F445757
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 446 | 333 | 414 | 236 |
Family's Representative Sequence
| Representative Sequence | 3300033442|Ga0315911_1000004|Ga0315911_1000004454 |
| Length | 261 |
| Sequence | MSEVLLSVDGLAATYNHAIGAVSDVSLVVRPGEIVAVLGANGAGKSTTLQAVSALLPARRGQITAGCILFEGHDLAGISAAALVRAGIVPVLEGRHCFASLTVEENLFTGAIGRDATRAETADDLDRVYTLFPRLKERRRSLAGLTSGGEQQMTAIGRALMSRPRLLVLDEPSMGLAPLVVEGILRALKQLNAEQGLSILVAEQNSTVALRFADHAVVLENGRSVLAGAAAELRRRGDIKTLYLGGSSQVDPSRQPTQAVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 2 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 3 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 4 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 5 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 6 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 7 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 8 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 9 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 10 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 11 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 12 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 13 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 14 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 15 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 16 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 17 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 18 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 19 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 20 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 21 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 22 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 23 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 24 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 25 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 26 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 27 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 28 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 29 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 31 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 103 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 140 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 142 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 143 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 144 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 145 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 146 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 147 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 148 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 149 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 150 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 151 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 152 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 153 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 154 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 155 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 156 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 157 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 158 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 159 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 160 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 161 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 162 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 163 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 164 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 165 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 166 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 167 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 170 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 171 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 172 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 173 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 174 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 175 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 176 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 177 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 178 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 179 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 244 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 245 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 246 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 247 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 248 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 249 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 251 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 252 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 253 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 254 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 255 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 256 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 257 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 258 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 259 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 260 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 261 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 262 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 290 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 293 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 294 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 295 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 296 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 301 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 303 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 306 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 307 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 308 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 309 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 310 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 311 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 312 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 313 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 314 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 315 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 316 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 317 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 318 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 319 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 320 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 321 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 322 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 323 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 324 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 325 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 328 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 329 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 330 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 331 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 332 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 333 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.6 |
| Metatranscriptomes | 0.22 |
| Isolates | 7.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.43 |
| Nodule | 5.16 |
| Rhizoplane | 3.59 |
| Rhizosphere | 68.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10032029 | 3300002459 | Bacteria | 1090 |
| 2 | JGI25160J50197_1000184 | 3300003354 | Bacteria | 53011 |
| 3 | Ga0055526_1027115 | 3300003771 | Bacteria | 1780 |
| 4 | Ga0065165_1001355 | 3300005262 | Bacteria | 27048 |
| 5 | Ga0065715_10000497 | 3300005293 | Bacteria | 10881 |
| 6 | Ga0070658_10305818 | 3300005327 | Bacteria | 1356 |
| 7 | Ga0070658_10629910 | 3300005327 | Bacteria | 930 |
| 8 | Ga0070683_100583644 | 3300005329 | Bacteria | 1069 |
| 9 | Ga0070690_100323744 | 3300005330 | Bacteria | 1111 |
| 10 | Ga0068869_100100923 | 3300005334 | Bacteria | 2182 |
| 11 | Ga0070680_100338414 | 3300005336 | Unclassified | 1278 |
| 12 | Ga0070660_100192178 | 3300005339 | Bacteria | 1654 |
| 13 | Ga0070689_100353547 | 3300005340 | Bacteria | 1233 |
| 14 | Ga0070687_100010290 | 3300005343 | Bacteria | 4040 |
| 15 | Ga0070687_100042854 | 3300005343 | Bacteria | 2296 |
| 16 | Ga0070675_100748797 | 3300005354 | Bacteria | 891 |
| 17 | Ga0070673_100411385 | 3300005364 | Bacteria | 1211 |
| 18 | Ga0070673_100672729 | 3300005364 | Bacteria | 949 |
| 19 | Ga0070703_10002141 | 3300005406 | Bacteria | 5747 |
| 20 | Ga0070701_10010549 | 3300005438 | Bacteria | 4089 |
| 21 | Ga0070700_100082103 | 3300005441 | Bacteria | 2084 |
| 22 | Ga0070708_100004618 | 3300005445 | Bacteria | 10845 |
| 23 | Ga0070678_100491308 | 3300005456 | Bacteria | 1082 |
| 24 | Ga0070662_100176938 | 3300005457 | Bacteria | 1679 |
| 25 | Ga0070681_10073034 | 3300005458 | Bacteria | 3392 |
| 26 | Ga0068867_100059588 | 3300005459 | Unclassified | 2830 |
| 27 | Ga0070706_100004294 | 3300005467 | Bacteria | 13804 |
| 28 | Ga0070707_100088093 | 3300005468 | Bacteria | 3003 |
| 29 | Ga0070698_100021194 | 3300005471 | Bacteria | 6810 |
| 30 | Ga0070679_100106690 | 3300005530 | Bacteria | 2787 |
| 31 | Ga0070684_100055449 | 3300005535 | Bacteria | 3455 |
| 32 | Ga0070686_100043647 | 3300005544 | Bacteria | 2814 |
| 33 | Ga0070695_100006755 | 3300005545 | Bacteria | 6790 |
| 34 | Ga0070695_100218130 | 3300005545 | Bacteria | 1373 |
| 35 | Ga0070696_100049527 | 3300005546 | Bacteria | 2918 |
| 36 | Ga0068855_100737003 | 3300005563 | Bacteria | 1052 |
| 37 | Ga0070664_100052295 | 3300005564 | Bacteria | 3459 |
| 38 | Ga0070664_100109527 | 3300005564 | Bacteria | 2409 |
| 39 | Ga0068857_100006321 | 3300005577 | Bacteria | 10143 |
| 40 | Ga0068857_100038046 | 3300005577 | Bacteria | 4261 |
| 41 | Ga0068854_100693887 | 3300005578 | Bacteria | 878 |
| 42 | Ga0068852_100422571 | 3300005616 | Bacteria | 1315 |
| 43 | Ga0068864_100029756 | 3300005618 | Bacteria | 4628 |
| 44 | Ga0068861_100164346 | 3300005719 | Bacteria | 1834 |
| 45 | Ga0068863_100006766 | 3300005841 | Bacteria | 11240 |
| 46 | Ga0068858_100397793 | 3300005842 | Bacteria | 1323 |
| 47 | Ga0068858_100502023 | 3300005842 | Bacteria | 1172 |
| 48 | Ga0068860_100094431 | 3300005843 | Bacteria | 2851 |
| 49 | Ga0068862_100396123 | 3300005844 | Bacteria | 1291 |
| 50 | Ga0081455_10000919 | 3300005937 | Bacteria | 37836 |
| 51 | Ga0081455_10278914 | 3300005937 | Bacteria | 1208 |
| 52 | Ga0081539_10014335 | 3300005985 | Bacteria | 5872 |
| 53 | Ga0081539_10035583 | 3300005985 | Bacteria | 2989 |
| 54 | Ga0070717_10257275 | 3300006028 | Bacteria | 1544 |
| 55 | Ga0075363_100117106 | 3300006048 | Bacteria | 1485 |
| 56 | Ga0075363_100222982 | 3300006048 | Bacteria | 1081 |
| 57 | Ga0075364_10005042 | 3300006051 | Bacteria | 7654 |
| 58 | Ga0075364_10005490 | 3300006051 | Bacteria | 7374 |
| 59 | Ga0075432_10061487 | 3300006058 | Bacteria | 1338 |
| 60 | Ga0070712_100009522 | 3300006175 | Bacteria | 6126 |
| 61 | Ga0075362_10000810 | 3300006177 | Bacteria | 9342 |
| 62 | Ga0075367_10026177 | 3300006178 | Bacteria | 3305 |
| 63 | Ga0075367_10058592 | 3300006178 | Bacteria | 2292 |
| 64 | Ga0075369_10064455 | 3300006186 | Bacteria | 1604 |
| 65 | Ga0075369_10070025 | 3300006186 | Bacteria | 1543 |
| 66 | Ga0097621_100000445 | 3300006237 | Bacteria | 28963 |
| 67 | Ga0068871_100001310 | 3300006358 | Bacteria | 16647 |
| 68 | Ga0075428_100000426 | 3300006844 | Bacteria | 41901 |
| 69 | Ga0075431_100000059 | 3300006847 | Bacteria | 61740 |
| 70 | Ga0075431_100318143 | 3300006847 | Bacteria | 1570 |
| 71 | Ga0075429_100007528 | 3300006880 | Bacteria | 9453 |
| 72 | Ga0105250_10062777 | 3300009092 | Bacteria | 1495 |
| 73 | Ga0105240_10181444 | 3300009093 | Bacteria | 2484 |
| 74 | Ga0111539_10002614 | 3300009094 | Bacteria | 23869 |
| 75 | Ga0105245_10465815 | 3300009098 | Bacteria | 1275 |
| 76 | Ga0105247_10008352 | 3300009101 | Bacteria | 6313 |
| 77 | Ga0114129_10001483 | 3300009147 | Bacteria | 31789 |
| 78 | Ga0105243_10048496 | 3300009148 | Bacteria | 3348 |
| 79 | Ga0105243_10085525 | 3300009148 | Bacteria | 2585 |
| 80 | Ga0105243_10134635 | 3300009148 | Bacteria | 2101 |
| 81 | Ga0105241_10077007 | 3300009174 | Bacteria | 2602 |
| 82 | Ga0105242_10095815 | 3300009176 | Bacteria | 2506 |
| 83 | Ga0105248_10056291 | 3300009177 | Bacteria | 4412 |
| 84 | Ga0105248_10896585 | 3300009177 | Bacteria | 1001 |
| 85 | Ga0105238_10699783 | 3300009551 | Bacteria | 1025 |
| 86 | Ga0157373_10195930 | 3300013100 | Bacteria | 1424 |
| 87 | Ga0157370_10012366 | 3300013104 | Bacteria | 8856 |
| 88 | Ga0157375_10146313 | 3300013308 | Bacteria | 2494 |
| 89 | Ga0157375_10592043 | 3300013308 | Bacteria | 1269 |
| 90 | Ga0157380_10042555 | 3300014326 | Bacteria | 3550 |
| 91 | Ga0157380_10111236 | 3300014326 | Bacteria | 2302 |
| 92 | Ga0157376_10126616 | 3300014969 | Bacteria | 2273 |
| 93 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 94 | Ga0163161_10089107 | 3300017792 | Bacteria | 2281 |
| 95 | Ga0213874_10018031 | 3300021377 | Bacteria | 1903 |
| 96 | Ga0209233_1005652 | 3300025261 | Bacteria | 4129 |
| 97 | Ga0209130_1012227 | 3300025284 | Bacteria | 2258 |
| 98 | Ga0209675_1007782 | 3300025291 | Bacteria | 4042 |
| 99 | Ga0209564_1009934 | 3300025295 | Bacteria | 4452 |
| 100 | Ga0209050_1008405 | 3300025298 | Bacteria | 5528 |
| 101 | Ga0207426_1000004 | 3300025302 | Bacteria | 1047900 |
| 102 | Ga0207655_1003880 | 3300025728 | Bacteria | 10876 |
| 103 | Ga0207653_10000347 | 3300025885 | Bacteria | 23308 |
| 104 | Ga0207692_10208072 | 3300025898 | Bacteria | 1154 |
| 105 | Ga0207684_10060230 | 3300025910 | Bacteria | 3224 |
| 106 | Ga0207707_10043643 | 3300025912 | Bacteria | 3910 |
| 107 | Ga0207695_10200123 | 3300025913 | Bacteria | 1912 |
| 108 | Ga0207693_10001023 | 3300025915 | Bacteria | 25036 |
| 109 | Ga0207662_10015134 | 3300025918 | Bacteria | 4336 |
| 110 | Ga0207662_10046606 | 3300025918 | Bacteria | 2564 |
| 111 | Ga0207662_10087480 | 3300025918 | Bacteria | 1911 |
| 112 | Ga0207657_10150193 | 3300025919 | Bacteria | 1898 |
| 113 | Ga0207652_10062154 | 3300025921 | Bacteria | 3227 |
| 114 | Ga0207646_10137140 | 3300025922 | Bacteria | 2203 |
| 115 | Ga0207700_10531295 | 3300025928 | Bacteria | 1043 |
| 116 | Ga0207664_10234250 | 3300025929 | Bacteria | 1597 |
| 117 | Ga0207706_10017144 | 3300025933 | Bacteria | 6531 |
| 118 | Ga0207709_10024152 | 3300025935 | Bacteria | 3468 |
| 119 | Ga0207709_10541817 | 3300025935 | Bacteria | 914 |
| 120 | Ga0207670_10120153 | 3300025936 | Bacteria | 1908 |
| 121 | Ga0207691_10407264 | 3300025940 | Bacteria | 1160 |
| 122 | Ga0207711_10015828 | 3300025941 | Bacteria | 6256 |
| 123 | Ga0207711_10477125 | 3300025941 | Bacteria | 1162 |
| 124 | Ga0207689_10087541 | 3300025942 | Bacteria | 2559 |
| 125 | Ga0207679_10057291 | 3300025945 | Bacteria | 2881 |
| 126 | Ga0207679_10098746 | 3300025945 | Bacteria | 2278 |
| 127 | Ga0207651_10707821 | 3300025960 | Bacteria | 888 |
| 128 | Ga0207640_10112480 | 3300025981 | Bacteria | 1933 |
| 129 | Ga0207658_10396707 | 3300025986 | Bacteria | 1212 |
| 130 | Ga0207703_10385764 | 3300026035 | Bacteria | 1297 |
| 131 | Ga0207639_10279707 | 3300026041 | Bacteria | 1467 |
| 132 | Ga0207708_10062030 | 3300026075 | Bacteria | 2855 |
| 133 | Ga0207648_10063456 | 3300026089 | Bacteria | 3220 |
| 134 | Ga0207648_10136318 | 3300026089 | Unclassified | 2162 |
| 135 | Ga0207676_10062656 | 3300026095 | Bacteria | 2950 |
| 136 | Ga0207674_10006766 | 3300026116 | Bacteria | 13453 |
| 137 | Ga0207674_10221287 | 3300026116 | Bacteria | 1841 |
| 138 | Ga0207674_10239807 | 3300026116 | Bacteria | 1760 |
| 139 | Ga0207683_10606520 | 3300026121 | Bacteria | 1013 |
| 140 | Ga0207428_10009343 | 3300027907 | Bacteria | 8795 |
| 141 | Ga0207428_10096413 | 3300027907 | Bacteria | 2290 |
| 142 | Ga0268265_10341159 | 3300028380 | Bacteria | 1364 |
| 143 | Ga0265337_1002183 | 3300028556 | Bacteria | 9169 |
| 144 | Ga0307517_10000035 | 3300028786 | Bacteria | 172762 |
| 145 | Ga0307515_10092206 | 3300028794 | Bacteria | 3773 |
| 146 | Ga0316181_1037493 | 3300030744 | Bacteria | 1297 |
| 147 | Ga0265762_1003372 | 3300030760 | Bacteria | 2860 |
| 148 | Ga0265332_10052084 | 3300031238 | Bacteria | 1758 |
| 149 | Ga0265340_10015775 | 3300031247 | Bacteria | 3920 |
| 150 | Ga0265342_10183260 | 3300031712 | Bacteria | 1146 |
| 151 | Ga0307410_10559436 | 3300031852 | Bacteria | 949 |
| 152 | Ga0307407_10216783 | 3300031903 | Bacteria | 1292 |
| 153 | Ga0307416_101143540 | 3300032002 | Bacteria | 884 |
| 154 | Ga0315911_1000004 | 3300033442 | Bacteria | 472637 |
| 155 | Ga0373929_0019800 | 3300035085 | Bacteria | 1351 |
| 156 | Ga0373934_0023702 | 3300035086 | Bacteria | 2372 |
| 157 | Ga0373932_0024236 | 3300035112 | Bacteria | 1631 |
| 158 | Ga0373936_0057790 | 3300035113 | Bacteria | 1578 |
| 159 | Ga0373941_0018218 | 3300035115 | Bacteria | 1937 |
| 160 | Ga0373954_0007126 | 3300035118 | Bacteria | 4881 |
| 161 | Ga0373955_0006860 | 3300035172 | Bacteria | 5207 |
| 162 | Ga0373961_0040940 | 3300035241 | Bacteria | 1337 |
| 163 | Ga0373924_0004152 | 3300035410 | Bacteria | 5039 |
| 164 | Ga0373931_0004070 | 3300035691 | Bacteria | 6628 |
| 165 | Ga0373931_0011184 | 3300035691 | Bacteria | 4332 |
| 166 | Ga0373935_0023511 | 3300035692 | Bacteria | 3787 |
| 167 | Ga0373927_0022365 | 3300035695 | Bacteria | 4142 |
| 168 | Ga0373933_0002610 | 3300035724 | Bacteria | 10097 |
| 169 | Ga0373933_0495012 | 3300035724 | Bacteria | 801 |
| 170 | Ga0373947_0019484 | 3300035725 | Bacteria | 3912 |
| 171 | Ga0373937_0000403 | 3300036401 | Bacteria | 40423 |
| 172 | Ga0373925_0099271 | 3300037068 | Bacteria | 2236 |
| 173 | Ga0436365_1559602 | 3300039437 | Bacteria | 2213 |
| 174 | Ga0436360_0985056 | 3300039438 | Bacteria | 2485 |
| 175 | Ga0436363_0388188 | 3300039450 | Bacteria | 2490 |
| 176 | Ga0436362_0480253 | 3300039453 | Bacteria | 1332 |
| 177 | Ga0439435_0019353 | 3300042436 | Bacteria | 1744 |
| 178 | Ga0466965_0039658 | 3300044683 | Bacteria | 2316 |
| 179 | Ga0466966_0040659 | 3300044684 | Bacteria | 2992 |
| 180 | Ga0466957_0069541 | 3300044842 | Bacteria | 2175 |
| 181 | Ga0466959_0001589 | 3300045049 | Bacteria | 14001 |
| 182 | Ga0466959_0404122 | 3300045049 | Bacteria | 928 |
| 183 | Ga0451576_0015893 | 3300045051 | Bacteria | 8321 |
| 184 | Ga0495592_0017240 | 3300046454 | Bacteria | 5485 |
| 185 | Ga0495603_0008270 | 3300046455 | Bacteria | 6288 |
| 186 | Ga0495590_0002032 | 3300046457 | Bacteria | 8498 |
| 187 | Ga0495590_0022188 | 3300046457 | Bacteria | 2245 |
| 188 | Ga0495629_0000119 | 3300046459 | Bacteria | 69922 |
| 189 | Ga0495629_0000687 | 3300046459 | Bacteria | 27397 |
| 190 | Ga0495638_0000558 | 3300046460 | Bacteria | 42376 |
| 191 | Ga0495638_0002784 | 3300046460 | Bacteria | 14041 |
| 192 | Ga0495638_0013995 | 3300046460 | Bacteria | 5439 |
| 193 | Ga0495638_0061936 | 3300046460 | Bacteria | 2310 |
| 194 | Ga0495651_0000185 | 3300046462 | Bacteria | 46374 |
| 195 | Ga0495653_0000105 | 3300046463 | Bacteria | 69642 |
| 196 | Ga0495653_0000831 | 3300046463 | Bacteria | 23809 |
| 197 | Ga0495650_0010109 | 3300046471 | Bacteria | 5297 |
| 198 | Ga0495580_0025976 | 3300046472 | Bacteria | 4273 |
| 199 | Ga0495582_0061341 | 3300046473 | Bacteria | 2076 |
| 200 | Ga0495605_0003091 | 3300046474 | Bacteria | 10041 |
| 201 | Ga0495605_0010868 | 3300046474 | Bacteria | 5084 |
| 202 | Ga0495605_0077974 | 3300046474 | Bacteria | 1553 |
| 203 | Ga0495607_0004389 | 3300046501 | Bacteria | 10395 |
| 204 | Ga0495583_0012502 | 3300046506 | Bacteria | 4796 |
| 205 | Ga0495583_0055061 | 3300046506 | Bacteria | 1798 |
| 206 | Ga0495606_0033922 | 3300046507 | Bacteria | 3512 |
| 207 | Ga0495606_0109565 | 3300046507 | Bacteria | 1667 |
| 208 | Ga0495608_0000598 | 3300046511 | Bacteria | 24822 |
| 209 | Ga0495610_0003810 | 3300046512 | Bacteria | 11500 |
| 210 | Ga0495610_0005191 | 3300046512 | Bacteria | 9327 |
| 211 | Ga0495616_0005685 | 3300046513 | Bacteria | 7639 |
| 212 | Ga0495616_0008108 | 3300046513 | Bacteria | 6254 |
| 213 | Ga0495616_0008326 | 3300046513 | Bacteria | 6151 |
| 214 | Ga0495620_0008148 | 3300046515 | Bacteria | 5640 |
| 215 | Ga0495620_0034480 | 3300046515 | Bacteria | 2286 |
| 216 | Ga0495628_0012799 | 3300046516 | Bacteria | 7065 |
| 217 | Ga0495628_0032327 | 3300046516 | Bacteria | 4224 |
| 218 | Ga0495630_0002805 | 3300046517 | Bacteria | 12087 |
| 219 | Ga0495630_0024003 | 3300046517 | Bacteria | 4509 |
| 220 | Ga0495631_0003347 | 3300046518 | Bacteria | 8791 |
| 221 | Ga0495637_0086374 | 3300046520 | Bacteria | 1244 |
| 222 | Ga0495648_0037818 | 3300046524 | Bacteria | 3096 |
| 223 | Ga0495648_0229186 | 3300046524 | Bacteria | 910 |
| 224 | Ga0495666_0024032 | 3300046526 | Bacteria | 3014 |
| 225 | Ga0495652_0001337 | 3300046529 | Bacteria | 27446 |
| 226 | Ga0495654_0004228 | 3300046530 | Bacteria | 8583 |
| 227 | Ga0495654_0007875 | 3300046530 | Bacteria | 5925 |
| 228 | Ga0495665_0022743 | 3300046531 | Bacteria | 3367 |
| 229 | Ga0495640_0046814 | 3300046533 | Bacteria | 2995 |
| 230 | Ga0495587_0003497 | 3300046536 | Bacteria | 10458 |
| 231 | Ga0495609_0020394 | 3300046538 | Bacteria | 3063 |
| 232 | Ga0495622_0007226 | 3300046557 | Bacteria | 5155 |
| 233 | Ga0495667_0002126 | 3300046559 | Bacteria | 13187 |
| 234 | Ga0495634_0001253 | 3300046642 | Bacteria | 23332 |
| 235 | Ga0495611_0009097 | 3300046648 | Bacteria | 4199 |
| 236 | Ga0495625_0013426 | 3300046660 | Bacteria | 6583 |
| 237 | Ga0495625_0041326 | 3300046660 | Bacteria | 3357 |
| 238 | Ga0495625_0362531 | 3300046660 | Bacteria | 913 |
| 239 | Ga0495588_0121771 | 3300046674 | Bacteria | 1375 |
| 240 | Ga0495588_0203171 | 3300046674 | Bacteria | 1047 |
| 241 | Ga0495657_0009967 | 3300046675 | Bacteria | 7168 |
| 242 | Ga0495599_0001430 | 3300046678 | Bacteria | 13677 |
| 243 | Ga0495623_0002363 | 3300046679 | Bacteria | 12552 |
| 244 | Ga0495646_0001973 | 3300046680 | Bacteria | 12375 |
| 245 | Ga0495646_0012891 | 3300046680 | Bacteria | 5315 |
| 246 | Ga0495669_0031681 | 3300046684 | Bacteria | 2322 |
| 247 | Ga0495613_0072504 | 3300046689 | Bacteria | 2510 |
| 248 | Ga0495613_0143302 | 3300046689 | Bacteria | 1706 |
| 249 | Ga0495624_0107517 | 3300046690 | Bacteria | 1716 |
| 250 | Ga0495649_0098741 | 3300046694 | Bacteria | 1553 |
| 251 | Ga0495589_0019487 | 3300046794 | Bacteria | 3477 |
| 252 | Ga0495589_0020644 | 3300046794 | Bacteria | 3369 |
| 253 | Ga0495600_0000663 | 3300046809 | Bacteria | 17927 |
| 254 | Ga0495660_0126627 | 3300046810 | Bacteria | 1286 |
| 255 | Ga0495604_0000478 | 3300047317 | Bacteria | 35243 |
| 256 | Ga0495674_0005391 | 3300047319 | Bacteria | 12279 |
| 257 | Ga0495674_0047204 | 3300047319 | Bacteria | 3819 |
| 258 | Ga0495676_0082146 | 3300047321 | Bacteria | 2439 |
| 259 | Ga0495676_0186038 | 3300047321 | Bacteria | 1452 |
| 260 | Ga0495680_0000640 | 3300047322 | Bacteria | 39222 |
| 261 | Ga0495683_0034087 | 3300047323 | Bacteria | 2589 |
| 262 | Ga0495683_0048843 | 3300047323 | Bacteria | 2120 |
| 263 | Ga0495687_017631 | 3300047443 | Bacteria | 3554 |
| 264 | Ga0495675_0003306 | 3300047444 | Bacteria | 9693 |
| 265 | Ga0495677_0011179 | 3300047445 | Bacteria | 3286 |
| 266 | Ga0495679_000036 | 3300047446 | Bacteria | 161473 |
| 267 | Ga0495673_0005195 | 3300047469 | Bacteria | 7922 |
| 268 | Ga0495686_0006696 | 3300047472 | Bacteria | 8767 |
| 269 | Ga0495593_0012854 | 3300047673 | Bacteria | 4782 |
| 270 | Ga0495602_0028131 | 3300048088 | Bacteria | 5385 |
| 271 | Ga0495614_0049840 | 3300048089 | Bacteria | 1795 |
| 272 | Ga0495626_0023838 | 3300048091 | Bacteria | 3007 |
| 273 | Ga0495626_0042998 | 3300048091 | Bacteria | 2121 |
| 274 | Ga0496100_0000086 | 3300048903 | Bacteria | 53043 |
| 275 | Ga0496101_0000044 | 3300048904 | Bacteria | 161295 |
| 276 | Ga0496101_0000224 | 3300048904 | Bacteria | 42435 |
| 277 | Ga0496102_0010285 | 3300048905 | Bacteria | 8044 |
| 278 | Ga0496102_0241086 | 3300048905 | Bacteria | 1705 |
| 279 | Ga0496103_0001893 | 3300048906 | Bacteria | 13609 |
| 280 | Ga0496104_0321329 | 3300048907 | Bacteria | 1461 |
| 281 | Ga0496105_0003748 | 3300048908 | Bacteria | 11325 |
| 282 | Ga0496106_0078646 | 3300048909 | Bacteria | 2531 |
| 283 | Ga0496107_0138143 | 3300048910 | Bacteria | 1801 |
| 284 | Ga0496109_0434765 | 3300048912 | Bacteria | 1240 |
| 285 | Ga0496109_0503906 | 3300048912 | Bacteria | 1143 |
| 286 | Ga0496112_0056945 | 3300048915 | Bacteria | 3848 |
| 287 | Ga0496113_0002020 | 3300048916 | Bacteria | 11646 |
| 288 | Ga0496113_0537949 | 3300048916 | Bacteria | 937 |
| 289 | Ga0496116_0003806 | 3300048919 | Bacteria | 14746 |
| 290 | Ga0496116_0047388 | 3300048919 | Bacteria | 2893 |
| 291 | Ga0496116_0047641 | 3300048919 | Bacteria | 2884 |
| 292 | Ga0496116_0064446 | 3300048919 | Bacteria | 2355 |
| 293 | Ga0496116_0093811 | 3300048919 | Bacteria | 1816 |
| 294 | Ga0496117_0000098 | 3300048920 | Bacteria | 196331 |
| 295 | Ga0496117_0002577 | 3300048920 | Bacteria | 22566 |
| 296 | Ga0496117_0017448 | 3300048920 | Bacteria | 5993 |
| 297 | Ga0496117_0026156 | 3300048920 | Bacteria | 4571 |
| 298 | Ga0496117_0086948 | 3300048920 | Bacteria | 2028 |
| 299 | Ga0496117_0114277 | 3300048920 | Bacteria | 1674 |
| 300 | Ga0496118_0000728 | 3300048921 | Bacteria | 53140 |
| 301 | Ga0496118_0007352 | 3300048921 | Bacteria | 11712 |
| 302 | Ga0496118_0025602 | 3300048921 | Bacteria | 5051 |
| 303 | Ga0496119_0105287 | 3300048922 | Bacteria | 1576 |
| 304 | Ga0496119_0116542 | 3300048922 | Bacteria | 1474 |
| 305 | Ga0496121_0000643 | 3300048924 | Bacteria | 65217 |
| 306 | Ga0496121_0004299 | 3300048924 | Bacteria | 19303 |
| 307 | Ga0496121_0013301 | 3300048924 | Bacteria | 8859 |
| 308 | Ga0496121_0021173 | 3300048924 | Bacteria | 6385 |
| 309 | Ga0496121_0023049 | 3300048924 | Bacteria | 6014 |
| 310 | Ga0496121_0026019 | 3300048924 | Bacteria | 5532 |
| 311 | Ga0496121_0131176 | 3300048924 | Bacteria | 1875 |
| 312 | Ga0496122_0021785 | 3300048925 | Bacteria | 5720 |
| 313 | Ga0496122_0095067 | 3300048925 | Bacteria | 2015 |
| 314 | Ga0496122_0130652 | 3300048925 | Bacteria | 1596 |
| 315 | Ga0496122_0131798 | 3300048925 | Bacteria | 1586 |
| 316 | Ga0496123_0002639 | 3300048926 | Bacteria | 21715 |
| 317 | Ga0496123_0041512 | 3300048926 | Bacteria | 3188 |
| 318 | Ga0496123_0114290 | 3300048926 | Bacteria | 1535 |
| 319 | Ga0496124_0459077 | 3300048927 | Bacteria | 866 |
| 320 | Ga0496125_0001227 | 3300048928 | Bacteria | 38397 |
| 321 | Ga0496125_0056455 | 3300048928 | Bacteria | 3188 |
| 322 | Ga0496125_0074948 | 3300048928 | Bacteria | 2621 |
| 323 | Ga0496125_0187036 | 3300048928 | Bacteria | 1372 |
| 324 | Ga0496126_0027842 | 3300048929 | Bacteria | 5391 |
| 325 | Ga0496126_0107852 | 3300048929 | Bacteria | 2429 |
| 326 | Ga0496126_0218149 | 3300048929 | Bacteria | 1604 |
| 327 | Ga0496126_0308227 | 3300048929 | Bacteria | 1304 |
| 328 | Ga0496126_0564602 | 3300048929 | Bacteria | 901 |
| 329 | Ga0495678_017335 | 3300049459 | Bacteria | 3267 |
| 330 | Ga0495682_0011728 | 3300049460 | Bacteria | 3368 |
| 331 | Ga0495682_0024899 | 3300049460 | Bacteria | 2228 |
| 332 | Ga0501031_0256804 | 3300049568 | Bacteria | 1136 |
| 333 | Ga0501032_0007033 | 3300049569 | Bacteria | 8252 |
| 334 | Ga0501033_0010149 | 3300049570 | Bacteria | 7229 |
| 335 | Ga0501034_0075155 | 3300049571 | Bacteria | 3386 |
| 336 | Ga0501036_0004663 | 3300049572 | Bacteria | 11075 |
| 337 | Ga0501036_0914929 | 3300049572 | Bacteria | 720 |
| 338 | Ga0501037_0005193 | 3300049573 | Bacteria | 9470 |
| 339 | Ga0501038_0010330 | 3300049574 | Bacteria | 8539 |
| 340 | Ga0501038_0363660 | 3300049574 | Bacteria | 1125 |
| 341 | Ga0501039_0068875 | 3300049575 | Bacteria | 2747 |
| 342 | Ga0501042_0164376 | 3300049578 | Bacteria | 1601 |
| 343 | Ga0501043_0010483 | 3300049579 | Bacteria | 7258 |
| 344 | Ga0501046_0013654 | 3300049580 | Bacteria | 6869 |
| 345 | Ga0501046_0334927 | 3300049580 | Bacteria | 1101 |
| 346 | Ga0501047_0092567 | 3300049581 | Bacteria | 2901 |
| 347 | Ga0501047_0152425 | 3300049581 | Bacteria | 2187 |
| 348 | Ga0501048_0033786 | 3300049582 | Bacteria | 3693 |
| 349 | Ga0501048_0220992 | 3300049582 | Bacteria | 1344 |
| 350 | Ga0501067_0070124 | 3300049583 | Bacteria | 1941 |
| 351 | Ga0501068_0049668 | 3300049584 | Bacteria | 2534 |
| 352 | Ga0501069_0009548 | 3300049585 | Bacteria | 5122 |
| 353 | Ga0501070_0019709 | 3300049586 | Bacteria | 5656 |
| 354 | Ga0501071_0299975 | 3300049587 | Bacteria | 1218 |
| 355 | Ga0501073_0011504 | 3300049589 | Bacteria | 6470 |
| 356 | Ga0501074_0035277 | 3300049590 | Bacteria | 3623 |
| 357 | Ga0501076_0196732 | 3300049592 | Bacteria | 1646 |
| 358 | Ga0501077_0198064 | 3300049593 | Bacteria | 1276 |
| 359 | Ga0501079_0426866 | 3300049741 | Bacteria | 1041 |
| 360 | Ga0501080_0008356 | 3300049742 | Bacteria | 9373 |
| 361 | Ga0501083_0001455 | 3300049744 | Bacteria | 16165 |
| 362 | Ga0501083_0024844 | 3300049744 | Bacteria | 4150 |
| 363 | Ga0501083_0035426 | 3300049744 | Bacteria | 3409 |
| 364 | Ga0501262_000165 | 3300049759 | Bacteria | 8174 |
| 365 | Ga0501035_0026098 | 3300049822 | Bacteria | 5350 |
| 366 | Ga0501044_0024850 | 3300049823 | Bacteria | 6354 |
| 367 | Ga0501044_0428882 | 3300049823 | Bacteria | 1231 |
| 368 | nmdc:mga00v17_27032_c1 | 3300050491 | Bacteria | 3347 |
| 369 | nmdc:mga00v17_42903_c1 | 3300050491 | Bacteria | 2722 |
| 370 | nmdc:mga0yw44_353828_c1 | 3300050492 | Bacteria | 989 |
| 371 | nmdc:mga0k408_6128_c1 | 3300050493 | Bacteria | 6411 |
| 372 | nmdc:mga06z11_78451_c1 | 3300050494 | Bacteria | 1765 |
| 373 | nmdc:mga05p37_285_c1 | 3300050507 | Bacteria | 52916 |
| 374 | nmdc:mga09592_9564_c1 | 3300050508 | Bacteria | 7877 |
| 375 | nmdc:mga06r32_118_c1 | 3300050510 | Bacteria | 56778 |
| 376 | nmdc:mga06r32_254298_c1 | 3300050510 | Bacteria | 1744 |
| 377 | nmdc:mga08y16_293295_c1 | 3300050511 | Bacteria | 1677 |
| 378 | nmdc:mga08y16_303_c1 | 3300050511 | Bacteria | 44322 |
| 379 | nmdc:mga0sz30_9739_c1 | 3300050516 | Bacteria | 3664 |
| 380 | Ga0495601_0001131 | 3300053077 | Bacteria | 14620 |
| 381 | Ga0500635_0036175 | 3300053080 | Bacteria | 1626 |
| 382 | Ga0495595_0000142 | 3300053084 | Bacteria | 29571 |
| 383 | Ga0495619_0003389 | 3300053085 | Bacteria | 10299 |
| 384 | Ga0495619_0053191 | 3300053085 | Bacteria | 2677 |
| 385 | Ga0500643_002411 | 3300053087 | Bacteria | 9688 |
| 386 | Ga0500643_029605 | 3300053087 | Bacteria | 1683 |
| 387 | Ga0500644_0023243 | 3300053088 | Bacteria | 1880 |
| 388 | Ga0500644_0181436 | 3300053088 | Bacteria | 862 |
| 389 | Ga0500651_0077910 | 3300053093 | Bacteria | 2056 |
| 390 | Ga0500566_0154254 | 3300053094 | Bacteria | 1204 |
| 391 | Ga0500556_0000003 | 3300053104 | Bacteria | 679379 |
| 392 | Ga0500556_0011257 | 3300053104 | Bacteria | 2646 |
| 393 | Ga0500562_041104 | 3300053108 | Bacteria | 1229 |
| 394 | Ga0500592_003029 | 3300053116 | Bacteria | 2686 |
| 395 | Ga0500594_0002223 | 3300053118 | Bacteria | 4203 |
| 396 | Ga0500595_003700 | 3300053119 | Bacteria | 7055 |
| 397 | Ga0500626_030117 | 3300053128 | Bacteria | 2449 |
| 398 | Ga0500652_000921 | 3300053131 | Bacteria | 9694 |
| 399 | Ga0500658_0000058 | 3300053134 | Bacteria | 55299 |
| 400 | Ga0500559_0004819 | 3300053136 | Bacteria | 6305 |
| 401 | Ga0500568_0001594 | 3300053139 | Bacteria | 14345 |
| 402 | Ga0500568_0001943 | 3300053139 | Bacteria | 12668 |
| 403 | Ga0500577_0169598 | 3300053142 | Bacteria | 933 |
| 404 | Ga0500604_0000208 | 3300053151 | Bacteria | 16819 |
| 405 | Ga0500616_0000114 | 3300053153 | Bacteria | 148574 |
| 406 | Ga0500616_0027644 | 3300053153 | Bacteria | 3130 |
| 407 | Ga0500616_0070155 | 3300053153 | Bacteria | 1790 |
| 408 | Ga0500622_0005705 | 3300053156 | Bacteria | 7400 |
| 409 | Ga0500627_0130911 | 3300053158 | Bacteria | 1133 |
| 410 | Ga0500636_0052503 | 3300053177 | Bacteria | 2394 |
| 411 | Ga0501084_0006355 | 3300054114 | Bacteria | 9707 |
| 412 | Ga0501082_0022242 | 3300060353 | Bacteria | 5464 |
| 413 | Ga0501082_0338226 | 3300060353 | Bacteria | 1312 |
| 414 | Ga0466962_0229822 | 3300061719 | Bacteria | 909 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048922 | Ga0496119_0116542 | Ga0496119_0116542_21_638 | 186 |
| 2 | iso_pu_bacteria | 2906401398 | 2906403977 | 199 |
| 3 | 3300049593 | Ga0501077_0198064 | Ga0501077_0198064_633_1256 | 200 |
| 4 | 3300035724 | Ga0373933_0495012 | Ga0373933_0495012_176_790 | 202 |
| 5 | 3300039437 | Ga0436365_1559602 | Ga0436365_1559602_993_1628 | 202 |
| 6 | 3300049572 | Ga0501036_0914929 | Ga0501036_0914929_60_698 | 210 |
| 7 | 3300005456 | Ga0070678_100491308 | Ga0070678_1004913082 | 214 |
| 8 | 3300005457 | Ga0070662_100176938 | Ga0070662_1001769382 | 214 |
| 9 | 3300005564 | Ga0070664_100052295 | Ga0070664_1000522953 | 214 |
| 10 | 3300006048 | Ga0075363_100222982 | Ga0075363_1002229821 | 214 |
| 11 | 3300009148 | Ga0105243_10048496 | Ga0105243_100484962 | 214 |
| 12 | 3300017792 | Ga0163161_10089107 | Ga0163161_100891073 | 214 |
| 13 | 3300025291 | Ga0209675_1007782 | Ga0209675_10077825 | 214 |
| 14 | 3300025298 | Ga0209050_1008405 | Ga0209050_10084052 | 214 |
| 15 | 3300025728 | Ga0207655_1003880 | Ga0207655_100388011 | 214 |
| 16 | 3300025933 | Ga0207706_10017144 | Ga0207706_100171442 | 214 |
| 17 | 3300025935 | Ga0207709_10024152 | Ga0207709_100241523 | 214 |
| 18 | 3300025945 | Ga0207679_10057291 | Ga0207679_100572913 | 214 |
| 19 | 3300025986 | Ga0207658_10396707 | Ga0207658_103967071 | 214 |
| 20 | 3300026116 | Ga0207674_10221287 | Ga0207674_102212872 | 214 |
| 21 | 3300026121 | Ga0207683_10606520 | Ga0207683_106065201 | 214 |
| 22 | 3300028794 | Ga0307515_10092206 | Ga0307515_100922062 | 214 |
| 23 | 3300030744 | Ga0316181_1037493 | Ga0316181_10374931 | 214 |
| 24 | 3300031903 | Ga0307407_10216783 | Ga0307407_102167832 | 214 |
| 25 | 3300046460 | Ga0495638_0013995 | Ga0495638_0013995_219_929 | 214 |
| 26 | 3300046512 | Ga0495610_0005191 | Ga0495610_0005191_1771_2481 | 214 |
| 27 | 3300046513 | Ga0495616_0008326 | Ga0495616_0008326_407_1117 | 214 |
| 28 | 3300046518 | Ga0495631_0003347 | Ga0495631_0003347_3316_4026 | 214 |
| 29 | 3300046530 | Ga0495654_0004228 | Ga0495654_0004228_5048_5773 | 214 |
| 30 | 3300046660 | Ga0495625_0013426 | Ga0495625_0013426_3016_3726 | 214 |
| 31 | 3300046674 | Ga0495588_0121771 | Ga0495588_0121771_162_872 | 214 |
| 32 | 3300048919 | Ga0496116_0064446 | Ga0496116_0064446_1146_1856 | 214 |
| 33 | 3300048920 | Ga0496117_0026156 | Ga0496117_0026156_3406_4116 | 214 |
| 34 | 3300048920 | Ga0496117_0086948 | Ga0496117_0086948_649_1359 | 214 |
| 35 | 3300048924 | Ga0496121_0023049 | Ga0496121_0023049_381_1091 | 214 |
| 36 | 3300048925 | Ga0496122_0095067 | Ga0496122_0095067_1140_1850 | 214 |
| 37 | 3300048925 | Ga0496122_0130652 | Ga0496122_0130652_859_1569 | 214 |
| 38 | 3300048926 | Ga0496123_0041512 | Ga0496123_0041512_1475_2185 | 214 |
| 39 | 3300048927 | Ga0496124_0459077 | Ga0496124_0459077_24_734 | 214 |
| 40 | 3300048928 | Ga0496125_0074948 | Ga0496125_0074948_839_1549 | 214 |
| 41 | 3300048929 | Ga0496126_0107852 | Ga0496126_0107852_609_1319 | 214 |
| 42 | 3300049759 | Ga0501262_000165 | Ga0501262_000165_3178_3888 | 214 |
| 43 | 3300053080 | Ga0500635_0036175 | Ga0500635_0036175_694_1404 | 214 |
| 44 | 3300053108 | Ga0500562_041104 | Ga0500562_041104_88_798 | 214 |
| 45 | 3300053116 | Ga0500592_003029 | Ga0500592_003029_1922_2632 | 214 |
| 46 | 3300053118 | Ga0500594_0002223 | Ga0500594_0002223_536_1246 | 214 |
| 47 | 3300053128 | Ga0500626_030117 | Ga0500626_030117_535_1245 | 214 |
| 48 | 3300053134 | Ga0500658_0000058 | Ga0500658_0000058_10622_11332 | 214 |
| 49 | 3300053136 | Ga0500559_0004819 | Ga0500559_0004819_872_1582 | 214 |
| 50 | 3300053139 | Ga0500568_0001943 | Ga0500568_0001943_3090_3800 | 214 |
| 51 | 3300053153 | Ga0500616_0027644 | Ga0500616_0027644_1067_1777 | 214 |
| 52 | 3300053153 | Ga0500616_0070155 | Ga0500616_0070155_694_1404 | 214 |
| 53 | iso_pu_bacteria | 8019597564 | 8019604808 | 215 |
| 54 | 3300003354 | JGI25160J50197_1000184 | JGI25160J50197_10001847 | 220 |
| 55 | 3300005262 | Ga0065165_1001355 | Ga0065165_100135520 | 220 |
| 56 | 3300025284 | Ga0209130_1012227 | Ga0209130_10122273 | 220 |
| 57 | 3300025302 | Ga0207426_1000004 | Ga0207426_1000004662 | 220 |
| 58 | 3300048903 | Ga0496100_0000086 | Ga0496100_0000086_7406_8116 | 220 |
| 59 | 3300048904 | Ga0496101_0000044 | Ga0496101_0000044_733_1443 | 220 |
| 60 | 3300048905 | Ga0496102_0010285 | Ga0496102_0010285_4283_4993 | 220 |
| 61 | 3300048906 | Ga0496103_0001893 | Ga0496103_0001893_5495_6205 | 220 |
| 62 | 3300048910 | Ga0496107_0138143 | Ga0496107_0138143_1064_1774 | 220 |
| 63 | 3300048916 | Ga0496113_0537949 | Ga0496113_0537949_61_771 | 220 |
| 64 | 3300048919 | Ga0496116_0093811 | Ga0496116_0093811_188_898 | 220 |
| 65 | 3300048920 | Ga0496117_0000098 | Ga0496117_0000098_35769_36479 | 220 |
| 66 | 3300048921 | Ga0496118_0000728 | Ga0496118_0000728_7491_8201 | 220 |
| 67 | 3300048922 | Ga0496119_0105287 | Ga0496119_0105287_449_1159 | 220 |
| 68 | 3300048924 | Ga0496121_0013301 | Ga0496121_0013301_7406_8116 | 220 |
| 69 | 3300048926 | Ga0496123_0114290 | Ga0496123_0114290_364_1074 | 220 |
| 70 | 3300006844 | Ga0075428_100000426 | Ga0075428_10000042630 | 225 |
| 71 | 3300006847 | Ga0075431_100000059 | Ga0075431_10000005918 | 225 |
| 72 | 3300006880 | Ga0075429_100007528 | Ga0075429_1000075289 | 225 |
| 73 | 3300027907 | Ga0207428_10009343 | Ga0207428_100093433 | 225 |
| 74 | 3300049574 | Ga0501038_0363660 | Ga0501038_0363660_46_729 | 225 |
| 75 | iso_pu_bacteria | 2848858292 | 2848863605 | 227 |
| 76 | iso_pu_bacteria | 3001889506 | 3001890525 | 228 |
| 77 | 3300005293 | Ga0065715_10000497 | Ga0065715_100004972 | 230 |
| 78 | 3300005330 | Ga0070690_100323744 | Ga0070690_1003237442 | 230 |
| 79 | 3300005334 | Ga0068869_100100923 | Ga0068869_1001009233 | 230 |
| 80 | 3300005336 | Ga0070680_100338414 | Ga0070680_1003384141 | 230 |
| 81 | 3300005339 | Ga0070660_100192178 | Ga0070660_1001921782 | 230 |
| 82 | 3300005343 | Ga0070687_100010290 | Ga0070687_1000102906 | 230 |
| 83 | 3300005364 | Ga0070673_100672729 | Ga0070673_1006727291 | 230 |
| 84 | 3300005406 | Ga0070703_10002141 | Ga0070703_100021412 | 230 |
| 85 | 3300005438 | Ga0070701_10010549 | Ga0070701_100105493 | 230 |
| 86 | 3300005441 | Ga0070700_100082103 | Ga0070700_1000821032 | 230 |
| 87 | 3300005445 | Ga0070708_100004618 | Ga0070708_1000046184 | 230 |
| 88 | 3300005458 | Ga0070681_10073034 | Ga0070681_100730343 | 230 |
| 89 | 3300005459 | Ga0068867_100059588 | Ga0068867_1000595882 | 230 |
| 90 | 3300005467 | Ga0070706_100004294 | Ga0070706_1000042946 | 230 |
| 91 | 3300005468 | Ga0070707_100088093 | Ga0070707_1000880935 | 230 |
| 92 | 3300005471 | Ga0070698_100021194 | Ga0070698_1000211943 | 230 |
| 93 | 3300005530 | Ga0070679_100106690 | Ga0070679_1001066903 | 230 |
| 94 | 3300005545 | Ga0070695_100218130 | Ga0070695_1002181302 | 230 |
| 95 | 3300005546 | Ga0070696_100049527 | Ga0070696_1000495273 | 230 |
| 96 | 3300005563 | Ga0068855_100737003 | Ga0068855_1007370032 | 230 |
| 97 | 3300005564 | Ga0070664_100109527 | Ga0070664_1001095272 | 230 |
| 98 | 3300005577 | Ga0068857_100006321 | Ga0068857_1000063213 | 230 |
| 99 | 3300005578 | Ga0068854_100693887 | Ga0068854_1006938872 | 230 |
| 100 | 3300005719 | Ga0068861_100164346 | Ga0068861_1001643462 | 230 |
| 101 | 3300005843 | Ga0068860_100094431 | Ga0068860_1000944312 | 230 |
| 102 | 3300005844 | Ga0068862_100396123 | Ga0068862_1003961232 | 230 |
| 103 | 3300009093 | Ga0105240_10181444 | Ga0105240_101814444 | 230 |
| 104 | 3300009098 | Ga0105245_10465815 | Ga0105245_104658152 | 230 |
| 105 | 3300009148 | Ga0105243_10085525 | Ga0105243_100855252 | 230 |
| 106 | 3300009176 | Ga0105242_10095815 | Ga0105242_100958154 | 230 |
| 107 | 3300013100 | Ga0157373_10195930 | Ga0157373_101959302 | 230 |
| 108 | 3300013308 | Ga0157375_10146313 | Ga0157375_101463134 | 230 |
| 109 | 3300014326 | Ga0157380_10042555 | Ga0157380_100425552 | 230 |
| 110 | 3300025885 | Ga0207653_10000347 | Ga0207653_1000034710 | 230 |
| 111 | 3300025910 | Ga0207684_10060230 | Ga0207684_100602302 | 230 |
| 112 | 3300025912 | Ga0207707_10043643 | Ga0207707_100436434 | 230 |
| 113 | 3300025913 | Ga0207695_10200123 | Ga0207695_102001232 | 230 |
| 114 | 3300025918 | Ga0207662_10046606 | Ga0207662_100466063 | 230 |
| 115 | 3300025919 | Ga0207657_10150193 | Ga0207657_101501934 | 230 |
| 116 | 3300025921 | Ga0207652_10062154 | Ga0207652_100621542 | 230 |
| 117 | 3300025922 | Ga0207646_10137140 | Ga0207646_101371402 | 230 |
| 118 | 3300025942 | Ga0207689_10087541 | Ga0207689_100875413 | 230 |
| 119 | 3300025945 | Ga0207679_10098746 | Ga0207679_100987462 | 230 |
| 120 | 3300025960 | Ga0207651_10707821 | Ga0207651_107078212 | 230 |
| 121 | 3300025981 | Ga0207640_10112480 | Ga0207640_101124801 | 230 |
| 122 | 3300026075 | Ga0207708_10062030 | Ga0207708_100620302 | 230 |
| 123 | 3300026089 | Ga0207648_10063456 | Ga0207648_100634564 | 230 |
| 124 | 3300026089 | Ga0207648_10136318 | Ga0207648_101363182 | 230 |
| 125 | 3300026116 | Ga0207674_10006766 | Ga0207674_100067668 | 230 |
| 126 | 3300028380 | Ga0268265_10341159 | Ga0268265_103411592 | 230 |
| 127 | 3300046674 | Ga0495588_0203171 | Ga0495588_0203171_46_759 | 230 |
| 128 | iso_pu_bacteria | 2513237166 | 2514047669 | 230 |
| 129 | iso_pu_bacteria | 2562617112 | 2563061075 | 230 |
| 130 | iso_pu_bacteria | 2711768613 | 2713476034 | 230 |
| 131 | 3300003771 | Ga0055526_1027115 | Ga0055526_10271152 | 231 |
| 132 | 3300005327 | Ga0070658_10629910 | Ga0070658_106299101 | 231 |
| 133 | 3300005329 | Ga0070683_100583644 | Ga0070683_1005836441 | 231 |
| 134 | 3300005340 | Ga0070689_100353547 | Ga0070689_1003535472 | 231 |
| 135 | 3300005343 | Ga0070687_100042854 | Ga0070687_1000428541 | 231 |
| 136 | 3300005354 | Ga0070675_100748797 | Ga0070675_1007487971 | 231 |
| 137 | 3300005364 | Ga0070673_100411385 | Ga0070673_1004113852 | 231 |
| 138 | 3300005535 | Ga0070684_100055449 | Ga0070684_1000554491 | 231 |
| 139 | 3300005544 | Ga0070686_100043647 | Ga0070686_1000436474 | 231 |
| 140 | 3300005545 | Ga0070695_100006755 | Ga0070695_1000067555 | 231 |
| 141 | 3300005841 | Ga0068863_100006766 | Ga0068863_1000067662 | 231 |
| 142 | 3300005842 | Ga0068858_100502023 | Ga0068858_1005020231 | 231 |
| 143 | 3300005937 | Ga0081455_10000919 | Ga0081455_1000091933 | 231 |
| 144 | 3300005937 | Ga0081455_10278914 | Ga0081455_102789142 | 231 |
| 145 | 3300005985 | Ga0081539_10014335 | Ga0081539_100143354 | 231 |
| 146 | 3300005985 | Ga0081539_10035583 | Ga0081539_100355833 | 231 |
| 147 | 3300006028 | Ga0070717_10257275 | Ga0070717_102572752 | 231 |
| 148 | 3300006048 | Ga0075363_100117106 | Ga0075363_1001171062 | 231 |
| 149 | 3300006051 | Ga0075364_10005042 | Ga0075364_1000504210 | 231 |
| 150 | 3300006051 | Ga0075364_10005490 | Ga0075364_100054907 | 231 |
| 151 | 3300006058 | Ga0075432_10061487 | Ga0075432_100614873 | 231 |
| 152 | 3300006175 | Ga0070712_100009522 | Ga0070712_1000095225 | 231 |
| 153 | 3300006177 | Ga0075362_10000810 | Ga0075362_100008103 | 231 |
| 154 | 3300006178 | Ga0075367_10026177 | Ga0075367_100261772 | 231 |
| 155 | 3300006178 | Ga0075367_10058592 | Ga0075367_100585922 | 231 |
| 156 | 3300006186 | Ga0075369_10064455 | Ga0075369_100644552 | 231 |
| 157 | 3300006186 | Ga0075369_10070025 | Ga0075369_100700252 | 231 |
| 158 | 3300006237 | Ga0097621_100000445 | Ga0097621_10000044512 | 231 |
| 159 | 3300006358 | Ga0068871_100001310 | Ga0068871_1000013106 | 231 |
| 160 | 3300006847 | Ga0075431_100318143 | Ga0075431_1003181432 | 231 |
| 161 | 3300009092 | Ga0105250_10062777 | Ga0105250_100627772 | 231 |
| 162 | 3300009094 | Ga0111539_10002614 | Ga0111539_100026143 | 231 |
| 163 | 3300009147 | Ga0114129_10001483 | Ga0114129_1000148331 | 231 |
| 164 | 3300009177 | Ga0105248_10056291 | Ga0105248_100562912 | 231 |
| 165 | 3300009551 | Ga0105238_10699783 | Ga0105238_106997832 | 231 |
| 166 | 3300014326 | Ga0157380_10111236 | Ga0157380_101112362 | 231 |
| 167 | 3300014969 | Ga0157376_10126616 | Ga0157376_101266163 | 231 |
| 168 | 3300015683 | Ga0183362_10001 | Ga0183362_10001922 | 231 |
| 169 | 3300021377 | Ga0213874_10018031 | Ga0213874_100180313 | 231 |
| 170 | 3300025261 | Ga0209233_1005652 | Ga0209233_10056523 | 231 |
| 171 | 3300025295 | Ga0209564_1009934 | Ga0209564_10099343 | 231 |
| 172 | 3300025898 | Ga0207692_10208072 | Ga0207692_102080722 | 231 |
| 173 | 3300025915 | Ga0207693_10001023 | Ga0207693_1000102311 | 231 |
| 174 | 3300025918 | Ga0207662_10015134 | Ga0207662_100151343 | 231 |
| 175 | 3300025928 | Ga0207700_10531295 | Ga0207700_105312952 | 231 |
| 176 | 3300025929 | Ga0207664_10234250 | Ga0207664_102342502 | 231 |
| 177 | 3300025935 | Ga0207709_10541817 | Ga0207709_105418171 | 231 |
| 178 | 3300025940 | Ga0207691_10407264 | Ga0207691_104072641 | 231 |
| 179 | 3300025941 | Ga0207711_10015828 | Ga0207711_100158284 | 231 |
| 180 | 3300026035 | Ga0207703_10385764 | Ga0207703_103857641 | 231 |
| 181 | 3300027907 | Ga0207428_10096413 | Ga0207428_100964132 | 231 |
| 182 | 3300028786 | Ga0307517_10000035 | Ga0307517_10000035120 | 231 |
| 183 | 3300030760 | Ga0265762_1003372 | Ga0265762_10033723 | 231 |
| 184 | 3300031852 | Ga0307410_10559436 | Ga0307410_105594362 | 231 |
| 185 | 3300032002 | Ga0307416_101143540 | Ga0307416_1011435401 | 231 |
| 186 | 3300033442 | Ga0315911_1000004 | Ga0315911_1000004454 | 231 |
| 187 | 3300035085 | Ga0373929_0019800 | Ga0373929_0019800_227_928 | 231 |
| 188 | 3300035086 | Ga0373934_0023702 | Ga0373934_0023702_822_1538 | 231 |
| 189 | 3300035112 | Ga0373932_0024236 | Ga0373932_0024236_380_1081 | 231 |
| 190 | 3300035113 | Ga0373936_0057790 | Ga0373936_0057790_105_821 | 231 |
| 191 | 3300035115 | Ga0373941_0018218 | Ga0373941_0018218_240_941 | 231 |
| 192 | 3300035118 | Ga0373954_0007126 | Ga0373954_0007126_3218_3934 | 231 |
| 193 | 3300035172 | Ga0373955_0006860 | Ga0373955_0006860_997_1713 | 231 |
| 194 | 3300035241 | Ga0373961_0040940 | Ga0373961_0040940_401_1102 | 231 |
| 195 | 3300035410 | Ga0373924_0004152 | Ga0373924_0004152_3464_4180 | 231 |
| 196 | 3300035691 | Ga0373931_0004070 | Ga0373931_0004070_3203_3904 | 231 |
| 197 | 3300035691 | Ga0373931_0011184 | Ga0373931_0011184_2211_2912 | 231 |
| 198 | 3300035692 | Ga0373935_0023511 | Ga0373935_0023511_2024_2740 | 231 |
| 199 | 3300035695 | Ga0373927_0022365 | Ga0373927_0022365_2873_3589 | 231 |
| 200 | 3300035724 | Ga0373933_0002610 | Ga0373933_0002610_352_1068 | 231 |
| 201 | 3300035725 | Ga0373947_0019484 | Ga0373947_0019484_1021_1737 | 231 |
| 202 | 3300036401 | Ga0373937_0000403 | Ga0373937_0000403_23921_24637 | 231 |
| 203 | 3300037068 | Ga0373925_0099271 | Ga0373925_0099271_1504_2220 | 231 |
| 204 | 3300039438 | Ga0436360_0985056 | Ga0436360_0985056_1323_2039 | 231 |
| 205 | 3300039450 | Ga0436363_0388188 | Ga0436363_0388188_671_1372 | 231 |
| 206 | 3300039453 | Ga0436362_0480253 | Ga0436362_0480253_305_1015 | 231 |
| 207 | 3300042436 | Ga0439435_0019353 | Ga0439435_0019353_603_1316 | 231 |
| 208 | 3300044683 | Ga0466965_0039658 | Ga0466965_0039658_1091_1801 | 231 |
| 209 | 3300044684 | Ga0466966_0040659 | Ga0466966_0040659_500_1213 | 231 |
| 210 | 3300044842 | Ga0466957_0069541 | Ga0466957_0069541_354_1064 | 231 |
| 211 | 3300045049 | Ga0466959_0001589 | Ga0466959_0001589_3823_4536 | 231 |
| 212 | 3300045049 | Ga0466959_0404122 | Ga0466959_0404122_84_794 | 231 |
| 213 | 3300045051 | Ga0451576_0015893 | Ga0451576_0015893_6521_7222 | 231 |
| 214 | 3300046454 | Ga0495592_0017240 | Ga0495592_0017240_2418_3134 | 231 |
| 215 | 3300046455 | Ga0495603_0008270 | Ga0495603_0008270_5220_5930 | 231 |
| 216 | 3300046457 | Ga0495590_0002032 | Ga0495590_0002032_5537_6247 | 231 |
| 217 | 3300046457 | Ga0495590_0022188 | Ga0495590_0022188_67_777 | 231 |
| 218 | 3300046459 | Ga0495629_0000119 | Ga0495629_0000119_36274_36984 | 231 |
| 219 | 3300046459 | Ga0495629_0000687 | Ga0495629_0000687_4042_4758 | 231 |
| 220 | 3300046460 | Ga0495638_0000558 | Ga0495638_0000558_31077_31796 | 231 |
| 221 | 3300046460 | Ga0495638_0061936 | Ga0495638_0061936_273_983 | 231 |
| 222 | 3300046462 | Ga0495651_0000185 | Ga0495651_0000185_20883_21599 | 231 |
| 223 | 3300046463 | Ga0495653_0000105 | Ga0495653_0000105_36007_36717 | 231 |
| 224 | 3300046463 | Ga0495653_0000831 | Ga0495653_0000831_180_896 | 231 |
| 225 | 3300046471 | Ga0495650_0010109 | Ga0495650_0010109_2257_2967 | 231 |
| 226 | 3300046472 | Ga0495580_0025976 | Ga0495580_0025976_2484_3194 | 231 |
| 227 | 3300046473 | Ga0495582_0061341 | Ga0495582_0061341_647_1357 | 231 |
| 228 | 3300046474 | Ga0495605_0003091 | Ga0495605_0003091_7036_7746 | 231 |
| 229 | 3300046474 | Ga0495605_0077974 | Ga0495605_0077974_92_802 | 231 |
| 230 | 3300046501 | Ga0495607_0004389 | Ga0495607_0004389_2631_3350 | 231 |
| 231 | 3300046506 | Ga0495583_0012502 | Ga0495583_0012502_2823_3533 | 231 |
| 232 | 3300046506 | Ga0495583_0055061 | Ga0495583_0055061_786_1496 | 231 |
| 233 | 3300046507 | Ga0495606_0033922 | Ga0495606_0033922_2777_3496 | 231 |
| 234 | 3300046507 | Ga0495606_0109565 | Ga0495606_0109565_723_1433 | 231 |
| 235 | 3300046511 | Ga0495608_0000598 | Ga0495608_0000598_7144_7860 | 231 |
| 236 | 3300046512 | Ga0495610_0003810 | Ga0495610_0003810_1827_2546 | 231 |
| 237 | 3300046513 | Ga0495616_0005685 | Ga0495616_0005685_5516_6226 | 231 |
| 238 | 3300046513 | Ga0495616_0008108 | Ga0495616_0008108_690_1409 | 231 |
| 239 | 3300046515 | Ga0495620_0008148 | Ga0495620_0008148_4852_5571 | 231 |
| 240 | 3300046515 | Ga0495620_0034480 | Ga0495620_0034480_133_843 | 231 |
| 241 | 3300046516 | Ga0495628_0012799 | Ga0495628_0012799_4033_4743 | 231 |
| 242 | 3300046516 | Ga0495628_0032327 | Ga0495628_0032327_1775_2491 | 231 |
| 243 | 3300046517 | Ga0495630_0002805 | Ga0495630_0002805_9244_9954 | 231 |
| 244 | 3300046517 | Ga0495630_0024003 | Ga0495630_0024003_827_1543 | 231 |
| 245 | 3300046520 | Ga0495637_0086374 | Ga0495637_0086374_213_932 | 231 |
| 246 | 3300046524 | Ga0495648_0037818 | Ga0495648_0037818_1822_2541 | 231 |
| 247 | 3300046524 | Ga0495648_0229186 | Ga0495648_0229186_93_803 | 231 |
| 248 | 3300046526 | Ga0495666_0024032 | Ga0495666_0024032_1387_2097 | 231 |
| 249 | 3300046529 | Ga0495652_0001337 | Ga0495652_0001337_24345_25061 | 231 |
| 250 | 3300046530 | Ga0495654_0007875 | Ga0495654_0007875_2950_3669 | 231 |
| 251 | 3300046531 | Ga0495665_0022743 | Ga0495665_0022743_1566_2276 | 231 |
| 252 | 3300046533 | Ga0495640_0046814 | Ga0495640_0046814_375_1091 | 231 |
| 253 | 3300046536 | Ga0495587_0003497 | Ga0495587_0003497_3139_3855 | 231 |
| 254 | 3300046538 | Ga0495609_0020394 | Ga0495609_0020394_375_1085 | 231 |
| 255 | 3300046557 | Ga0495622_0007226 | Ga0495622_0007226_392_1102 | 231 |
| 256 | 3300046559 | Ga0495667_0002126 | Ga0495667_0002126_1940_2656 | 231 |
| 257 | 3300046642 | Ga0495634_0001253 | Ga0495634_0001253_18253_18969 | 231 |
| 258 | 3300046648 | Ga0495611_0009097 | Ga0495611_0009097_3005_3715 | 231 |
| 259 | 3300046660 | Ga0495625_0041326 | Ga0495625_0041326_2437_3156 | 231 |
| 260 | 3300046660 | Ga0495625_0362531 | Ga0495625_0362531_119_829 | 231 |
| 261 | 3300046675 | Ga0495657_0009967 | Ga0495657_0009967_6231_6947 | 231 |
| 262 | 3300046678 | Ga0495599_0001430 | Ga0495599_0001430_4040_4771 | 231 |
| 263 | 3300046679 | Ga0495623_0002363 | Ga0495623_0002363_8406_9122 | 231 |
| 264 | 3300046680 | Ga0495646_0001973 | Ga0495646_0001973_5162_5878 | 231 |
| 265 | 3300046680 | Ga0495646_0012891 | Ga0495646_0012891_122_832 | 231 |
| 266 | 3300046684 | Ga0495669_0031681 | Ga0495669_0031681_698_1408 | 231 |
| 267 | 3300046689 | Ga0495613_0072504 | Ga0495613_0072504_1575_2285 | 231 |
| 268 | 3300046689 | Ga0495613_0143302 | Ga0495613_0143302_835_1551 | 231 |
| 269 | 3300046690 | Ga0495624_0107517 | Ga0495624_0107517_319_1035 | 231 |
| 270 | 3300046694 | Ga0495649_0098741 | Ga0495649_0098741_629_1339 | 231 |
| 271 | 3300046794 | Ga0495589_0019487 | Ga0495589_0019487_1518_2228 | 231 |
| 272 | 3300046794 | Ga0495589_0020644 | Ga0495589_0020644_1448_2158 | 231 |
| 273 | 3300046809 | Ga0495600_0000663 | Ga0495600_0000663_10069_10785 | 231 |
| 274 | 3300046810 | Ga0495660_0126627 | Ga0495660_0126627_73_792 | 231 |
| 275 | 3300047317 | Ga0495604_0000478 | Ga0495604_0000478_33038_33754 | 231 |
| 276 | 3300047319 | Ga0495674_0005391 | Ga0495674_0005391_5020_5730 | 231 |
| 277 | 3300047319 | Ga0495674_0047204 | Ga0495674_0047204_2216_2926 | 231 |
| 278 | 3300047321 | Ga0495676_0082146 | Ga0495676_0082146_134_844 | 231 |
| 279 | 3300047321 | Ga0495676_0186038 | Ga0495676_0186038_34_750 | 231 |
| 280 | 3300047322 | Ga0495680_0000640 | Ga0495680_0000640_22986_23702 | 231 |
| 281 | 3300047323 | Ga0495683_0034087 | Ga0495683_0034087_1521_2231 | 231 |
| 282 | 3300047323 | Ga0495683_0048843 | Ga0495683_0048843_1319_2029 | 231 |
| 283 | 3300047443 | Ga0495687_017631 | Ga0495687_017631_2102_2812 | 231 |
| 284 | 3300047444 | Ga0495675_0003306 | Ga0495675_0003306_202_918 | 231 |
| 285 | 3300047445 | Ga0495677_0011179 | Ga0495677_0011179_1958_2668 | 231 |
| 286 | 3300047446 | Ga0495679_000036 | Ga0495679_000036_21499_22209 | 231 |
| 287 | 3300047469 | Ga0495673_0005195 | Ga0495673_0005195_6079_6789 | 231 |
| 288 | 3300047472 | Ga0495686_0006696 | Ga0495686_0006696_3369_4088 | 231 |
| 289 | 3300047673 | Ga0495593_0012854 | Ga0495593_0012854_1358_2074 | 231 |
| 290 | 3300048088 | Ga0495602_0028131 | Ga0495602_0028131_2420_3136 | 231 |
| 291 | 3300048089 | Ga0495614_0049840 | Ga0495614_0049840_29_739 | 231 |
| 292 | 3300048091 | Ga0495626_0023838 | Ga0495626_0023838_1979_2689 | 231 |
| 293 | 3300048091 | Ga0495626_0042998 | Ga0495626_0042998_1069_1779 | 231 |
| 294 | 3300048904 | Ga0496101_0000224 | Ga0496101_0000224_4247_4957 | 231 |
| 295 | 3300048905 | Ga0496102_0241086 | Ga0496102_0241086_529_1248 | 231 |
| 296 | 3300048907 | Ga0496104_0321329 | Ga0496104_0321329_29_739 | 231 |
| 297 | 3300048908 | Ga0496105_0003748 | Ga0496105_0003748_2038_2748 | 231 |
| 298 | 3300048909 | Ga0496106_0078646 | Ga0496106_0078646_1207_1917 | 231 |
| 299 | 3300048912 | Ga0496109_0434765 | Ga0496109_0434765_106_822 | 231 |
| 300 | 3300048912 | Ga0496109_0503906 | Ga0496109_0503906_142_852 | 231 |
| 301 | 3300048915 | Ga0496112_0056945 | Ga0496112_0056945_698_1408 | 231 |
| 302 | 3300048916 | Ga0496113_0002020 | Ga0496113_0002020_7011_7721 | 231 |
| 303 | 3300048919 | Ga0496116_0003806 | Ga0496116_0003806_3994_4722 | 231 |
| 304 | 3300048919 | Ga0496116_0047388 | Ga0496116_0047388_1796_2506 | 231 |
| 305 | 3300048919 | Ga0496116_0047641 | Ga0496116_0047641_1460_2179 | 231 |
| 306 | 3300048920 | Ga0496117_0002577 | Ga0496117_0002577_15003_15722 | 231 |
| 307 | 3300048920 | Ga0496117_0017448 | Ga0496117_0017448_594_1322 | 231 |
| 308 | 3300048920 | Ga0496117_0114277 | Ga0496117_0114277_915_1637 | 231 |
| 309 | 3300048921 | Ga0496118_0007352 | Ga0496118_0007352_6949_7668 | 231 |
| 310 | 3300048921 | Ga0496118_0025602 | Ga0496118_0025602_3252_3962 | 231 |
| 311 | 3300048924 | Ga0496121_0000643 | Ga0496121_0000643_53969_54688 | 231 |
| 312 | 3300048924 | Ga0496121_0004299 | Ga0496121_0004299_13481_14203 | 231 |
| 313 | 3300048924 | Ga0496121_0021173 | Ga0496121_0021173_5423_6133 | 231 |
| 314 | 3300048924 | Ga0496121_0026019 | Ga0496121_0026019_534_1244 | 231 |
| 315 | 3300048924 | Ga0496121_0131176 | Ga0496121_0131176_178_888 | 231 |
| 316 | 3300048925 | Ga0496122_0021785 | Ga0496122_0021785_3549_4268 | 231 |
| 317 | 3300048925 | Ga0496122_0131798 | Ga0496122_0131798_660_1370 | 231 |
| 318 | 3300048926 | Ga0496123_0002639 | Ga0496123_0002639_9833_10552 | 231 |
| 319 | 3300048928 | Ga0496125_0001227 | Ga0496125_0001227_4118_4837 | 231 |
| 320 | 3300048928 | Ga0496125_0056455 | Ga0496125_0056455_1891_2619 | 231 |
| 321 | 3300048928 | Ga0496125_0187036 | Ga0496125_0187036_605_1315 | 231 |
| 322 | 3300048929 | Ga0496126_0027842 | Ga0496126_0027842_827_1546 | 231 |
| 323 | 3300048929 | Ga0496126_0218149 | Ga0496126_0218149_345_1055 | 231 |
| 324 | 3300048929 | Ga0496126_0308227 | Ga0496126_0308227_508_1236 | 231 |
| 325 | 3300048929 | Ga0496126_0564602 | Ga0496126_0564602_67_777 | 231 |
| 326 | 3300049459 | Ga0495678_017335 | Ga0495678_017335_301_1011 | 231 |
| 327 | 3300049460 | Ga0495682_0011728 | Ga0495682_0011728_630_1340 | 231 |
| 328 | 3300049460 | Ga0495682_0024899 | Ga0495682_0024899_93_803 | 231 |
| 329 | 3300049568 | Ga0501031_0256804 | Ga0501031_0256804_164_865 | 231 |
| 330 | 3300049580 | Ga0501046_0334927 | Ga0501046_0334927_48_749 | 231 |
| 331 | 3300049581 | Ga0501047_0152425 | Ga0501047_0152425_71_784 | 231 |
| 332 | 3300049582 | Ga0501048_0220992 | Ga0501048_0220992_112_813 | 231 |
| 333 | 3300049592 | Ga0501076_0196732 | Ga0501076_0196732_659_1360 | 231 |
| 334 | 3300049741 | Ga0501079_0426866 | Ga0501079_0426866_212_913 | 231 |
| 335 | 3300049744 | Ga0501083_0001455 | Ga0501083_0001455_6211_6912 | 231 |
| 336 | 3300049823 | Ga0501044_0428882 | Ga0501044_0428882_291_1004 | 231 |
| 337 | 3300050491 | nmdc:mga00v17_27032_c1 | nmdc:mga00v17_27032_c1_1706_2434 | 231 |
| 338 | 3300050491 | nmdc:mga00v17_42903_c1 | nmdc:mga00v17_42903_c1_608_1321 | 231 |
| 339 | 3300050492 | nmdc:mga0yw44_353828_c1 | nmdc:mga0yw44_353828_c1_112_828 | 231 |
| 340 | 3300050493 | nmdc:mga0k408_6128_c1 | nmdc:mga0k408_6128_c1_4344_5057 | 231 |
| 341 | 3300050494 | nmdc:mga06z11_78451_c1 | nmdc:mga06z11_78451_c1_667_1395 | 231 |
| 342 | 3300050507 | nmdc:mga05p37_285_c1 | nmdc:mga05p37_285_c1_5011_5712 | 231 |
| 343 | 3300050508 | nmdc:mga09592_9564_c1 | nmdc:mga09592_9564_c1_2297_2998 | 231 |
| 344 | 3300050510 | nmdc:mga06r32_118_c1 | nmdc:mga06r32_118_c1_40756_41457 | 231 |
| 345 | 3300050510 | nmdc:mga06r32_254298_c1 | nmdc:mga06r32_254298_c1_684_1397 | 231 |
| 346 | 3300050511 | nmdc:mga08y16_293295_c1 | nmdc:mga08y16_293295_c1_943_1656 | 231 |
| 347 | 3300050511 | nmdc:mga08y16_303_c1 | nmdc:mga08y16_303_c1_9599_10300 | 231 |
| 348 | 3300050516 | nmdc:mga0sz30_9739_c1 | nmdc:mga0sz30_9739_c1_942_1670 | 231 |
| 349 | 3300053077 | Ga0495601_0001131 | Ga0495601_0001131_9368_10084 | 231 |
| 350 | 3300053084 | Ga0495595_0000142 | Ga0495595_0000142_22895_23611 | 231 |
| 351 | 3300053085 | Ga0495619_0003389 | Ga0495619_0003389_2582_3298 | 231 |
| 352 | 3300053085 | Ga0495619_0053191 | Ga0495619_0053191_35_781 | 231 |
| 353 | 3300053087 | Ga0500643_002411 | Ga0500643_002411_624_1343 | 231 |
| 354 | 3300053087 | Ga0500643_029605 | Ga0500643_029605_158_883 | 231 |
| 355 | 3300053088 | Ga0500644_0023243 | Ga0500644_0023243_735_1454 | 231 |
| 356 | 3300053088 | Ga0500644_0181436 | Ga0500644_0181436_38_766 | 231 |
| 357 | 3300053093 | Ga0500651_0077910 | Ga0500651_0077910_443_1171 | 231 |
| 358 | 3300053094 | Ga0500566_0154254 | Ga0500566_0154254_77_799 | 231 |
| 359 | 3300053104 | Ga0500556_0000003 | Ga0500556_0000003_455563_456282 | 231 |
| 360 | 3300053104 | Ga0500556_0011257 | Ga0500556_0011257_798_1517 | 231 |
| 361 | 3300053119 | Ga0500595_003700 | Ga0500595_003700_1283_2011 | 231 |
| 362 | 3300053131 | Ga0500652_000921 | Ga0500652_000921_218_940 | 231 |
| 363 | 3300053139 | Ga0500568_0001594 | Ga0500568_0001594_7664_8383 | 231 |
| 364 | 3300053151 | Ga0500604_0000208 | Ga0500604_0000208_4923_5642 | 231 |
| 365 | 3300053153 | Ga0500616_0000114 | Ga0500616_0000114_50339_51058 | 231 |
| 366 | 3300053156 | Ga0500622_0005705 | Ga0500622_0005705_3888_4607 | 231 |
| 367 | 3300053158 | Ga0500627_0130911 | Ga0500627_0130911_38_766 | 231 |
| 368 | 3300053177 | Ga0500636_0052503 | Ga0500636_0052503_393_1115 | 231 |
| 369 | 3300054114 | Ga0501084_0006355 | Ga0501084_0006355_8498_9199 | 231 |
| 370 | 3300060353 | Ga0501082_0338226 | Ga0501082_0338226_61_762 | 231 |
| 371 | 3300061719 | Ga0466962_0229822 | Ga0466962_0229822_170_883 | 231 |
| 372 | iso_pu_bacteria | 2513237137 | 2513862159 | 231 |
| 373 | iso_pu_bacteria | 2517572143 | 2517895311 | 231 |
| 374 | iso_pu_bacteria | 2602042107 | 2603857608 | 231 |
| 375 | iso_pu_bacteria | 2643221547 | 2643754847 | 231 |
| 376 | iso_pu_bacteria | 2791355197 | 2793069283 | 231 |
| 377 | iso_pu_bacteria | 2888378607 | 2888378903 | 231 |
| 378 | iso_pu_bacteria | 2903748898 | 2903750429 | 231 |
| 379 | iso_pu_bacteria | 2904690495 | 2904698644 | 231 |
| 380 | iso_pu_bacteria | 2906660503 | 2906663540 | 231 |
| 381 | iso_pu_bacteria | 2908739725 | 2908745504 | 231 |
| 382 | iso_pu_bacteria | 2908756301 | 2908761976 | 231 |
| 383 | iso_pu_bacteria | 2919073203 | 2919076605 | 231 |
| 384 | iso_pu_bacteria | 2935608549 | 2935613705 | 231 |
| 385 | iso_pu_bacteria | 2935638405 | 2935643346 | 231 |
| 386 | iso_pu_bacteria | 2935703347 | 2935713141 | 231 |
| 387 | iso_pu_bacteria | 2935827899 | 2935832869 | 231 |
| 388 | iso_pu_bacteria | 2935864058 | 2935873365 | 231 |
| 389 | iso_pu_bacteria | 2935873716 | 2935879207 | 231 |
| 390 | iso_pu_bacteria | 2935992306 | 2935996852 | 231 |
| 391 | iso_pu_bacteria | 3005474847 | 3005477031 | 231 |
| 392 | iso_pu_bacteria | 8019576017 | 8019578836 | 231 |
| 393 | iso_pu_bacteria | 8019586578 | 8019596907 | 231 |
| 394 | iso_pu_bacteria | 8019608314 | 8019613722 | 231 |
| 395 | iso_pu_bacteria | 8024486573 | 8024490714 | 231 |
| 396 | iso_pu_bacteria | 8054002106 | 8054009065 | 231 |
| 397 | 3300002459 | JGI24751J29686_10032029 | JGI24751J29686_100320292 | 232 |
| 398 | 3300005327 | Ga0070658_10305818 | Ga0070658_103058181 | 232 |
| 399 | 3300005577 | Ga0068857_100038046 | Ga0068857_1000380462 | 232 |
| 400 | 3300005616 | Ga0068852_100422571 | Ga0068852_1004225712 | 232 |
| 401 | 3300005618 | Ga0068864_100029756 | Ga0068864_1000297564 | 232 |
| 402 | 3300005842 | Ga0068858_100397793 | Ga0068858_1003977932 | 232 |
| 403 | 3300009101 | Ga0105247_10008352 | Ga0105247_100083525 | 232 |
| 404 | 3300009148 | Ga0105243_10134635 | Ga0105243_101346352 | 232 |
| 405 | 3300009174 | Ga0105241_10077007 | Ga0105241_100770072 | 232 |
| 406 | 3300009177 | Ga0105248_10896585 | Ga0105248_108965851 | 232 |
| 407 | 3300013104 | Ga0157370_10012366 | Ga0157370_100123663 | 232 |
| 408 | 3300013308 | Ga0157375_10592043 | Ga0157375_105920432 | 232 |
| 409 | 3300025918 | Ga0207662_10087480 | Ga0207662_100874802 | 232 |
| 410 | 3300025936 | Ga0207670_10120153 | Ga0207670_101201532 | 232 |
| 411 | 3300025941 | Ga0207711_10477125 | Ga0207711_104771252 | 232 |
| 412 | 3300026041 | Ga0207639_10279707 | Ga0207639_102797072 | 232 |
| 413 | 3300026095 | Ga0207676_10062656 | Ga0207676_100626562 | 232 |
| 414 | 3300026116 | Ga0207674_10239807 | Ga0207674_102398072 | 232 |
| 415 | 3300028556 | Ga0265337_1002183 | Ga0265337_100218310 | 232 |
| 416 | 3300031238 | Ga0265332_10052084 | Ga0265332_100520842 | 232 |
| 417 | 3300031247 | Ga0265340_10015775 | Ga0265340_100157754 | 232 |
| 418 | 3300031712 | Ga0265342_10183260 | Ga0265342_101832601 | 232 |
| 419 | 3300046460 | Ga0495638_0002784 | Ga0495638_0002784_6107_6805 | 232 |
| 420 | 3300046474 | Ga0495605_0010868 | Ga0495605_0010868_447_1145 | 232 |
| 421 | 3300049569 | Ga0501032_0007033 | Ga0501032_0007033_2333_3064 | 232 |
| 422 | 3300049570 | Ga0501033_0010149 | Ga0501033_0010149_5081_5812 | 232 |
| 423 | 3300049571 | Ga0501034_0075155 | Ga0501034_0075155_1677_2408 | 232 |
| 424 | 3300049572 | Ga0501036_0004663 | Ga0501036_0004663_4436_5167 | 232 |
| 425 | 3300049573 | Ga0501037_0005193 | Ga0501037_0005193_3865_4596 | 232 |
| 426 | 3300049574 | Ga0501038_0010330 | Ga0501038_0010330_5493_6224 | 232 |
| 427 | 3300049575 | Ga0501039_0068875 | Ga0501039_0068875_1330_2061 | 232 |
| 428 | 3300049578 | Ga0501042_0164376 | Ga0501042_0164376_230_961 | 232 |
| 429 | 3300049579 | Ga0501043_0010483 | Ga0501043_0010483_4813_5544 | 232 |
| 430 | 3300049580 | Ga0501046_0013654 | Ga0501046_0013654_3086_3817 | 232 |
| 431 | 3300049581 | Ga0501047_0092567 | Ga0501047_0092567_1501_2232 | 232 |
| 432 | 3300049582 | Ga0501048_0033786 | Ga0501048_0033786_1818_2549 | 232 |
| 433 | 3300049583 | Ga0501067_0070124 | Ga0501067_0070124_433_1164 | 232 |
| 434 | 3300049584 | Ga0501068_0049668 | Ga0501068_0049668_1333_2064 | 232 |
| 435 | 3300049585 | Ga0501069_0009548 | Ga0501069_0009548_1481_2212 | 232 |
| 436 | 3300049586 | Ga0501070_0019709 | Ga0501070_0019709_2825_3556 | 232 |
| 437 | 3300049587 | Ga0501071_0299975 | Ga0501071_0299975_94_825 | 232 |
| 438 | 3300049589 | Ga0501073_0011504 | Ga0501073_0011504_3735_4466 | 232 |
| 439 | 3300049590 | Ga0501074_0035277 | Ga0501074_0035277_204_935 | 232 |
| 440 | 3300049742 | Ga0501080_0008356 | Ga0501080_0008356_3210_3941 | 232 |
| 441 | 3300049744 | Ga0501083_0024844 | Ga0501083_0024844_2848_3546 | 232 |
| 442 | 3300049744 | Ga0501083_0035426 | Ga0501083_0035426_841_1572 | 232 |
| 443 | 3300049822 | Ga0501035_0026098 | Ga0501035_0026098_3167_3898 | 232 |
| 444 | 3300049823 | Ga0501044_0024850 | Ga0501044_0024850_5162_5893 | 232 |
| 445 | 3300053142 | Ga0500577_0169598 | Ga0500577_0169598_129_827 | 232 |
| 446 | 3300060353 | Ga0501082_0022242 | Ga0501082_0022242_2296_3027 | 232 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ji0-assembly1.cif.gz_A | crystal structure analysis of the abc transporter from thermotoga maritima | 0.9681 | 2 | 231 |
| 1ji0-assembly1.cif.gz_A | crystal structure analysis of the abc transporter from thermotoga maritima | 0.9559 | 2 | 231 |
| 2awo-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) | 0.9518 | 2 | 221 |
| 4khz-assembly1.cif.gz_B | crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose | 0.9337 | 2 | 221 |
| 2awn-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) | 0.9337 | 2 | 221 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P22731_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9874 | 1 | 229 | 3.40.50.300 |
| af_P22731_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9664 | 1 | 229 | 3.40.50.300 |
| af_Q58664_1_235_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9599 | 1 | 230 | 3.40.50.300 |
| 1ji0A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9528 | 2 | 231 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9524 | 2 | 216 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A854GVC9-F1-model_v4 | deleted | 0.9915 | 1 | 227 |
|
| AF-A0A496QUQ5-F1-model_v4 | ABC transporter ATP-binding protein | 0.9879 | 2 | 231 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A6G6K803-F1-model_v4 | ABC transporter ATP-binding protein | 0.9869 | 1 | 229 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A1S1RJF5-F1-model_v4 | ABC transporter ATP-binding protein | 0.9865 | 2 | 229 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A238D136-F1-model_v4 | Leucine/isoleucine/valine transporter subunit ATP-binding component of ABC superfamily | 0.9863 | 1 | 228 |
GO:0005524
GO:0005886 GO:0015658 GO:0015807 GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar