358861
717 Ga0207658_10098328
718 Ga0207658_10732286
719 Ga0207677_10083624
720 Ga0207677_10379780
721 Ga0207703_10068589
722 Ga0207639_10042754
723 Ga0207678_10021507
724 Ga0207678_10415993
725 Ga0207708_10176804
726 Ga0207702_10002936
727 Ga0207702_10023424
728 Ga0207702_10049945
729 Ga0207641_10000153
730 Ga0207641_10022260
731 Ga0207641_10072423
732 Ga0207641_10106566
733 Ga0207648_10000069
734 Ga0207676_10000311
735 Ga0207676_10058035
736 Ga0207674_10000016
737 Ga0207674_10007195
738 Ga0207674_10112609
739 Ga0207675_100039482
740 Ga0207683_10000176
741 Ga0207683_10135772
742 Ga0207698_10152062
743 Ga0268266_10001571
744 Ga0268264_10090242
745 Ga0268264_10164402
746 Ga0265336_10142818
747 Ga0265338_10005376
748 Ga0265338_10007981
749 Ga0265338_10044756
750 Ga0265338_10156884
751 Ga0265338_10375831
752 Ga0265338_10381109
753 Ga0265760_10000582
754 Ga0265328_10093485
755 Ga0265325_10013227
756 Ga0265325_10216704
757 Ga0265339_10042361
758 Ga0265339_10075639
759 Ga0265327_10162595
760 Ga0265316_10022177
761 Ga0265316_10038756
762 Ga0265313_10031807
763 Ga0265314_10005392
764 Ga0265314_10069139
765 Ga0265314_10129519
766 Ga0265314_10156757
767 Ga0307410_10138314
768 Ga0307410_10168867
769 Ga0307409_100015418
770 Ga0307409_100114160
771 Ga0307409_100804085
772 Ga0307416_101560658
773 Ga0373926_0035937
774 Ga0373926_0038890
775 Ga0373934_0016766
776 Ga0373923_0003346
777 Ga0373923_0141963
778 Ga0373923_0147946
779 Ga0373936_0022356
780 Ga0373936_0034995
781 Ga0373945_0002730
782 Ga0373954_0192556
783 Ga0373943_0001484
784 Ga0373943_0094508
785 Ga0373943_0184536
786 Ga0373943_0269158
787 Ga0373955_0069027
788 Ga0373955_0073940
789 Ga0373955_0131681
790 Ga0373955_0484267
791 Ga0373924_0116894
792 Ga0373924_0328462
793 Ga0373935_0013771
794 Ga0373935_0024666
795 Ga0373935_0426094
796 Ga0373935_0584808
797 Ga0373935_0757394
798 Ga0373927_0000016
799 Ga0373933_0007417
800 Ga0373933_0022212
801 Ga0373933_0044419
802 Ga0373933_0134238
803 Ga0373947_0000154
804 Ga0373947_0189308
805 Ga0373947_0195140
806 Ga0373947_0241610
807 Ga0373937_0003309
808 Ga0373937_0178760
809 Ga0373937_0809061
810 Ga0373925_0023299
811 Ga0373925_0425777
812 Ga0373925_0585520
813 Ga0436360_0045224
814 Ga0436362_0664754
815 Ga0451839_0003877
816 Ga0451577_0445601
817 Ga0451577_1289203
818 Ga0453683_0732660
819 Ga0466963_0427932
820 Ga0453684_0188194
821 Ga0453684_1141461
822 Ga0466968_0211793
823 Ga0451576_0034165
824 Ga0451576_0571072
825 Ga0451576_1063944
826 Ga0466967_0030433
827 Ga0466967_0510544
828 Ga0466967_0846582
829 Ga0495629_0013591
830 Ga0495651_0241480
831 Ga0495580_0000243
832 Ga0495580_0004718
833 Ga0495580_0072028
834 Ga0495580_0288477
835 Ga0495580_0371675
836 Ga0495580_0429789
837 Ga0495580_0573834
838 Ga0495582_0040561
839 Ga0495584_0111842
840 Ga0495594_0361969
841 Ga0495630_0016908
842 Ga0495630_0518746
843 Ga0495666_0101179
844 Ga0495665_0078001
845 Ga0495665_0157133
846 Ga0495658_0078865
847 Ga0495669_0009246
848 Ga0495669_0198032
849 Ga0495613_0383975
850 Ga0495674_0029805
851 Ga0495674_0032544
852 Ga0495674_0241027
853 Ga0495674_0911333
854 Ga0495602_1130466
855 Ga0496101_0143466
856 Ga0496101_0632714
857 Ga0496102_0302464
858 Ga0496102_0514763
859 Ga0496103_0019225
860 Ga0496103_0217162
861 Ga0496104_0053923
862 Ga0496104_0329983
863 Ga0496105_0032445
864 Ga0496105_0125545
865 Ga0496107_0161482
866 Ga0496107_0194777
867 Ga0496108_0000119
868 Ga0496109_0000020
869 Ga0496109_0012174
870 Ga0496109_0049380
871 Ga0496109_1852289
872 Ga0496110_0015709
873 Ga0496110_0078237
874 Ga0496111_0005944
875 Ga0496111_0017341
876 Ga0496111_0662614
877 Ga0496112_0000490
878 Ga0496112_0029257
879 Ga0496112_0188378
880 Ga0496112_0223933
881 Ga0496112_0562233
882 Ga0496112_0612753
883 Ga0496112_0625739
884 Ga0496113_0030923
885 Ga0496115_0021346
886 Ga0501297_020730
887 Ga0501067_0320594
888 Ga0501073_0000938
889 Ga0501080_0262336
890 Ga0495601_0318333
891 Ga0495619_0243474
892 Ga0495619_0287147

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07998

Peptidase_M54

Peptidase family M54

72

191

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zvs-assembly3.cif.gz_C crystal structure of archaemetzincin (amza) from archaeoglobus fulgidus at 1.4 a resolution complexed with malonate 0.9009 1 171
3zvs-assembly3.cif.gz_C crystal structure of archaemetzincin (amza) from archaeoglobus fulgidus at 1.4 a resolution complexed with malonate 0.8902 1 171
3lmc-assembly1.cif.gz_A crystal structure of zinc-dependent peptidase from methanocorpusculum labreanum (strain z), northeast structural genomics consortium target mur16 0.887 4 172
2x7m-assembly1.cif.gz_A crystal structure of archaemetzincin (amza) from methanopyrus kandleri at 1.5 a resolution 0.8606 2 177
3lmc-assembly1.cif.gz_A crystal structure of zinc-dependent peptidase from methanocorpusculum labreanum (strain z), northeast structural genomics consortium target mur16 0.8271 4 172
ID Description Score Start End Superfamily
2xhqA01 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.9206 1 172 3.40.390.10
af_Q57729_6_171_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.9103 2 172 3.40.390.10
2xhqA01 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.9042 1 172 3.40.390.10
af_Q57729_6_171_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.9 2 172 3.40.390.10
3lmcA00 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.8819 4 172 3.40.390.10
ID Description Score Start End GO Terms
AF-A0A419EPW0-F1-model_v4 Archemetzincin 0.9797 6 175 GO:0006508
GO:0008237
GO:0008270
AF-Q1INE4-F1-model_v4 Peptidase, zinc-dependent 0.973 1 172 GO:0006508
GO:0008237
GO:0008270
AF-A0A2W6ATV3-F1-model_v4 Peptidase zinc-dependent 0.9683 1 172 GO:0006508
GO:0008237
GO:0008270
GO:0016020
AF-A0A062V6T2-F1-model_v4 Archaemetzincin (EC 3.4.-.-) 0.9644 1 172 GO:0006508
GO:0008237
GO:0008270
GO:0016020
AF-A0A7V2YDH9-F1-model_v4 Matrixin family metalloprotease 0.9644 21 178 GO:0006508
GO:0008237
GO:0008270

Map