F445757

General Info

Members Datasets Scaffolds Average Seq Length
446 333 414 236

Family's Representative Sequence

Representative Sequence 3300033442|Ga0315911_1000004|Ga0315911_1000004454
Length 261
Sequence MSEVLLSVDGLAATYNHAIGAVSDVSLVVRPGEIVAVLGANGAGKSTTLQAVSALLPARRGQITAGCILFEGHDLAGISAAALVRAGIVPVLEGRHCFASLTVEENLFTGAIGRDATRAETADDLDRVYTLFPRLKERRRSLAGLTSGGEQQMTAIGRALMSRPRLLVLDEPSMGLAPLVVEGILRALKQLNAEQGLSILVAEQNSTVALRFADHAVVLENGRSVLAGAAAELRRRGDIKTLYLGGSSQVDPSRQPTQAVA

Samples

Sample ID Description Type Environment
1 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
2 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
3 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
4 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
5 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
6 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
7 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
8 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
9 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
10 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
11 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
12 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
13 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
14 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
15 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
16 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
17 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
18 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
19 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
20 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
21 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
22 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
23 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
24 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
25 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
26 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
27 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
28 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
29 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
103 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
104 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
142 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
143 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
144 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
145 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
147 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
148 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
153 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
154 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
155 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
156 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
158 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
171 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
172 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
173 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
174 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
175 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
189 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
190 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
191 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
192 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
193 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
194 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
195 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
196 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
197 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
200 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
201 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
202 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
203 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
204 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
205 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
206 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
207 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
208 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
209 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
210 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
211 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
212 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
215 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
216 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
217 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
218 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
219 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
223 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
226 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
229 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
230 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
231 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
232 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
233 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
234 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
235 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
236 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
237 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
238 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
239 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
240 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
241 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
253 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
254 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
255 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
256 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
257 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
258 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
259 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
260 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
261 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
262 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
263 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
264 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
278 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
279 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
280 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
281 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
282 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
283 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
284 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
285 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
286 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
287 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
288 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
289 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
290 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
292 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
293 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
294 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
295 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
296 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
297 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
298 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
299 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
300 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
301 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
302 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
303 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
304 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
305 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
306 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
307 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
308 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
309 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
310 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
311 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
312 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
313 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
314 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
315 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
316 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
317 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
318 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
319 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
320 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
321 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
322 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
323 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
324 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
325 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
326 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
327 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
328 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
329 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
330 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
331 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
332 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
333 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.6
Metatranscriptomes 0.22
Isolates 7.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.43
Nodule 5.16
Rhizoplane 3.59
Rhizosphere 68.16
Stem 0
Stem Tuber 0
Unclassified 11.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10032029 3300002459 Bacteria 1090
2 JGI25160J50197_1000184 3300003354 Bacteria 53011
3 Ga0055526_1027115 3300003771 Bacteria 1780
4 Ga0065165_1001355 3300005262 Bacteria 27048
5 Ga0065715_10000497 3300005293 Bacteria 10881
6 Ga0070658_10305818 3300005327 Bacteria 1356
7 Ga0070658_10629910 3300005327 Bacteria 930
8 Ga0070683_100583644 3300005329 Bacteria 1069
9 Ga0070690_100323744 3300005330 Bacteria 1111
10 Ga0068869_100100923 3300005334 Bacteria 2182
11 Ga0070680_100338414 3300005336 Unclassified 1278
12 Ga0070660_100192178 3300005339 Bacteria 1654
13 Ga0070689_100353547 3300005340 Bacteria 1233
14 Ga0070687_100010290 3300005343 Bacteria 4040
15 Ga0070687_100042854 3300005343 Bacteria 2296
16 Ga0070675_100748797 3300005354 Bacteria 891
17 Ga0070673_100411385 3300005364 Bacteria 1211
18 Ga0070673_100672729 3300005364 Bacteria 949
19 Ga0070703_10002141 3300005406 Bacteria 5747
20 Ga0070701_10010549 3300005438 Bacteria 4089
21 Ga0070700_100082103 3300005441 Bacteria 2084
22 Ga0070708_100004618 3300005445 Bacteria 10845
23 Ga0070678_100491308 3300005456 Bacteria 1082
24 Ga0070662_100176938 3300005457 Bacteria 1679
25 Ga0070681_10073034 3300005458 Bacteria 3392
26 Ga0068867_100059588 3300005459 Unclassified 2830
27 Ga0070706_100004294 3300005467 Bacteria 13804
28 Ga0070707_100088093 3300005468 Bacteria 3003
29 Ga0070698_100021194 3300005471 Bacteria 6810
30 Ga0070679_100106690 3300005530 Bacteria 2787
31 Ga0070684_100055449 3300005535 Bacteria 3455
32 Ga0070686_100043647 3300005544 Bacteria 2814
33 Ga0070695_100006755 3300005545 Bacteria 6790
34 Ga0070695_100218130 3300005545 Bacteria 1373
35 Ga0070696_100049527 3300005546 Bacteria 2918
36 Ga0068855_100737003 3300005563 Bacteria 1052
37 Ga0070664_100052295 3300005564 Bacteria 3459
38 Ga0070664_100109527 3300005564 Bacteria 2409
39 Ga0068857_100006321 3300005577 Bacteria 10143
40 Ga0068857_100038046 3300005577 Bacteria 4261
41 Ga0068854_100693887 3300005578 Bacteria 878
42 Ga0068852_100422571 3300005616 Bacteria 1315
43 Ga0068864_100029756 3300005618 Bacteria 4628
44 Ga0068861_100164346 3300005719 Bacteria 1834
45 Ga0068863_100006766 3300005841 Bacteria 11240
46 Ga0068858_100397793 3300005842 Bacteria 1323
47 Ga0068858_100502023 3300005842 Bacteria 1172
48 Ga0068860_100094431 3300005843 Bacteria 2851
49 Ga0068862_100396123 3300005844 Bacteria 1291
50 Ga0081455_10000919 3300005937 Bacteria 37836
51 Ga0081455_10278914 3300005937 Bacteria 1208
52 Ga0081539_10014335 3300005985 Bacteria 5872
53 Ga0081539_10035583 3300005985 Bacteria 2989
54 Ga0070717_10257275 3300006028 Bacteria 1544
55 Ga0075363_100117106 3300006048 Bacteria 1485
56 Ga0075363_100222982 3300006048 Bacteria 1081
57 Ga0075364_10005042 3300006051 Bacteria 7654
58 Ga0075364_10005490 3300006051 Bacteria 7374
59 Ga0075432_10061487 3300006058 Bacteria 1338
60 Ga0070712_100009522 3300006175 Bacteria 6126
61 Ga0075362_10000810 3300006177 Bacteria 9342
62 Ga0075367_10026177 3300006178 Bacteria 3305
63 Ga0075367_10058592 3300006178 Bacteria 2292
64 Ga0075369_10064455 3300006186 Bacteria 1604
65 Ga0075369_10070025 3300006186 Bacteria 1543
66 Ga0097621_100000445 3300006237 Bacteria 28963
67 Ga0068871_100001310 3300006358 Bacteria 16647
68 Ga0075428_100000426 3300006844 Bacteria 41901
69 Ga0075431_100000059 3300006847 Bacteria 61740
70 Ga0075431_100318143 3300006847 Bacteria 1570
71 Ga0075429_100007528 3300006880 Bacteria 9453
72 Ga0105250_10062777 3300009092 Bacteria 1495
73 Ga0105240_10181444 3300009093 Bacteria 2484
74 Ga0111539_10002614 3300009094 Bacteria 23869
75 Ga0105245_10465815 3300009098 Bacteria 1275
76 Ga0105247_10008352 3300009101 Bacteria 6313
77 Ga0114129_10001483 3300009147 Bacteria 31789
78 Ga0105243_10048496 3300009148 Bacteria 3348
79 Ga0105243_10085525 3300009148 Bacteria 2585
80 Ga0105243_10134635 3300009148 Bacteria 2101
81 Ga0105241_10077007 3300009174 Bacteria 2602
82 Ga0105242_10095815 3300009176 Bacteria 2506
83 Ga0105248_10056291 3300009177 Bacteria 4412
84 Ga0105248_10896585 3300009177 Bacteria 1001
85 Ga0105238_10699783 3300009551 Bacteria 1025
86 Ga0157373_10195930 3300013100 Bacteria 1424
87 Ga0157370_10012366 3300013104 Bacteria 8856
88 Ga0157375_10146313 3300013308 Bacteria 2494
89 Ga0157375_10592043 3300013308 Bacteria 1269
90 Ga0157380_10042555 3300014326 Bacteria 3550
91 Ga0157380_10111236 3300014326 Bacteria 2302
92 Ga0157376_10126616 3300014969 Bacteria 2273
93 Ga0183362_10001 3300015683 Bacteria 2046624
94 Ga0163161_10089107 3300017792 Bacteria 2281
95 Ga0213874_10018031 3300021377 Bacteria 1903
96 Ga0209233_1005652 3300025261 Bacteria 4129
97 Ga0209130_1012227 3300025284 Bacteria 2258
98 Ga0209675_1007782 3300025291 Bacteria 4042
99 Ga0209564_1009934 3300025295 Bacteria 4452
100 Ga0209050_1008405 3300025298 Bacteria 5528
101 Ga0207426_1000004 3300025302 Bacteria 1047900
102 Ga0207655_1003880 3300025728 Bacteria 10876
103 Ga0207653_10000347 3300025885 Bacteria 23308
104 Ga0207692_10208072 3300025898 Bacteria 1154
105 Ga0207684_10060230 3300025910 Bacteria 3224
106 Ga0207707_10043643 3300025912 Bacteria 3910
107 Ga0207695_10200123 3300025913 Bacteria 1912
108 Ga0207693_10001023 3300025915 Bacteria 25036
109 Ga0207662_10015134 3300025918 Bacteria 4336
110 Ga0207662_10046606 3300025918 Bacteria 2564
111 Ga0207662_10087480 3300025918 Bacteria 1911
112 Ga0207657_10150193 3300025919 Bacteria 1898
113 Ga0207652_10062154 3300025921 Bacteria 3227
114 Ga0207646_10137140 3300025922 Bacteria 2203
115 Ga0207700_10531295 3300025928 Bacteria 1043
116 Ga0207664_10234250 3300025929 Bacteria 1597
117 Ga0207706_10017144 3300025933 Bacteria 6531
118 Ga0207709_10024152 3300025935 Bacteria 3468
119 Ga0207709_10541817 3300025935 Bacteria 914
120 Ga0207670_10120153 3300025936 Bacteria 1908
121 Ga0207691_10407264 3300025940 Bacteria 1160
122 Ga0207711_10015828 3300025941 Bacteria 6256
123 Ga0207711_10477125 3300025941 Bacteria 1162
124 Ga0207689_10087541 3300025942 Bacteria 2559
125 Ga0207679_10057291 3300025945 Bacteria 2881
126 Ga0207679_10098746 3300025945 Bacteria 2278
127 Ga0207651_10707821 3300025960 Bacteria 888
128 Ga0207640_10112480 3300025981 Bacteria 1933
129 Ga0207658_10396707 3300025986 Bacteria 1212
130 Ga0207703_10385764 3300026035 Bacteria 1297
131 Ga0207639_10279707 3300026041 Bacteria 1467
132 Ga0207708_10062030 3300026075 Bacteria 2855
133 Ga0207648_10063456 3300026089 Bacteria 3220
134 Ga0207648_10136318 3300026089 Unclassified 2162
135 Ga0207676_10062656 3300026095 Bacteria 2950
136 Ga0207674_10006766 3300026116 Bacteria 13453
137 Ga0207674_10221287 3300026116 Bacteria 1841
138 Ga0207674_10239807 3300026116 Bacteria 1760
139 Ga0207683_10606520 3300026121 Bacteria 1013
140 Ga0207428_10009343 3300027907 Bacteria 8795
141 Ga0207428_10096413 3300027907 Bacteria 2290
142 Ga0268265_10341159 3300028380 Bacteria 1364
143 Ga0265337_1002183 3300028556 Bacteria 9169
144 Ga0307517_10000035 3300028786 Bacteria 172762
145 Ga0307515_10092206 3300028794 Bacteria 3773
146 Ga0316181_1037493 3300030744 Bacteria 1297
147 Ga0265762_1003372 3300030760 Bacteria 2860
148 Ga0265332_10052084 3300031238 Bacteria 1758
149 Ga0265340_10015775 3300031247 Bacteria 3920
150 Ga0265342_10183260 3300031712 Bacteria 1146
151 Ga0307410_10559436 3300031852 Bacteria 949
152 Ga0307407_10216783 3300031903 Bacteria 1292
153 Ga0307416_101143540 3300032002 Bacteria 884
154 Ga0315911_1000004 3300033442 Bacteria 472637
155 Ga0373929_0019800 3300035085 Bacteria 1351
156 Ga0373934_0023702 3300035086 Bacteria 2372
157 Ga0373932_0024236 3300035112 Bacteria 1631
158 Ga0373936_0057790 3300035113 Bacteria 1578
159 Ga0373941_0018218 3300035115 Bacteria 1937
160 Ga0373954_0007126 3300035118 Bacteria 4881
161 Ga0373955_0006860 3300035172 Bacteria 5207
162 Ga0373961_0040940 3300035241 Bacteria 1337
163 Ga0373924_0004152 3300035410 Bacteria 5039
164 Ga0373931_0004070 3300035691 Bacteria 6628
165 Ga0373931_0011184 3300035691 Bacteria 4332
166 Ga0373935_0023511 3300035692 Bacteria 3787
167 Ga0373927_0022365 3300035695 Bacteria 4142
168 Ga0373933_0002610 3300035724 Bacteria 10097
169 Ga0373933_0495012 3300035724 Bacteria 801
170 Ga0373947_0019484 3300035725 Bacteria 3912
171 Ga0373937_0000403 3300036401 Bacteria 40423
172 Ga0373925_0099271 3300037068 Bacteria 2236
173 Ga0436365_1559602 3300039437 Bacteria 2213
174 Ga0436360_0985056 3300039438 Bacteria 2485
175 Ga0436363_0388188 3300039450 Bacteria 2490
176 Ga0436362_0480253 3300039453 Bacteria 1332
177 Ga0439435_0019353 3300042436 Bacteria 1744
178 Ga0466965_0039658 3300044683 Bacteria 2316
179 Ga0466966_0040659 3300044684 Bacteria 2992
180 Ga0466957_0069541 3300044842 Bacteria 2175
181 Ga0466959_0001589 3300045049 Bacteria 14001
182 Ga0466959_0404122 3300045049 Bacteria 928
183 Ga0451576_0015893 3300045051 Bacteria 8321
184 Ga0495592_0017240 3300046454 Bacteria 5485
185 Ga0495603_0008270 3300046455 Bacteria 6288
186 Ga0495590_0002032 3300046457 Bacteria 8498
187 Ga0495590_0022188 3300046457 Bacteria 2245
188 Ga0495629_0000119 3300046459 Bacteria 69922
189 Ga0495629_0000687 3300046459 Bacteria 27397
190 Ga0495638_0000558 3300046460 Bacteria 42376
191 Ga0495638_0002784 3300046460 Bacteria 14041
192 Ga0495638_0013995 3300046460 Bacteria 5439
193 Ga0495638_0061936 3300046460 Bacteria 2310
194 Ga0495651_0000185 3300046462 Bacteria 46374
195 Ga0495653_0000105 3300046463 Bacteria 69642
196 Ga0495653_0000831 3300046463 Bacteria 23809
197 Ga0495650_0010109 3300046471 Bacteria 5297
198 Ga0495580_0025976 3300046472 Bacteria 4273
199 Ga0495582_0061341 3300046473 Bacteria 2076
200 Ga0495605_0003091 3300046474 Bacteria 10041
201 Ga0495605_0010868 3300046474 Bacteria 5084
202 Ga0495605_0077974 3300046474 Bacteria 1553
203 Ga0495607_0004389 3300046501 Bacteria 10395
204 Ga0495583_0012502 3300046506 Bacteria 4796
205 Ga0495583_0055061 3300046506 Bacteria 1798
206 Ga0495606_0033922 3300046507 Bacteria 3512
207 Ga0495606_0109565 3300046507 Bacteria 1667
208 Ga0495608_0000598 3300046511 Bacteria 24822
209 Ga0495610_0003810 3300046512 Bacteria 11500
210 Ga0495610_0005191 3300046512 Bacteria 9327
211 Ga0495616_0005685 3300046513 Bacteria 7639
212 Ga0495616_0008108 3300046513 Bacteria 6254
213 Ga0495616_0008326 3300046513 Bacteria 6151
214 Ga0495620_0008148 3300046515 Bacteria 5640
215 Ga0495620_0034480 3300046515 Bacteria 2286
216 Ga0495628_0012799 3300046516 Bacteria 7065
217 Ga0495628_0032327 3300046516 Bacteria 4224
218 Ga0495630_0002805 3300046517 Bacteria 12087
219 Ga0495630_0024003 3300046517 Bacteria 4509
220 Ga0495631_0003347 3300046518 Bacteria 8791
221 Ga0495637_0086374 3300046520 Bacteria 1244
222 Ga0495648_0037818 3300046524 Bacteria 3096
223 Ga0495648_0229186 3300046524 Bacteria 910
224 Ga0495666_0024032 3300046526 Bacteria 3014
225 Ga0495652_0001337 3300046529 Bacteria 27446
226 Ga0495654_0004228 3300046530 Bacteria 8583
227 Ga0495654_0007875 3300046530 Bacteria 5925
228 Ga0495665_0022743 3300046531 Bacteria 3367
229 Ga0495640_0046814 3300046533 Bacteria 2995
230 Ga0495587_0003497 3300046536 Bacteria 10458
231 Ga0495609_0020394 3300046538 Bacteria 3063
232 Ga0495622_0007226 3300046557 Bacteria 5155
233 Ga0495667_0002126 3300046559 Bacteria 13187
234 Ga0495634_0001253 3300046642 Bacteria 23332
235 Ga0495611_0009097 3300046648 Bacteria 4199
236 Ga0495625_0013426 3300046660 Bacteria 6583
237 Ga0495625_0041326 3300046660 Bacteria 3357
238 Ga0495625_0362531 3300046660 Bacteria 913
239 Ga0495588_0121771 3300046674 Bacteria 1375
240 Ga0495588_0203171 3300046674 Bacteria 1047
241 Ga0495657_0009967 3300046675 Bacteria 7168
242 Ga0495599_0001430 3300046678 Bacteria 13677
243 Ga0495623_0002363 3300046679 Bacteria 12552
244 Ga0495646_0001973 3300046680 Bacteria 12375
245 Ga0495646_0012891 3300046680 Bacteria 5315
246 Ga0495669_0031681 3300046684 Bacteria 2322
247 Ga0495613_0072504 3300046689 Bacteria 2510
248 Ga0495613_0143302 3300046689 Bacteria 1706
249 Ga0495624_0107517 3300046690 Bacteria 1716
250 Ga0495649_0098741 3300046694 Bacteria 1553
251 Ga0495589_0019487 3300046794 Bacteria 3477
252 Ga0495589_0020644 3300046794 Bacteria 3369
253 Ga0495600_0000663 3300046809 Bacteria 17927
254 Ga0495660_0126627 3300046810 Bacteria 1286
255 Ga0495604_0000478 3300047317 Bacteria 35243
256 Ga0495674_0005391 3300047319 Bacteria 12279
257 Ga0495674_0047204 3300047319 Bacteria 3819
258 Ga0495676_0082146 3300047321 Bacteria 2439
259 Ga0495676_0186038 3300047321 Bacteria 1452
260 Ga0495680_0000640 3300047322 Bacteria 39222
261 Ga0495683_0034087 3300047323 Bacteria 2589
262 Ga0495683_0048843 3300047323 Bacteria 2120
263 Ga0495687_017631 3300047443 Bacteria 3554
264 Ga0495675_0003306 3300047444 Bacteria 9693
265 Ga0495677_0011179 3300047445 Bacteria 3286
266 Ga0495679_000036 3300047446 Bacteria 161473
267 Ga0495673_0005195 3300047469 Bacteria 7922
268 Ga0495686_0006696 3300047472 Bacteria 8767
269 Ga0495593_0012854 3300047673 Bacteria 4782
270 Ga0495602_0028131 3300048088 Bacteria 5385
271 Ga0495614_0049840 3300048089 Bacteria 1795
272 Ga0495626_0023838 3300048091 Bacteria 3007
273 Ga0495626_0042998 3300048091 Bacteria 2121
274 Ga0496100_0000086 3300048903 Bacteria 53043
275 Ga0496101_0000044 3300048904 Bacteria 161295
276 Ga0496101_0000224 3300048904 Bacteria 42435
277 Ga0496102_0010285 3300048905 Bacteria 8044
278 Ga0496102_0241086 3300048905 Bacteria 1705
279 Ga0496103_0001893 3300048906 Bacteria 13609
280 Ga0496104_0321329 3300048907 Bacteria 1461
281 Ga0496105_0003748 3300048908 Bacteria 11325
282 Ga0496106_0078646 3300048909 Bacteria 2531
283 Ga0496107_0138143 3300048910 Bacteria 1801
284 Ga0496109_0434765 3300048912 Bacteria 1240
285 Ga0496109_0503906 3300048912 Bacteria 1143
286 Ga0496112_0056945 3300048915 Bacteria 3848
287 Ga0496113_0002020 3300048916 Bacteria 11646
288 Ga0496113_0537949 3300048916 Bacteria 937
289 Ga0496116_0003806 3300048919 Bacteria 14746
290 Ga0496116_0047388 3300048919 Bacteria 2893
291 Ga0496116_0047641 3300048919 Bacteria 2884
292 Ga0496116_0064446 3300048919 Bacteria 2355
293 Ga0496116_0093811 3300048919 Bacteria 1816
294 Ga0496117_0000098 3300048920 Bacteria 196331
295 Ga0496117_0002577 3300048920 Bacteria 22566
296 Ga0496117_0017448 3300048920 Bacteria 5993
297 Ga0496117_0026156 3300048920 Bacteria 4571
298 Ga0496117_0086948 3300048920 Bacteria 2028
299 Ga0496117_0114277 3300048920 Bacteria 1674
300 Ga0496118_0000728 3300048921 Bacteria 53140
301 Ga0496118_0007352 3300048921 Bacteria 11712
302 Ga0496118_0025602 3300048921 Bacteria 5051
303 Ga0496119_0105287 3300048922 Bacteria 1576
304 Ga0496119_0116542 3300048922 Bacteria 1474
305 Ga0496121_0000643 3300048924 Bacteria 65217
306 Ga0496121_0004299 3300048924 Bacteria 19303
307 Ga0496121_0013301 3300048924 Bacteria 8859
308 Ga0496121_0021173 3300048924 Bacteria 6385
309 Ga0496121_0023049 3300048924 Bacteria 6014
310 Ga0496121_0026019 3300048924 Bacteria 5532
311 Ga0496121_0131176 3300048924 Bacteria 1875
312 Ga0496122_0021785 3300048925 Bacteria 5720
313 Ga0496122_0095067 3300048925 Bacteria 2015
314 Ga0496122_0130652 3300048925 Bacteria 1596
315 Ga0496122_0131798 3300048925 Bacteria 1586
316 Ga0496123_0002639 3300048926 Bacteria 21715
317 Ga0496123_0041512 3300048926 Bacteria 3188
318 Ga0496123_0114290 3300048926 Bacteria 1535
319 Ga0496124_0459077 3300048927 Bacteria 866
320 Ga0496125_0001227 3300048928 Bacteria 38397
321 Ga0496125_0056455 3300048928 Bacteria 3188
322 Ga0496125_0074948 3300048928 Bacteria 2621
323 Ga0496125_0187036 3300048928 Bacteria 1372
324 Ga0496126_0027842 3300048929 Bacteria 5391
325 Ga0496126_0107852 3300048929 Bacteria 2429
326 Ga0496126_0218149 3300048929 Bacteria 1604
327 Ga0496126_0308227 3300048929 Bacteria 1304
328 Ga0496126_0564602 3300048929 Bacteria 901
329 Ga0495678_017335 3300049459 Bacteria 3267
330 Ga0495682_0011728 3300049460 Bacteria 3368
331 Ga0495682_0024899 3300049460 Bacteria 2228
332 Ga0501031_0256804 3300049568 Bacteria 1136
333 Ga0501032_0007033 3300049569 Bacteria 8252
334 Ga0501033_0010149 3300049570 Bacteria 7229
335 Ga0501034_0075155 3300049571 Bacteria 3386
336 Ga0501036_0004663 3300049572 Bacteria 11075
337 Ga0501036_0914929 3300049572 Bacteria 720
338 Ga0501037_0005193 3300049573 Bacteria 9470
339 Ga0501038_0010330 3300049574 Bacteria 8539
340 Ga0501038_0363660 3300049574 Bacteria 1125
341 Ga0501039_0068875 3300049575 Bacteria 2747
342 Ga0501042_0164376 3300049578 Bacteria 1601
343 Ga0501043_0010483 3300049579 Bacteria 7258
344 Ga0501046_0013654 3300049580 Bacteria 6869
345 Ga0501046_0334927 3300049580 Bacteria 1101
346 Ga0501047_0092567 3300049581 Bacteria 2901
347 Ga0501047_0152425 3300049581 Bacteria 2187
348 Ga0501048_0033786 3300049582 Bacteria 3693
349 Ga0501048_0220992 3300049582 Bacteria 1344
350 Ga0501067_0070124 3300049583 Bacteria 1941
351 Ga0501068_0049668 3300049584 Bacteria 2534
352 Ga0501069_0009548 3300049585 Bacteria 5122
353 Ga0501070_0019709 3300049586 Bacteria 5656
354 Ga0501071_0299975 3300049587 Bacteria 1218
355 Ga0501073_0011504 3300049589 Bacteria 6470
356 Ga0501074_0035277 3300049590 Bacteria 3623
357 Ga0501076_0196732 3300049592 Bacteria 1646
358 Ga0501077_0198064 3300049593 Bacteria 1276
359 Ga0501079_0426866 3300049741 Bacteria 1041
360 Ga0501080_0008356 3300049742 Bacteria 9373
361 Ga0501083_0001455 3300049744 Bacteria 16165
362 Ga0501083_0024844 3300049744 Bacteria 4150
363 Ga0501083_0035426 3300049744 Bacteria 3409
364 Ga0501262_000165 3300049759 Bacteria 8174
365 Ga0501035_0026098 3300049822 Bacteria 5350
366 Ga0501044_0024850 3300049823 Bacteria 6354
367 Ga0501044_0428882 3300049823 Bacteria 1231
368 nmdc:mga00v17_27032_c1 3300050491 Bacteria 3347
369 nmdc:mga00v17_42903_c1 3300050491 Bacteria 2722
370 nmdc:mga0yw44_353828_c1 3300050492 Bacteria 989
371 nmdc:mga0k408_6128_c1 3300050493 Bacteria 6411
372 nmdc:mga06z11_78451_c1 3300050494 Bacteria 1765
373 nmdc:mga05p37_285_c1 3300050507 Bacteria 52916
374 nmdc:mga09592_9564_c1 3300050508 Bacteria 7877
375 nmdc:mga06r32_118_c1 3300050510 Bacteria 56778
376 nmdc:mga06r32_254298_c1 3300050510 Bacteria 1744
377 nmdc:mga08y16_293295_c1 3300050511 Bacteria 1677
378 nmdc:mga08y16_303_c1 3300050511 Bacteria 44322
379 nmdc:mga0sz30_9739_c1 3300050516 Bacteria 3664
380 Ga0495601_0001131 3300053077 Bacteria 14620
381 Ga0500635_0036175 3300053080 Bacteria 1626
382 Ga0495595_0000142 3300053084 Bacteria 29571
383 Ga0495619_0003389 3300053085 Bacteria 10299
384 Ga0495619_0053191 3300053085 Bacteria 2677
385 Ga0500643_002411 3300053087 Bacteria 9688
386 Ga0500643_029605 3300053087 Bacteria 1683
387 Ga0500644_0023243 3300053088 Bacteria 1880
388 Ga0500644_0181436 3300053088 Bacteria 862
389 Ga0500651_0077910 3300053093 Bacteria 2056
390 Ga0500566_0154254 3300053094 Bacteria 1204
391 Ga0500556_0000003 3300053104 Bacteria 679379
392 Ga0500556_0011257 3300053104 Bacteria 2646
393 Ga0500562_041104 3300053108 Bacteria 1229
394 Ga0500592_003029 3300053116 Bacteria 2686
395 Ga0500594_0002223 3300053118 Bacteria 4203
396 Ga0500595_003700 3300053119 Bacteria 7055
397 Ga0500626_030117 3300053128 Bacteria 2449
398 Ga0500652_000921 3300053131 Bacteria 9694
399 Ga0500658_0000058 3300053134 Bacteria 55299
400 Ga0500559_0004819 3300053136 Bacteria 6305
401 Ga0500568_0001594 3300053139 Bacteria 14345
402 Ga0500568_0001943 3300053139 Bacteria 12668
403 Ga0500577_0169598 3300053142 Bacteria 933
404 Ga0500604_0000208 3300053151 Bacteria 16819
405 Ga0500616_0000114 3300053153 Bacteria 148574
406 Ga0500616_0027644 3300053153 Bacteria 3130
407 Ga0500616_0070155 3300053153 Bacteria 1790
408 Ga0500622_0005705 3300053156 Bacteria 7400
409 Ga0500627_0130911 3300053158 Bacteria 1133
410 Ga0500636_0052503 3300053177 Bacteria 2394
411 Ga0501084_0006355 3300054114 Bacteria 9707
412 Ga0501082_0022242 3300060353 Bacteria 5464
413 Ga0501082_0338226 3300060353 Bacteria 1312
414 Ga0466962_0229822 3300061719 Bacteria 909

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048922 Ga0496119_0116542 Ga0496119_0116542_21_638 186
2 iso_pu_bacteria 2906401398 2906403977 199
3 3300049593 Ga0501077_0198064 Ga0501077_0198064_633_1256 200
4 3300035724 Ga0373933_0495012 Ga0373933_0495012_176_790 202
5 3300039437 Ga0436365_1559602 Ga0436365_1559602_993_1628 202
6 3300049572 Ga0501036_0914929 Ga0501036_0914929_60_698 210
7 3300005456 Ga0070678_100491308 Ga0070678_1004913082 214
8 3300005457 Ga0070662_100176938 Ga0070662_1001769382 214
9 3300005564 Ga0070664_100052295 Ga0070664_1000522953 214
10 3300006048 Ga0075363_100222982 Ga0075363_1002229821 214
11 3300009148 Ga0105243_10048496 Ga0105243_100484962 214
12 3300017792 Ga0163161_10089107 Ga0163161_100891073 214
13 3300025291 Ga0209675_1007782 Ga0209675_10077825 214
14 3300025298 Ga0209050_1008405 Ga0209050_10084052 214
15 3300025728 Ga0207655_1003880 Ga0207655_100388011 214
16 3300025933 Ga0207706_10017144 Ga0207706_100171442 214
17 3300025935 Ga0207709_10024152 Ga0207709_100241523 214
18 3300025945 Ga0207679_10057291 Ga0207679_100572913 214
19 3300025986 Ga0207658_10396707 Ga0207658_103967071 214
20 3300026116 Ga0207674_10221287 Ga0207674_102212872 214
21 3300026121 Ga0207683_10606520 Ga0207683_106065201 214
22 3300028794 Ga0307515_10092206 Ga0307515_100922062 214
23 3300030744 Ga0316181_1037493 Ga0316181_10374931 214
24 3300031903 Ga0307407_10216783 Ga0307407_102167832 214
25 3300046460 Ga0495638_0013995 Ga0495638_0013995_219_929 214
26 3300046512 Ga0495610_0005191 Ga0495610_0005191_1771_2481 214
27 3300046513 Ga0495616_0008326 Ga0495616_0008326_407_1117 214
28 3300046518 Ga0495631_0003347 Ga0495631_0003347_3316_4026 214
29 3300046530 Ga0495654_0004228 Ga0495654_0004228_5048_5773 214
30 3300046660 Ga0495625_0013426 Ga0495625_0013426_3016_3726 214
31 3300046674 Ga0495588_0121771 Ga0495588_0121771_162_872 214
32 3300048919 Ga0496116_0064446 Ga0496116_0064446_1146_1856 214
33 3300048920 Ga0496117_0026156 Ga0496117_0026156_3406_4116 214
34 3300048920 Ga0496117_0086948 Ga0496117_0086948_649_1359 214
35 3300048924 Ga0496121_0023049 Ga0496121_0023049_381_1091 214
36 3300048925 Ga0496122_0095067 Ga0496122_0095067_1140_1850 214
37 3300048925 Ga0496122_0130652 Ga0496122_0130652_859_1569 214
38 3300048926 Ga0496123_0041512 Ga0496123_0041512_1475_2185 214
39 3300048927 Ga0496124_0459077 Ga0496124_0459077_24_734 214
40 3300048928 Ga0496125_0074948 Ga0496125_0074948_839_1549 214
41 3300048929 Ga0496126_0107852 Ga0496126_0107852_609_1319 214
42 3300049759 Ga0501262_000165 Ga0501262_000165_3178_3888 214
43 3300053080 Ga0500635_0036175 Ga0500635_0036175_694_1404 214
44 3300053108 Ga0500562_041104 Ga0500562_041104_88_798 214
45 3300053116 Ga0500592_003029 Ga0500592_003029_1922_2632 214
46 3300053118 Ga0500594_0002223 Ga0500594_0002223_536_1246 214
47 3300053128 Ga0500626_030117 Ga0500626_030117_535_1245 214
48 3300053134 Ga0500658_0000058 Ga0500658_0000058_10622_11332 214
49 3300053136 Ga0500559_0004819 Ga0500559_0004819_872_1582 214
50 3300053139 Ga0500568_0001943 Ga0500568_0001943_3090_3800 214
51 3300053153 Ga0500616_0027644 Ga0500616_0027644_1067_1777 214
52 3300053153 Ga0500616_0070155 Ga0500616_0070155_694_1404 214
53 iso_pu_bacteria 8019597564 8019604808 215
54 3300003354 JGI25160J50197_1000184 JGI25160J50197_10001847 220
55 3300005262 Ga0065165_1001355 Ga0065165_100135520 220
56 3300025284 Ga0209130_1012227 Ga0209130_10122273 220
57 3300025302 Ga0207426_1000004 Ga0207426_1000004662 220
58 3300048903 Ga0496100_0000086 Ga0496100_0000086_7406_8116 220
59 3300048904 Ga0496101_0000044 Ga0496101_0000044_733_1443 220
60 3300048905 Ga0496102_0010285 Ga0496102_0010285_4283_4993 220
61 3300048906 Ga0496103_0001893 Ga0496103_0001893_5495_6205 220
62 3300048910 Ga0496107_0138143 Ga0496107_0138143_1064_1774 220
63 3300048916 Ga0496113_0537949 Ga0496113_0537949_61_771 220
64 3300048919 Ga0496116_0093811 Ga0496116_0093811_188_898 220
65 3300048920 Ga0496117_0000098 Ga0496117_0000098_35769_36479 220
66 3300048921 Ga0496118_0000728 Ga0496118_0000728_7491_8201 220
67 3300048922 Ga0496119_0105287 Ga0496119_0105287_449_1159 220
68 3300048924 Ga0496121_0013301 Ga0496121_0013301_7406_8116 220
69 3300048926 Ga0496123_0114290 Ga0496123_0114290_364_1074 220
70 3300006844 Ga0075428_100000426 Ga0075428_10000042630 225
71 3300006847 Ga0075431_100000059 Ga0075431_10000005918 225
72 3300006880 Ga0075429_100007528 Ga0075429_1000075289 225
73 3300027907 Ga0207428_10009343 Ga0207428_100093433 225
74 3300049574 Ga0501038_0363660 Ga0501038_0363660_46_729 225
75 iso_pu_bacteria 2848858292 2848863605 227
76 iso_pu_bacteria 3001889506 3001890525 228
77 3300005293 Ga0065715_10000497 Ga0065715_100004972 230
78 3300005330 Ga0070690_100323744 Ga0070690_1003237442 230
79 3300005334 Ga0068869_100100923 Ga0068869_1001009233 230
80 3300005336 Ga0070680_100338414 Ga0070680_1003384141 230
81 3300005339 Ga0070660_100192178 Ga0070660_1001921782 230
82 3300005343 Ga0070687_100010290 Ga0070687_1000102906 230
83 3300005364 Ga0070673_100672729 Ga0070673_1006727291 230
84 3300005406 Ga0070703_10002141 Ga0070703_100021412 230
85 3300005438 Ga0070701_10010549 Ga0070701_100105493 230
86 3300005441 Ga0070700_100082103 Ga0070700_1000821032 230
87 3300005445 Ga0070708_100004618 Ga0070708_1000046184 230
88 3300005458 Ga0070681_10073034 Ga0070681_100730343 230
89 3300005459 Ga0068867_100059588 Ga0068867_1000595882 230
90 3300005467 Ga0070706_100004294 Ga0070706_1000042946 230
91 3300005468 Ga0070707_100088093 Ga0070707_1000880935 230
92 3300005471 Ga0070698_100021194 Ga0070698_1000211943 230
93 3300005530 Ga0070679_100106690 Ga0070679_1001066903 230
94 3300005545 Ga0070695_100218130 Ga0070695_1002181302 230
95 3300005546 Ga0070696_100049527 Ga0070696_1000495273 230
96 3300005563 Ga0068855_100737003 Ga0068855_1007370032 230
97 3300005564 Ga0070664_100109527 Ga0070664_1001095272 230
98 3300005577 Ga0068857_100006321 Ga0068857_1000063213 230
99 3300005578 Ga0068854_100693887 Ga0068854_1006938872 230
100 3300005719 Ga0068861_100164346 Ga0068861_1001643462 230
101 3300005843 Ga0068860_100094431 Ga0068860_1000944312 230
102 3300005844 Ga0068862_100396123 Ga0068862_1003961232 230
103 3300009093 Ga0105240_10181444 Ga0105240_101814444 230
104 3300009098 Ga0105245_10465815 Ga0105245_104658152 230
105 3300009148 Ga0105243_10085525 Ga0105243_100855252 230
106 3300009176 Ga0105242_10095815 Ga0105242_100958154 230
107 3300013100 Ga0157373_10195930 Ga0157373_101959302 230
108 3300013308 Ga0157375_10146313 Ga0157375_101463134 230
109 3300014326 Ga0157380_10042555 Ga0157380_100425552 230
110 3300025885 Ga0207653_10000347 Ga0207653_1000034710 230
111 3300025910 Ga0207684_10060230 Ga0207684_100602302 230
112 3300025912 Ga0207707_10043643 Ga0207707_100436434 230
113 3300025913 Ga0207695_10200123 Ga0207695_102001232 230
114 3300025918 Ga0207662_10046606 Ga0207662_100466063 230
115 3300025919 Ga0207657_10150193 Ga0207657_101501934 230
116 3300025921 Ga0207652_10062154 Ga0207652_100621542 230
117 3300025922 Ga0207646_10137140 Ga0207646_101371402 230
118 3300025942 Ga0207689_10087541 Ga0207689_100875413 230
119 3300025945 Ga0207679_10098746 Ga0207679_100987462 230
120 3300025960 Ga0207651_10707821 Ga0207651_107078212 230
121 3300025981 Ga0207640_10112480 Ga0207640_101124801 230
122 3300026075 Ga0207708_10062030 Ga0207708_100620302 230
123 3300026089 Ga0207648_10063456 Ga0207648_100634564 230
124 3300026089 Ga0207648_10136318 Ga0207648_101363182 230
125 3300026116 Ga0207674_10006766 Ga0207674_100067668 230
126 3300028380 Ga0268265_10341159 Ga0268265_103411592 230
127 3300046674 Ga0495588_0203171 Ga0495588_0203171_46_759 230
128 iso_pu_bacteria 2513237166 2514047669 230
129 iso_pu_bacteria 2562617112 2563061075 230
130 iso_pu_bacteria 2711768613 2713476034 230
131 3300003771 Ga0055526_1027115 Ga0055526_10271152 231
132 3300005327 Ga0070658_10629910 Ga0070658_106299101 231
133 3300005329 Ga0070683_100583644 Ga0070683_1005836441 231
134 3300005340 Ga0070689_100353547 Ga0070689_1003535472 231
135 3300005343 Ga0070687_100042854 Ga0070687_1000428541 231
136 3300005354 Ga0070675_100748797 Ga0070675_1007487971 231
137 3300005364 Ga0070673_100411385 Ga0070673_1004113852 231
138 3300005535 Ga0070684_100055449 Ga0070684_1000554491 231
139 3300005544 Ga0070686_100043647 Ga0070686_1000436474 231
140 3300005545 Ga0070695_100006755 Ga0070695_1000067555 231
141 3300005841 Ga0068863_100006766 Ga0068863_1000067662 231
142 3300005842 Ga0068858_100502023 Ga0068858_1005020231 231
143 3300005937 Ga0081455_10000919 Ga0081455_1000091933 231
144 3300005937 Ga0081455_10278914 Ga0081455_102789142 231
145 3300005985 Ga0081539_10014335 Ga0081539_100143354 231
146 3300005985 Ga0081539_10035583 Ga0081539_100355833 231
147 3300006028 Ga0070717_10257275 Ga0070717_102572752 231
148 3300006048 Ga0075363_100117106 Ga0075363_1001171062 231
149 3300006051 Ga0075364_10005042 Ga0075364_1000504210 231
150 3300006051 Ga0075364_10005490 Ga0075364_100054907 231
151 3300006058 Ga0075432_10061487 Ga0075432_100614873 231
152 3300006175 Ga0070712_100009522 Ga0070712_1000095225 231
153 3300006177 Ga0075362_10000810 Ga0075362_100008103 231
154 3300006178 Ga0075367_10026177 Ga0075367_100261772 231
155 3300006178 Ga0075367_10058592 Ga0075367_100585922 231
156 3300006186 Ga0075369_10064455 Ga0075369_100644552 231
157 3300006186 Ga0075369_10070025 Ga0075369_100700252 231
158 3300006237 Ga0097621_100000445 Ga0097621_10000044512 231
159 3300006358 Ga0068871_100001310 Ga0068871_1000013106 231
160 3300006847 Ga0075431_100318143 Ga0075431_1003181432 231
161 3300009092 Ga0105250_10062777 Ga0105250_100627772 231
162 3300009094 Ga0111539_10002614 Ga0111539_100026143 231
163 3300009147 Ga0114129_10001483 Ga0114129_1000148331 231
164 3300009177 Ga0105248_10056291 Ga0105248_100562912 231
165 3300009551 Ga0105238_10699783 Ga0105238_106997832 231
166 3300014326 Ga0157380_10111236 Ga0157380_101112362 231
167 3300014969 Ga0157376_10126616 Ga0157376_101266163 231
168 3300015683 Ga0183362_10001 Ga0183362_10001922 231
169 3300021377 Ga0213874_10018031 Ga0213874_100180313 231
170 3300025261 Ga0209233_1005652 Ga0209233_10056523 231
171 3300025295 Ga0209564_1009934 Ga0209564_10099343 231
172 3300025898 Ga0207692_10208072 Ga0207692_102080722 231
173 3300025915 Ga0207693_10001023 Ga0207693_1000102311 231
174 3300025918 Ga0207662_10015134 Ga0207662_100151343 231
175 3300025928 Ga0207700_10531295 Ga0207700_105312952 231
176 3300025929 Ga0207664_10234250 Ga0207664_102342502 231
177 3300025935 Ga0207709_10541817 Ga0207709_105418171 231
178 3300025940 Ga0207691_10407264 Ga0207691_104072641 231
179 3300025941 Ga0207711_10015828 Ga0207711_100158284 231
180 3300026035 Ga0207703_10385764 Ga0207703_103857641 231
181 3300027907 Ga0207428_10096413 Ga0207428_100964132 231
182 3300028786 Ga0307517_10000035 Ga0307517_10000035120 231
183 3300030760 Ga0265762_1003372 Ga0265762_10033723 231
184 3300031852 Ga0307410_10559436 Ga0307410_105594362 231
185 3300032002 Ga0307416_101143540 Ga0307416_1011435401 231
186 3300033442 Ga0315911_1000004 Ga0315911_1000004454 231
187 3300035085 Ga0373929_0019800 Ga0373929_0019800_227_928 231
188 3300035086 Ga0373934_0023702 Ga0373934_0023702_822_1538 231
189 3300035112 Ga0373932_0024236 Ga0373932_0024236_380_1081 231
190 3300035113 Ga0373936_0057790 Ga0373936_0057790_105_821 231
191 3300035115 Ga0373941_0018218 Ga0373941_0018218_240_941 231
192 3300035118 Ga0373954_0007126 Ga0373954_0007126_3218_3934 231
193 3300035172 Ga0373955_0006860 Ga0373955_0006860_997_1713 231
194 3300035241 Ga0373961_0040940 Ga0373961_0040940_401_1102 231
195 3300035410 Ga0373924_0004152 Ga0373924_0004152_3464_4180 231
196 3300035691 Ga0373931_0004070 Ga0373931_0004070_3203_3904 231
197 3300035691 Ga0373931_0011184 Ga0373931_0011184_2211_2912 231
198 3300035692 Ga0373935_0023511 Ga0373935_0023511_2024_2740 231
199 3300035695 Ga0373927_0022365 Ga0373927_0022365_2873_3589 231
200 3300035724 Ga0373933_0002610 Ga0373933_0002610_352_1068 231
201 3300035725 Ga0373947_0019484 Ga0373947_0019484_1021_1737 231
202 3300036401 Ga0373937_0000403 Ga0373937_0000403_23921_24637 231
203 3300037068 Ga0373925_0099271 Ga0373925_0099271_1504_2220 231
204 3300039438 Ga0436360_0985056 Ga0436360_0985056_1323_2039 231
205 3300039450 Ga0436363_0388188 Ga0436363_0388188_671_1372 231
206 3300039453 Ga0436362_0480253 Ga0436362_0480253_305_1015 231
207 3300042436 Ga0439435_0019353 Ga0439435_0019353_603_1316 231
208 3300044683 Ga0466965_0039658 Ga0466965_0039658_1091_1801 231
209 3300044684 Ga0466966_0040659 Ga0466966_0040659_500_1213 231
210 3300044842 Ga0466957_0069541 Ga0466957_0069541_354_1064 231
211 3300045049 Ga0466959_0001589 Ga0466959_0001589_3823_4536 231
212 3300045049 Ga0466959_0404122 Ga0466959_0404122_84_794 231
213 3300045051 Ga0451576_0015893 Ga0451576_0015893_6521_7222 231
214 3300046454 Ga0495592_0017240 Ga0495592_0017240_2418_3134 231
215 3300046455 Ga0495603_0008270 Ga0495603_0008270_5220_5930 231
216 3300046457 Ga0495590_0002032 Ga0495590_0002032_5537_6247 231
217 3300046457 Ga0495590_0022188 Ga0495590_0022188_67_777 231
218 3300046459 Ga0495629_0000119 Ga0495629_0000119_36274_36984 231
219 3300046459 Ga0495629_0000687 Ga0495629_0000687_4042_4758 231
220 3300046460 Ga0495638_0000558 Ga0495638_0000558_31077_31796 231
221 3300046460 Ga0495638_0061936 Ga0495638_0061936_273_983 231
222 3300046462 Ga0495651_0000185 Ga0495651_0000185_20883_21599 231
223 3300046463 Ga0495653_0000105 Ga0495653_0000105_36007_36717 231
224 3300046463 Ga0495653_0000831 Ga0495653_0000831_180_896 231
225 3300046471 Ga0495650_0010109 Ga0495650_0010109_2257_2967 231
226 3300046472 Ga0495580_0025976 Ga0495580_0025976_2484_3194 231
227 3300046473 Ga0495582_0061341 Ga0495582_0061341_647_1357 231
228 3300046474 Ga0495605_0003091 Ga0495605_0003091_7036_7746 231
229 3300046474 Ga0495605_0077974 Ga0495605_0077974_92_802 231
230 3300046501 Ga0495607_0004389 Ga0495607_0004389_2631_3350 231
231 3300046506 Ga0495583_0012502 Ga0495583_0012502_2823_3533 231
232 3300046506 Ga0495583_0055061 Ga0495583_0055061_786_1496 231
233 3300046507 Ga0495606_0033922 Ga0495606_0033922_2777_3496 231
234 3300046507 Ga0495606_0109565 Ga0495606_0109565_723_1433 231
235 3300046511 Ga0495608_0000598 Ga0495608_0000598_7144_7860 231
236 3300046512 Ga0495610_0003810 Ga0495610_0003810_1827_2546 231
237 3300046513 Ga0495616_0005685 Ga0495616_0005685_5516_6226 231
238 3300046513 Ga0495616_0008108 Ga0495616_0008108_690_1409 231
239 3300046515 Ga0495620_0008148 Ga0495620_0008148_4852_5571 231
240 3300046515 Ga0495620_0034480 Ga0495620_0034480_133_843 231
241 3300046516 Ga0495628_0012799 Ga0495628_0012799_4033_4743 231
242 3300046516 Ga0495628_0032327 Ga0495628_0032327_1775_2491 231
243 3300046517 Ga0495630_0002805 Ga0495630_0002805_9244_9954 231
244 3300046517 Ga0495630_0024003 Ga0495630_0024003_827_1543 231
245 3300046520 Ga0495637_0086374 Ga0495637_0086374_213_932 231
246 3300046524 Ga0495648_0037818 Ga0495648_0037818_1822_2541 231
247 3300046524 Ga0495648_0229186 Ga0495648_0229186_93_803 231
248 3300046526 Ga0495666_0024032 Ga0495666_0024032_1387_2097 231
249 3300046529 Ga0495652_0001337 Ga0495652_0001337_24345_25061 231
250 3300046530 Ga0495654_0007875 Ga0495654_0007875_2950_3669 231
251 3300046531 Ga0495665_0022743 Ga0495665_0022743_1566_2276 231
252 3300046533 Ga0495640_0046814 Ga0495640_0046814_375_1091 231
253 3300046536 Ga0495587_0003497 Ga0495587_0003497_3139_3855 231
254 3300046538 Ga0495609_0020394 Ga0495609_0020394_375_1085 231
255 3300046557 Ga0495622_0007226 Ga0495622_0007226_392_1102 231
256 3300046559 Ga0495667_0002126 Ga0495667_0002126_1940_2656 231
257 3300046642 Ga0495634_0001253 Ga0495634_0001253_18253_18969 231
258 3300046648 Ga0495611_0009097 Ga0495611_0009097_3005_3715 231
259 3300046660 Ga0495625_0041326 Ga0495625_0041326_2437_3156 231
260 3300046660 Ga0495625_0362531 Ga0495625_0362531_119_829 231
261 3300046675 Ga0495657_0009967 Ga0495657_0009967_6231_6947 231
262 3300046678 Ga0495599_0001430 Ga0495599_0001430_4040_4771 231
263 3300046679 Ga0495623_0002363 Ga0495623_0002363_8406_9122 231
264 3300046680 Ga0495646_0001973 Ga0495646_0001973_5162_5878 231
265 3300046680 Ga0495646_0012891 Ga0495646_0012891_122_832 231
266 3300046684 Ga0495669_0031681 Ga0495669_0031681_698_1408 231
267 3300046689 Ga0495613_0072504 Ga0495613_0072504_1575_2285 231
268 3300046689 Ga0495613_0143302 Ga0495613_0143302_835_1551 231
269 3300046690 Ga0495624_0107517 Ga0495624_0107517_319_1035 231
270 3300046694 Ga0495649_0098741 Ga0495649_0098741_629_1339 231
271 3300046794 Ga0495589_0019487 Ga0495589_0019487_1518_2228 231
272 3300046794 Ga0495589_0020644 Ga0495589_0020644_1448_2158 231
273 3300046809 Ga0495600_0000663 Ga0495600_0000663_10069_10785 231
274 3300046810 Ga0495660_0126627 Ga0495660_0126627_73_792 231
275 3300047317 Ga0495604_0000478 Ga0495604_0000478_33038_33754 231
276 3300047319 Ga0495674_0005391 Ga0495674_0005391_5020_5730 231
277 3300047319 Ga0495674_0047204 Ga0495674_0047204_2216_2926 231
278 3300047321 Ga0495676_0082146 Ga0495676_0082146_134_844 231
279 3300047321 Ga0495676_0186038 Ga0495676_0186038_34_750 231
280 3300047322 Ga0495680_0000640 Ga0495680_0000640_22986_23702 231
281 3300047323 Ga0495683_0034087 Ga0495683_0034087_1521_2231 231
282 3300047323 Ga0495683_0048843 Ga0495683_0048843_1319_2029 231
283 3300047443 Ga0495687_017631 Ga0495687_017631_2102_2812 231
284 3300047444 Ga0495675_0003306 Ga0495675_0003306_202_918 231
285 3300047445 Ga0495677_0011179 Ga0495677_0011179_1958_2668 231
286 3300047446 Ga0495679_000036 Ga0495679_000036_21499_22209 231
287 3300047469 Ga0495673_0005195 Ga0495673_0005195_6079_6789 231
288 3300047472 Ga0495686_0006696 Ga0495686_0006696_3369_4088 231
289 3300047673 Ga0495593_0012854 Ga0495593_0012854_1358_2074 231
290 3300048088 Ga0495602_0028131 Ga0495602_0028131_2420_3136 231
291 3300048089 Ga0495614_0049840 Ga0495614_0049840_29_739 231
292 3300048091 Ga0495626_0023838 Ga0495626_0023838_1979_2689 231
293 3300048091 Ga0495626_0042998 Ga0495626_0042998_1069_1779 231
294 3300048904 Ga0496101_0000224 Ga0496101_0000224_4247_4957 231
295 3300048905 Ga0496102_0241086 Ga0496102_0241086_529_1248 231
296 3300048907 Ga0496104_0321329 Ga0496104_0321329_29_739 231
297 3300048908 Ga0496105_0003748 Ga0496105_0003748_2038_2748 231
298 3300048909 Ga0496106_0078646 Ga0496106_0078646_1207_1917 231
299 3300048912 Ga0496109_0434765 Ga0496109_0434765_106_822 231
300 3300048912 Ga0496109_0503906 Ga0496109_0503906_142_852 231
301 3300048915 Ga0496112_0056945 Ga0496112_0056945_698_1408 231
302 3300048916 Ga0496113_0002020 Ga0496113_0002020_7011_7721 231
303 3300048919 Ga0496116_0003806 Ga0496116_0003806_3994_4722 231
304 3300048919 Ga0496116_0047388 Ga0496116_0047388_1796_2506 231
305 3300048919 Ga0496116_0047641 Ga0496116_0047641_1460_2179 231
306 3300048920 Ga0496117_0002577 Ga0496117_0002577_15003_15722 231
307 3300048920 Ga0496117_0017448 Ga0496117_0017448_594_1322 231
308 3300048920 Ga0496117_0114277 Ga0496117_0114277_915_1637 231
309 3300048921 Ga0496118_0007352 Ga0496118_0007352_6949_7668 231
310 3300048921 Ga0496118_0025602 Ga0496118_0025602_3252_3962 231
311 3300048924 Ga0496121_0000643 Ga0496121_0000643_53969_54688 231
312 3300048924 Ga0496121_0004299 Ga0496121_0004299_13481_14203 231
313 3300048924 Ga0496121_0021173 Ga0496121_0021173_5423_6133 231
314 3300048924 Ga0496121_0026019 Ga0496121_0026019_534_1244 231
315 3300048924 Ga0496121_0131176 Ga0496121_0131176_178_888 231
316 3300048925 Ga0496122_0021785 Ga0496122_0021785_3549_4268 231
317 3300048925 Ga0496122_0131798 Ga0496122_0131798_660_1370 231
318 3300048926 Ga0496123_0002639 Ga0496123_0002639_9833_10552 231
319 3300048928 Ga0496125_0001227 Ga0496125_0001227_4118_4837 231
320 3300048928 Ga0496125_0056455 Ga0496125_0056455_1891_2619 231
321 3300048928 Ga0496125_0187036 Ga0496125_0187036_605_1315 231
322 3300048929 Ga0496126_0027842 Ga0496126_0027842_827_1546 231
323 3300048929 Ga0496126_0218149 Ga0496126_0218149_345_1055 231
324 3300048929 Ga0496126_0308227 Ga0496126_0308227_508_1236 231
325 3300048929 Ga0496126_0564602 Ga0496126_0564602_67_777 231
326 3300049459 Ga0495678_017335 Ga0495678_017335_301_1011 231
327 3300049460 Ga0495682_0011728 Ga0495682_0011728_630_1340 231
328 3300049460 Ga0495682_0024899 Ga0495682_0024899_93_803 231
329 3300049568 Ga0501031_0256804 Ga0501031_0256804_164_865 231
330 3300049580 Ga0501046_0334927 Ga0501046_0334927_48_749 231
331 3300049581 Ga0501047_0152425 Ga0501047_0152425_71_784 231
332 3300049582 Ga0501048_0220992 Ga0501048_0220992_112_813 231
333 3300049592 Ga0501076_0196732 Ga0501076_0196732_659_1360 231
334 3300049741 Ga0501079_0426866 Ga0501079_0426866_212_913 231
335 3300049744 Ga0501083_0001455 Ga0501083_0001455_6211_6912 231
336 3300049823 Ga0501044_0428882 Ga0501044_0428882_291_1004 231
337 3300050491 nmdc:mga00v17_27032_c1 nmdc:mga00v17_27032_c1_1706_2434 231
338 3300050491 nmdc:mga00v17_42903_c1 nmdc:mga00v17_42903_c1_608_1321 231
339 3300050492 nmdc:mga0yw44_353828_c1 nmdc:mga0yw44_353828_c1_112_828 231
340 3300050493 nmdc:mga0k408_6128_c1 nmdc:mga0k408_6128_c1_4344_5057 231
341 3300050494 nmdc:mga06z11_78451_c1 nmdc:mga06z11_78451_c1_667_1395 231
342 3300050507 nmdc:mga05p37_285_c1 nmdc:mga05p37_285_c1_5011_5712 231
343 3300050508 nmdc:mga09592_9564_c1 nmdc:mga09592_9564_c1_2297_2998 231
344 3300050510 nmdc:mga06r32_118_c1 nmdc:mga06r32_118_c1_40756_41457 231
345 3300050510 nmdc:mga06r32_254298_c1 nmdc:mga06r32_254298_c1_684_1397 231
346 3300050511 nmdc:mga08y16_293295_c1 nmdc:mga08y16_293295_c1_943_1656 231
347 3300050511 nmdc:mga08y16_303_c1 nmdc:mga08y16_303_c1_9599_10300 231
348 3300050516 nmdc:mga0sz30_9739_c1 nmdc:mga0sz30_9739_c1_942_1670 231
349 3300053077 Ga0495601_0001131 Ga0495601_0001131_9368_10084 231
350 3300053084 Ga0495595_0000142 Ga0495595_0000142_22895_23611 231
351 3300053085 Ga0495619_0003389 Ga0495619_0003389_2582_3298 231
352 3300053085 Ga0495619_0053191 Ga0495619_0053191_35_781 231
353 3300053087 Ga0500643_002411 Ga0500643_002411_624_1343 231
354 3300053087 Ga0500643_029605 Ga0500643_029605_158_883 231
355 3300053088 Ga0500644_0023243 Ga0500644_0023243_735_1454 231
356 3300053088 Ga0500644_0181436 Ga0500644_0181436_38_766 231
357 3300053093 Ga0500651_0077910 Ga0500651_0077910_443_1171 231
358 3300053094 Ga0500566_0154254 Ga0500566_0154254_77_799 231
359 3300053104 Ga0500556_0000003 Ga0500556_0000003_455563_456282 231
360 3300053104 Ga0500556_0011257 Ga0500556_0011257_798_1517 231
361 3300053119 Ga0500595_003700 Ga0500595_003700_1283_2011 231
362 3300053131 Ga0500652_000921 Ga0500652_000921_218_940 231
363 3300053139 Ga0500568_0001594 Ga0500568_0001594_7664_8383 231
364 3300053151 Ga0500604_0000208 Ga0500604_0000208_4923_5642 231
365 3300053153 Ga0500616_0000114 Ga0500616_0000114_50339_51058 231
366 3300053156 Ga0500622_0005705 Ga0500622_0005705_3888_4607 231
367 3300053158 Ga0500627_0130911 Ga0500627_0130911_38_766 231
368 3300053177 Ga0500636_0052503 Ga0500636_0052503_393_1115 231
369 3300054114 Ga0501084_0006355 Ga0501084_0006355_8498_9199 231
370 3300060353 Ga0501082_0338226 Ga0501082_0338226_61_762 231
371 3300061719 Ga0466962_0229822 Ga0466962_0229822_170_883 231
372 iso_pu_bacteria 2513237137 2513862159 231
373 iso_pu_bacteria 2517572143 2517895311 231
374 iso_pu_bacteria 2602042107 2603857608 231
375 iso_pu_bacteria 2643221547 2643754847 231
376 iso_pu_bacteria 2791355197 2793069283 231
377 iso_pu_bacteria 2888378607 2888378903 231
378 iso_pu_bacteria 2903748898 2903750429 231
379 iso_pu_bacteria 2904690495 2904698644 231
380 iso_pu_bacteria 2906660503 2906663540 231
381 iso_pu_bacteria 2908739725 2908745504 231
382 iso_pu_bacteria 2908756301 2908761976 231
383 iso_pu_bacteria 2919073203 2919076605 231
384 iso_pu_bacteria 2935608549 2935613705 231
385 iso_pu_bacteria 2935638405 2935643346 231
386 iso_pu_bacteria 2935703347 2935713141 231
387 iso_pu_bacteria 2935827899 2935832869 231
388 iso_pu_bacteria 2935864058 2935873365 231
389 iso_pu_bacteria 2935873716 2935879207 231
390 iso_pu_bacteria 2935992306 2935996852 231
391 iso_pu_bacteria 3005474847 3005477031 231
392 iso_pu_bacteria 8019576017 8019578836 231
393 iso_pu_bacteria 8019586578 8019596907 231
394 iso_pu_bacteria 8019608314 8019613722 231
395 iso_pu_bacteria 8024486573 8024490714 231
396 iso_pu_bacteria 8054002106 8054009065 231
397 3300002459 JGI24751J29686_10032029 JGI24751J29686_100320292 232
398 3300005327 Ga0070658_10305818 Ga0070658_103058181 232
399 3300005577 Ga0068857_100038046 Ga0068857_1000380462 232
400 3300005616 Ga0068852_100422571 Ga0068852_1004225712 232
401 3300005618 Ga0068864_100029756 Ga0068864_1000297564 232
402 3300005842 Ga0068858_100397793 Ga0068858_1003977932 232
403 3300009101 Ga0105247_10008352 Ga0105247_100083525 232
404 3300009148 Ga0105243_10134635 Ga0105243_101346352 232
405 3300009174 Ga0105241_10077007 Ga0105241_100770072 232
406 3300009177 Ga0105248_10896585 Ga0105248_108965851 232
407 3300013104 Ga0157370_10012366 Ga0157370_100123663 232
408 3300013308 Ga0157375_10592043 Ga0157375_105920432 232
409 3300025918 Ga0207662_10087480 Ga0207662_100874802 232
410 3300025936 Ga0207670_10120153 Ga0207670_101201532 232
411 3300025941 Ga0207711_10477125 Ga0207711_104771252 232
412 3300026041 Ga0207639_10279707 Ga0207639_102797072 232
413 3300026095 Ga0207676_10062656 Ga0207676_100626562 232
414 3300026116 Ga0207674_10239807 Ga0207674_102398072 232
415 3300028556 Ga0265337_1002183 Ga0265337_100218310 232
416 3300031238 Ga0265332_10052084 Ga0265332_100520842 232
417 3300031247 Ga0265340_10015775 Ga0265340_100157754 232
418 3300031712 Ga0265342_10183260 Ga0265342_101832601 232
419 3300046460 Ga0495638_0002784 Ga0495638_0002784_6107_6805 232
420 3300046474 Ga0495605_0010868 Ga0495605_0010868_447_1145 232
421 3300049569 Ga0501032_0007033 Ga0501032_0007033_2333_3064 232
422 3300049570 Ga0501033_0010149 Ga0501033_0010149_5081_5812 232
423 3300049571 Ga0501034_0075155 Ga0501034_0075155_1677_2408 232
424 3300049572 Ga0501036_0004663 Ga0501036_0004663_4436_5167 232
425 3300049573 Ga0501037_0005193 Ga0501037_0005193_3865_4596 232
426 3300049574 Ga0501038_0010330 Ga0501038_0010330_5493_6224 232
427 3300049575 Ga0501039_0068875 Ga0501039_0068875_1330_2061 232
428 3300049578 Ga0501042_0164376 Ga0501042_0164376_230_961 232
429 3300049579 Ga0501043_0010483 Ga0501043_0010483_4813_5544 232
430 3300049580 Ga0501046_0013654 Ga0501046_0013654_3086_3817 232
431 3300049581 Ga0501047_0092567 Ga0501047_0092567_1501_2232 232
432 3300049582 Ga0501048_0033786 Ga0501048_0033786_1818_2549 232
433 3300049583 Ga0501067_0070124 Ga0501067_0070124_433_1164 232
434 3300049584 Ga0501068_0049668 Ga0501068_0049668_1333_2064 232
435 3300049585 Ga0501069_0009548 Ga0501069_0009548_1481_2212 232
436 3300049586 Ga0501070_0019709 Ga0501070_0019709_2825_3556 232
437 3300049587 Ga0501071_0299975 Ga0501071_0299975_94_825 232
438 3300049589 Ga0501073_0011504 Ga0501073_0011504_3735_4466 232
439 3300049590 Ga0501074_0035277 Ga0501074_0035277_204_935 232
440 3300049742 Ga0501080_0008356 Ga0501080_0008356_3210_3941 232
441 3300049744 Ga0501083_0024844 Ga0501083_0024844_2848_3546 232
442 3300049744 Ga0501083_0035426 Ga0501083_0035426_841_1572 232
443 3300049822 Ga0501035_0026098 Ga0501035_0026098_3167_3898 232
444 3300049823 Ga0501044_0024850 Ga0501044_0024850_5162_5893 232
445 3300053142 Ga0500577_0169598 Ga0500577_0169598_129_827 232
446 3300060353 Ga0501082_0022242 Ga0501082_0022242_2296_3027 232

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

22

174

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9681 2 231
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9559 2 231
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9518 2 221
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9337 2 221
2awn-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.9337 2 221
ID Description Score Start End Superfamily
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9874 1 229 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9664 1 229 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9599 1 230 3.40.50.300
1ji0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9528 2 231 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9524 2 216 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A854GVC9-F1-model_v4 deleted 0.9915 1 227
AF-A0A496QUQ5-F1-model_v4 ABC transporter ATP-binding protein 0.9879 2 231 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A6G6K803-F1-model_v4 ABC transporter ATP-binding protein 0.9869 1 229 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A1S1RJF5-F1-model_v4 ABC transporter ATP-binding protein 0.9865 2 229 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A238D136-F1-model_v4 Leucine/isoleucine/valine transporter subunit ATP-binding component of ABC superfamily 0.9863 1 228 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887

Feature Viewer

pLDDT pTM Quality
92.76 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map