F445767

General Info

Members Datasets Scaffolds Average Seq Length
446 268 409 344

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0015285|Ga0395901_0015285_6168_7343
Length 391
Sequence MTSCDLAARAAETQDVPDDVLHPGRPDSRDAGHPTMHGHAFTCIVMHMPKKHVAVVGASGYAGGEVLRLLLGHPGVEIGALTGAGNAGETLGVLQPHLVPLADRVLDETSAATLAGHDVVFLALPHGQSAAIAEQLGDDVVVIDCGADFRLTDPEAWERFYGSPYAGSWPYGLPELPGQRGKLAGRHRIAVPGCYPTVSTLTLAPAVAAGLVETDDIVVVAASGTSGAGKAARPHLLGSEVMGSVSAYGVGGVHRHTPEIVQNLAGLADREVRVSFTPLLVPMPRGILATGTATVADGVTAEDLRAAYSKAYDDEPFVHLLPEGRWPTTGAVLGSNAVHVQVTLDPSAGRMVAVGAVDNLAKGTAGAAVQCMNLALGLDETTGLTTVGVAP

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2547132424 Nocardia nova SH22a Isolate Unclassified
3 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
4 2643221561 Nocardioides sp. Root151 Isolate Unclassified
5 2643221615 Nocardioides sp. Root224 Isolate Unclassified
6 2643221641 Nocardioides sp. Root122 Isolate Unclassified
7 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
8 2643221696 Nocardioides sp. Root140 Isolate Unclassified
9 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
10 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
11 2739367898 Nocardioides sp. CF479 Isolate Unclassified
12 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
13 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
14 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
15 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
16 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
17 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
18 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
19 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
20 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
21 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
22 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
23 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
24 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
25 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
26 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
27 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
28 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
29 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
30 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
31 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
32 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
33 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
34 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
35 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
36 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
37 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
51 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
52 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
148 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
149 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
150 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
151 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
172 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
173 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
174 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
175 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
176 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
177 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
179 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
180 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
185 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
186 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
193 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
213 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
214 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
215 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
216 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
217 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
218 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
252 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
253 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
254 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
255 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
259 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
260 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
261 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
262 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
263 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
266 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
267 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
268 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.48
Metatranscriptomes 0.22
Isolates 8.3

Biome Distribution

Category Percentage (%)
Aerial Root 0.67
Bulb 0
Endosphere 5.38
Nodule 0
Rhizoplane 8.07
Rhizosphere 74.44
Stem 0
Stem Tuber 0
Unclassified 11.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10000855 3300001990 Bacteria 10856
2 JGI24737J22298_10006918 3300001990 Bacteria 3849
3 Ga0070658_10041312 3300005327 Bacteria 3720
4 Ga0070683_100004858 3300005329 Bacteria 11132
5 Ga0070683_100018309 3300005329 Bacteria 6200
6 Ga0070683_100020733 3300005329 Bacteria 5853
7 Ga0070683_100063766 3300005329 Bacteria 3429
8 Ga0070683_100198977 3300005329 Bacteria 1903
9 Ga0070683_100286446 3300005329 Bacteria 1567
10 Ga0070680_100007781 3300005336 Bacteria 8168
11 Ga0070682_100096859 3300005337 Bacteria 1940
12 Ga0070691_10024734 3300005341 Bacteria 2793
13 Ga0070692_10012349 3300005345 Bacteria 3951
14 Ga0070692_10016467 3300005345 Bacteria 3516
15 Ga0070675_100154855 3300005354 Bacteria 1967
16 Ga0070671_100000123 3300005355 Bacteria 50096
17 Ga0070671_100230510 3300005355 Bacteria 1571
18 Ga0070674_100026508 3300005356 Bacteria 3788
19 Ga0070659_100026103 3300005366 Bacteria 4493
20 Ga0070659_100106706 3300005366 Bacteria 2258
21 Ga0070659_100330598 3300005366 Bacteria 1275
22 Ga0070667_100037890 3300005367 Bacteria 4043
23 Ga0070714_100003821 3300005435 Bacteria 11312
24 Ga0070710_10000813 3300005437 Bacteria 15009
25 Ga0070701_10111241 3300005438 Bacteria 1530
26 Ga0070700_100029988 3300005441 Bacteria 3247
27 Ga0070700_100044964 3300005441 Bacteria 2722
28 Ga0070663_100042115 3300005455 Bacteria 3207
29 Ga0070663_100275982 3300005455 Bacteria 1338
30 Ga0070698_100001494 3300005471 Bacteria 25962
31 Ga0070698_100060610 3300005471 Bacteria 3819
32 Ga0070684_100002926 3300005535 Bacteria 12692
33 Ga0070684_100077629 3300005535 Bacteria 2933
34 Ga0070684_100164060 3300005535 Bacteria 2016
35 Ga0070672_100001030 3300005543 Bacteria 16961
36 Ga0070665_100001499 3300005548 Bacteria 27178
37 Ga0070665_100009827 3300005548 Bacteria 9671
38 Ga0070665_100274608 3300005548 Bacteria 1687
39 Ga0070665_100322523 3300005548 Bacteria 1549
40 Ga0068855_100698752 3300005563 Bacteria 1085
41 Ga0068857_100015467 3300005577 Bacteria 6666
42 Ga0068857_100065448 3300005577 Bacteria 3232
43 Ga0068854_100042056 3300005578 Bacteria 3232
44 Ga0068856_100165210 3300005614 Bacteria 2224
45 Ga0070702_100081238 3300005615 Bacteria 1942
46 Ga0068852_100012616 3300005616 Bacteria 6424
47 Ga0068859_100016266 3300005617 Bacteria 7472
48 Ga0068859_100120968 3300005617 Bacteria 2684
49 Ga0068861_100019491 3300005719 Bacteria 4845
50 Ga0068861_100083006 3300005719 Bacteria 2512
51 Ga0068870_10005350 3300005840 Bacteria 5600
52 Ga0068863_100004293 3300005841 Bacteria 14035
53 Ga0068863_100286788 3300005841 Bacteria 1596
54 Ga0068858_100184599 3300005842 Bacteria 1970
55 Ga0068860_100001541 3300005843 Bacteria 24832
56 Ga0081538_10001227 3300005981 Bacteria 26904
57 Ga0081539_10018128 3300005985 Bacteria 4902
58 Ga0075365_10000618 3300006038 Bacteria 14004
59 Ga0075365_10040412 3300006038 Bacteria 3041
60 Ga0075365_10149307 3300006038 Bacteria 1626
61 Ga0075365_10179165 3300006038 Bacteria 1481
62 Ga0075363_100003598 3300006048 Bacteria 6634
63 Ga0075363_100054407 3300006048 Bacteria 2141
64 Ga0075363_100065739 3300006048 Bacteria 1961
65 Ga0075367_10010052 3300006178 Bacteria 4961
66 Ga0075367_10024916 3300006178 Bacteria 3377
67 Ga0075370_10029470 3300006353 Bacteria 3058
68 Ga0075370_10162993 3300006353 Bacteria 1309
69 Ga0075434_100202169 3300006871 Bacteria 2007
70 Ga0068865_100036074 3300006881 Bacteria 3331
71 Ga0068865_100400622 3300006881 Bacteria 1124
72 Ga0097620_100016266 3300006931 Bacteria 7472
73 Ga0097620_100120965 3300006931 Bacteria 2684
74 Ga0105240_10086954 3300009093 Bacteria 3828
75 Ga0111539_10184081 3300009094 Bacteria 2439
76 Ga0105245_10006602 3300009098 Bacteria 10185
77 Ga0105245_10266750 3300009098 Bacteria 1668
78 Ga0105245_10396787 3300009098 Bacteria 1377
79 Ga0105247_10024033 3300009101 Bacteria 3670
80 Ga0105243_10014044 3300009148 Bacteria 6061
81 Ga0105242_10329124 3300009176 Bacteria 1404
82 Ga0105248_10069580 3300009177 Bacteria 3951
83 Ga0105237_10216642 3300009545 Bacteria 1914
84 Ga0105237_10232455 3300009545 Bacteria 1844
85 Ga0105238_10021151 3300009551 Bacteria 6631
86 Ga0105249_10063642 3300009553 Bacteria 3389
87 Ga0105239_10015679 3300010375 Bacteria 8388
88 Ga0105239_10138718 3300010375 Bacteria 2709
89 Ga0157373_10013580 3300013100 Bacteria 5974
90 Ga0157371_10280051 3300013102 Bacteria 1204
91 Ga0157370_10105906 3300013104 Bacteria 2632
92 Ga0157369_10169056 3300013105 Bacteria 2304
93 Ga0157374_10147219 3300013296 Bacteria 2288
94 Ga0163162_10019899 3300013306 Bacteria 6592
95 Ga0157372_10025547 3300013307 Bacteria 6425
96 Ga0157372_10044921 3300013307 Bacteria 4897
97 Ga0157372_10080062 3300013307 Bacteria 3695
98 Ga0157372_10122030 3300013307 Bacteria 2994
99 Ga0157375_10012926 3300013308 Bacteria 7415
100 Ga0163163_10056704 3300014325 Bacteria 3872
101 Ga0163163_10116810 3300014325 Bacteria 2699
102 Ga0163163_10164553 3300014325 Bacteria 2264
103 Ga0157380_10178793 3300014326 Bacteria 1862
104 Ga0182008_10064627 3300014497 Bacteria 1801
105 Ga0157377_10110342 3300014745 Bacteria 1652
106 Ga0157379_10042400 3300014968 Bacteria 4063
107 Ga0157376_10147542 3300014969 Bacteria 2117
108 Ga0206353_10512837 3300020082 Bacteria 1157
109 Ga0213876_10018813 3300021384 Bacteria 3648
110 Ga0213875_10022850 3300021388 Bacteria 2990
111 Ga0207692_10034552 3300025898 Bacteria 2448
112 Ga0207710_10006216 3300025900 Bacteria 5111
113 Ga0207688_10014810 3300025901 Bacteria 4232
114 Ga0207647_10010951 3300025904 Bacteria 6379
115 Ga0207647_10161446 3300025904 Bacteria 1307
116 Ga0207645_10024353 3300025907 Bacteria 3926
117 Ga0207645_10145398 3300025907 Bacteria 1545
118 Ga0207643_10002264 3300025908 Bacteria 10488
119 Ga0207705_10013300 3300025909 Bacteria 5938
120 Ga0207695_10012451 3300025913 Bacteria 10213
121 Ga0207671_10114299 3300025914 Bacteria 2057
122 Ga0207660_10006893 3300025917 Bacteria 7355
123 Ga0207657_10007406 3300025919 Bacteria 11252
124 Ga0207649_10021518 3300025920 Bacteria 3714
125 Ga0207652_10102131 3300025921 Bacteria 2534
126 Ga0207687_10059878 3300025927 Bacteria 2684
127 Ga0207664_10072855 3300025929 Bacteria 2771
128 Ga0207644_10001264 3300025931 Bacteria 16262
129 Ga0207690_10133013 3300025932 Bacteria 1823
130 Ga0207709_10014110 3300025935 Bacteria 4411
131 Ga0207669_10035018 3300025937 Bacteria 2852
132 Ga0207704_10082965 3300025938 Bacteria 2078
133 Ga0207704_10214376 3300025938 Bacteria 1420
134 Ga0207691_10001201 3300025940 Bacteria 25783
135 Ga0207711_10054391 3300025941 Bacteria 3435
136 Ga0207689_10096922 3300025942 Bacteria 2422
137 Ga0207661_10087570 3300025944 Bacteria 2587
138 Ga0207661_10153855 3300025944 Bacteria 1990
139 Ga0207661_10292324 3300025944 Bacteria 1459
140 Ga0207712_10197683 3300025961 Bacteria 1592
141 Ga0207640_10049634 3300025981 Bacteria 2718
142 Ga0207658_10371428 3300025986 Bacteria 1250
143 Ga0207678_10048427 3300026067 Bacteria 3674
144 Ga0207678_10054792 3300026067 Bacteria 3435
145 Ga0207708_10000513 3300026075 Bacteria 29912
146 Ga0207708_10072156 3300026075 Bacteria 2645
147 Ga0207702_10017335 3300026078 Bacteria 5959
148 Ga0207641_10003429 3300026088 Bacteria 14048
149 Ga0207648_10015694 3300026089 Bacteria 6951
150 Ga0207676_10042938 3300026095 Bacteria 3478
151 Ga0207676_10290314 3300026095 Bacteria 1489
152 Ga0207674_10017010 3300026116 Bacteria 7939
153 Ga0207674_10048489 3300026116 Bacteria 4347
154 Ga0207674_10102848 3300026116 Bacteria 2836
155 Ga0207674_10119740 3300026116 Bacteria 2601
156 Ga0207674_10133062 3300026116 Bacteria 2450
157 Ga0207675_100004561 3300026118 Bacteria 13362
158 Ga0207675_100014826 3300026118 Bacteria 7274
159 Ga0207698_10029954 3300026142 Bacteria 3906
160 Ga0209813_10000804 3300027866 Bacteria 7117
161 Ga0207428_10030952 3300027907 Bacteria 4421
162 Ga0268266_10036031 3300028379 Bacteria 4209
163 Ga0268266_10208715 3300028379 Bacteria 1791
164 Ga0268264_10001453 3300028381 Bacteria 22147
165 Ga0316177_1197294 3300030731 Bacteria 1937
166 Ga0316176_1218664 3300030732 Bacteria 3160
167 Ga0316180_1091681 3300030736 Bacteria 2914
168 Ga0316181_1291543 3300030744 Bacteria 1771
169 Ga0316182_1108171 3300030745 Bacteria 7208
170 Ga0265327_10000041 3300031251 Bacteria 288506
171 Ga0307513_10009318 3300031456 Bacteria 12429
172 Ga0307413_10013799 3300031824 Bacteria 4079
173 Ga0307518_10011209 3300031838 Bacteria 6408
174 Ga0307410_10234638 3300031852 Bacteria 1418
175 Ga0307409_100015002 3300031995 Bacteria 5066
176 Ga0307416_100037561 3300032002 Bacteria 3728
177 Ga0307414_10402933 3300032004 Bacteria 1189
178 Ga0307411_10076288 3300032005 Bacteria 2291
179 Ga0307415_100001865 3300032126 Bacteria 10337
180 Ga0307507_10002765 3300033179 Bacteria 35856
181 Ga0307507_10009773 3300033179 Bacteria 12665
182 Ga0395899_0032993 3300037312 Bacteria 3890
183 Ga0395900_0056892 3300037418 Bacteria 4026
184 Ga0395900_0142831 3300037418 Bacteria 2450
185 Ga0395898_0014692 3300037466 Bacteria 8039
186 Ga0395898_0053418 3300037466 Bacteria 3946
187 Ga0395898_0211395 3300037466 Bacteria 1850
188 Ga0395905_0010044 3300037471 Bacteria 9226
189 Ga0395905_0455454 3300037471 Bacteria 1177
190 Ga0395905_0480981 3300037471 Bacteria 1141
191 Ga0436364_0606713 3300037853 Bacteria 9522
192 Ga0436364_0980570 3300037853 Bacteria 1205
193 Ga0395901_0015285 3300038443 Bacteria 7810
194 Ga0395901_0033900 3300038443 Bacteria 5272
195 Ga0395901_0039115 3300038443 Bacteria 4907
196 Ga0395901_0079722 3300038443 Bacteria 3419
197 Ga0395901_0091852 3300038443 Bacteria 3178
198 Ga0395901_0242868 3300038443 Bacteria 1878
199 Ga0400483_062358 3300039062 Bacteria 16680
200 Ga0400483_276618 3300039062 Bacteria 37892
201 Ga0436365_1648284 3300039437 Bacteria 9032
202 Ga0451793_0330630 3300041452 Bacteria 3024
203 Ga0451833_1052414 3300041491 Bacteria 10150
204 Ga0451837_0346962 3300041494 Bacteria 1819
205 Ga0451839_1058945 3300041496 Bacteria 1467
206 Ga0451853_0222545 3300041512 Bacteria 6879
207 Ga0439445_0024137 3300042004 Bacteria 1543
208 Ga0439449_0038223 3300042007 Bacteria 1785
209 Ga0466969_0000669 3300044656 Bacteria 18606
210 Ga0466969_0096205 3300044656 Bacteria 1398
211 Ga0466972_0009592 3300044658 Bacteria 4858
212 Ga0466972_0022176 3300044658 Bacteria 3162
213 Ga0466965_0000233 3300044683 Bacteria 17837
214 Ga0466965_0000499 3300044683 Bacteria 13978
215 Ga0466965_0004855 3300044683 Bacteria 6001
216 Ga0466965_0015526 3300044683 Bacteria 3618
217 Ga0466965_0137665 3300044683 Bacteria 1269
218 Ga0466966_0033565 3300044684 Bacteria 3323
219 Ga0466966_0034402 3300044684 Bacteria 3276
220 Ga0466961_0015068 3300044693 Bacteria 4963
221 Ga0466961_0017239 3300044693 Bacteria 4639
222 Ga0466961_0089242 3300044693 Bacteria 1947
223 Ga0466963_0033329 3300044694 Bacteria 3343
224 Ga0466963_0092636 3300044694 Bacteria 2059
225 Ga0466963_0098219 3300044694 Bacteria 2001
226 Ga0466963_0114480 3300044694 Bacteria 1853
227 Ga0466963_0131830 3300044694 Bacteria 1727
228 Ga0466963_0194220 3300044694 Bacteria 1418
229 Ga0466971_0000099 3300044719 Bacteria 31807
230 Ga0466968_0004749 3300044735 Bacteria 5089
231 Ga0466968_0038608 3300044735 Bacteria 2007
232 Ga0466970_0004577 3300044765 Bacteria 6825
233 Ga0466970_0005927 3300044765 Bacteria 6091
234 Ga0466970_0020585 3300044765 Bacteria 3429
235 Ga0466970_0121586 3300044765 Bacteria 1430
236 Ga0466957_0036761 3300044842 Bacteria 2946
237 Ga0466957_0041847 3300044842 Bacteria 2770
238 Ga0466957_0063409 3300044842 Bacteria 2271
239 Ga0466957_0196256 3300044842 Bacteria 1324
240 Ga0466960_0010557 3300044901 Bacteria 3839
241 Ga0466960_0019826 3300044901 Bacteria 2969
242 Ga0466960_0039069 3300044901 Bacteria 2236
243 Ga0466960_0053131 3300044901 Bacteria 1962
244 Ga0466960_0055443 3300044901 Bacteria 1927
245 Ga0466960_0123616 3300044901 Bacteria 1358
246 Ga0466959_0003341 3300045049 Bacteria 10482
247 Ga0466959_0075101 3300045049 Bacteria 2443
248 Ga0466959_0118013 3300045049 Bacteria 1888
249 Ga0466958_0041609 3300045836 Bacteria 2764
250 Ga0466958_0057063 3300045836 Bacteria 2373
251 Ga0466958_0076912 3300045836 Bacteria 2049
252 Ga0466967_0001086 3300045976 Bacteria 15050
253 Ga0466967_0006791 3300045976 Bacteria 8156
254 Ga0466967_0038172 3300045976 Bacteria 4117
255 Ga0466967_0076156 3300045976 Bacteria 3017
256 Ga0466967_0099921 3300045976 Bacteria 2650
257 Ga0466967_0108890 3300045976 Bacteria 2543
258 Ga0466967_0150100 3300045976 Bacteria 2177
259 Ga0495627_034962 3300046453 Bacteria 1568
260 Ga0495585_0189257 3300046492 Bacteria 1054
261 Ga0495668_0009885 3300046616 Bacteria 5818
262 Ga0495683_0002356 3300047323 Bacteria 11468
263 Ga0496100_0027505 3300048903 Bacteria 3498
264 Ga0496101_0018653 3300048904 Bacteria 4721
265 Ga0496101_0128964 3300048904 Bacteria 1919
266 Ga0496102_0000282 3300048905 Bacteria 64788
267 Ga0496102_0000287 3300048905 Bacteria 64356
268 Ga0496102_0161136 3300048905 Bacteria 2110
269 Ga0496102_0195057 3300048905 Bacteria 1908
270 Ga0496102_0229326 3300048905 Bacteria 1751
271 Ga0496103_0000192 3300048906 Bacteria 60768
272 Ga0496103_0000502 3300048906 Bacteria 32312
273 Ga0496104_0065738 3300048907 Bacteria 3442
274 Ga0496104_0360027 3300048907 Bacteria 1367
275 Ga0496105_0022396 3300048908 Bacteria 5117
276 Ga0496106_0007015 3300048909 Bacteria 8323
277 Ga0496106_0163522 3300048909 Bacteria 1761
278 Ga0496107_0168549 3300048910 Bacteria 1624
279 Ga0496107_0197758 3300048910 Bacteria 1494
280 Ga0496107_0277163 3300048910 Bacteria 1248
281 Ga0496108_0280124 3300048911 Bacteria 1452
282 Ga0496108_0301992 3300048911 Bacteria 1394
283 Ga0496109_0005602 3300048912 Bacteria 10510
284 Ga0496109_0131348 3300048912 Bacteria 2337
285 Ga0496109_0300640 3300048912 Bacteria 1513
286 Ga0496109_0435556 3300048912 Bacteria 1238
287 Ga0496110_0003627 3300048913 Bacteria 11876
288 Ga0496110_0087050 3300048913 Bacteria 2790
289 Ga0496110_0273601 3300048913 Bacteria 1538
290 Ga0496111_0006814 3300048914 Bacteria 7451
291 Ga0496111_0134170 3300048914 Bacteria 1833
292 Ga0496112_0088581 3300048915 Bacteria 3063
293 Ga0496113_0079096 3300048916 Bacteria 2516
294 Ga0496114_0060954 3300048917 Bacteria 3154
295 Ga0496114_0206423 3300048917 Bacteria 1722
296 Ga0496115_0078734 3300048918 Bacteria 2682
297 Ga0496115_0157555 3300048918 Bacteria 1876
298 Ga0496116_0000490 3300048919 Bacteria 54489
299 Ga0496117_0001571 3300048920 Bacteria 32416
300 Ga0496118_0000502 3300048921 Bacteria 64792
301 Ga0496118_0045741 3300048921 Bacteria 3412
302 Ga0496119_0001014 3300048922 Bacteria 35952
303 Ga0496119_0087314 3300048922 Bacteria 1780
304 Ga0496120_0007637 3300048923 Bacteria 8012
305 Ga0496120_0053621 3300048923 Bacteria 2290
306 Ga0496121_0004243 3300048924 Bacteria 19489
307 Ga0496121_0022246 3300048924 Bacteria 6166
308 Ga0496124_0021004 3300048927 Bacteria 6022
309 Ga0496124_0129066 3300048927 Bacteria 2011
310 Ga0496126_0001733 3300048929 Bacteria 32358
311 Ga0501031_0000063 3300049568 Bacteria 57266
312 Ga0501031_0007822 3300049568 Bacteria 6959
313 Ga0501032_0000427 3300049569 Bacteria 34916
314 Ga0501033_0000817 3300049570 Bacteria 28434
315 Ga0501034_0009177 3300049571 Bacteria 10377
316 Ga0501036_0000408 3300049572 Bacteria 30363
317 Ga0501036_0003852 3300049572 Bacteria 12037
318 Ga0501037_0000703 3300049573 Bacteria 25448
319 Ga0501038_0000146 3300049574 Bacteria 60336
320 Ga0501038_0022636 3300049574 Bacteria 5627
321 Ga0501038_0074521 3300049574 Bacteria 2871
322 Ga0501039_0000075 3300049575 Bacteria 74491
323 Ga0501039_0003865 3300049575 Bacteria 11247
324 Ga0501039_0006498 3300049575 Bacteria 8890
325 Ga0501039_0119753 3300049575 Bacteria 2062
326 Ga0501039_0220576 3300049575 Bacteria 1491
327 Ga0501040_0008963 3300049576 Bacteria 6507
328 Ga0501040_0045792 3300049576 Bacteria 2985
329 Ga0501041_0000703 3300049577 Bacteria 17796
330 Ga0501041_0021412 3300049577 Bacteria 3874
331 Ga0501041_0102040 3300049577 Bacteria 1777
332 Ga0501042_0005120 3300049578 Bacteria 8413
333 Ga0501043_0000882 3300049579 Bacteria 26619
334 Ga0501043_0048166 3300049579 Bacteria 3351
335 Ga0501046_0000324 3300049580 Bacteria 47936
336 Ga0501046_0002135 3300049580 Bacteria 18685
337 Ga0501046_0041874 3300049580 Bacteria 3653
338 Ga0501046_0066054 3300049580 Bacteria 2821
339 Ga0501047_0034877 3300049581 Bacteria 4857
340 Ga0501048_0003331 3300049582 Bacteria 12228
341 Ga0501048_0003472 3300049582 Bacteria 11983
342 Ga0501048_0240800 3300049582 Bacteria 1284
343 Ga0501067_0001393 3300049583 Bacteria 13109
344 Ga0501067_0005747 3300049583 Bacteria 6883
345 Ga0501067_0018513 3300049583 Bacteria 3858
346 Ga0501067_0196447 3300049583 Bacteria 1124
347 Ga0501068_0039851 3300049584 Bacteria 2818
348 Ga0501068_0085213 3300049584 Bacteria 1945
349 Ga0501069_0000137 3300049585 Bacteria 32103
350 Ga0501069_0020465 3300049585 Bacteria 3585
351 Ga0501069_0269644 3300049585 Bacteria 995
352 Ga0501070_0001107 3300049586 Bacteria 24195
353 Ga0501070_0030880 3300049586 Bacteria 4488
354 Ga0501070_0051689 3300049586 Bacteria 3411
355 Ga0501070_0206237 3300049586 Bacteria 1614
356 Ga0501070_0331205 3300049586 Bacteria 1237
357 Ga0501071_0011397 3300049587 Bacteria 5989
358 Ga0501072_0019728 3300049588 Bacteria 5215
359 Ga0501073_0034392 3300049589 Bacteria 3607
360 Ga0501074_0001667 3300049590 Bacteria 15112
361 Ga0501074_0021611 3300049590 Bacteria 4672
362 Ga0501075_0008542 3300049591 Bacteria 7138
363 Ga0501075_0008760 3300049591 Bacteria 7052
364 Ga0501075_0185502 3300049591 Bacteria 1587
365 Ga0501075_0200335 3300049591 Bacteria 1523
366 Ga0501076_0003989 3300049592 Bacteria 10426
367 Ga0501076_0004208 3300049592 Bacteria 10190
368 Ga0501076_0266401 3300049592 Bacteria 1403
369 Ga0501079_0061037 3300049741 Bacteria 2908
370 Ga0501079_0102363 3300049741 Bacteria 2221
371 Ga0501079_0151778 3300049741 Bacteria 1806
372 Ga0501080_0000531 3300049742 Bacteria 29982
373 Ga0501080_0187116 3300049742 Bacteria 1904
374 Ga0501083_0001876 3300049744 Bacteria 14438
375 Ga0501035_0000822 3300049822 Bacteria 33112
376 Ga0501035_0007420 3300049822 Bacteria 10239
377 Ga0501044_0001346 3300049823 Bacteria 28901
378 Ga0501044_0400992 3300049823 Bacteria 1284
379 Ga0501045_0023854 3300049824 Bacteria 4391
380 Ga0501045_0057814 3300049824 Bacteria 2838
381 Ga0501045_0067712 3300049824 Bacteria 2623
382 Ga0501045_0217051 3300049824 Bacteria 1424
383 Ga0501045_0264715 3300049824 Bacteria 1280
384 nmdc:mga03n38_1302_c1 3300050490 Bacteria 7042
385 nmdc:mga03n38_5349_c1 3300050490 Bacteria 4361
386 nmdc:mga00v17_190214_c1 3300050491 Bacteria 1325
387 nmdc:mga0yw44_115999_c1 3300050492 Bacteria 1721
388 nmdc:mga0yw44_62051_c1 3300050492 Bacteria 2294
389 nmdc:mga06z11_10804_c1 3300050494 Bacteria 3907
390 nmdc:mga04h51_2416_c1 3300050495 Bacteria 4429
391 Ga0495601_0032655 3300053077 Bacteria 3241
392 Ga0495601_0049518 3300053077 Bacteria 2649
393 Ga0495612_0000472 3300053078 Bacteria 16204
394 Ga0495619_0105319 3300053085 Bacteria 1923
395 Ga0500644_0000679 3300053088 Bacteria 12345
396 Ga0500556_0000981 3300053104 Bacteria 15108
397 Ga0500593_000172 3300053117 Bacteria 26252
398 Ga0500658_0000188 3300053134 Bacteria 29351
399 Ga0500573_0018007 3300053140 Bacteria 4025
400 Ga0501084_0002094 3300054114 Bacteria 15945
401 Ga0501084_0004341 3300054114 Bacteria 11553
402 Ga0501082_0029304 3300060353 Bacteria 4741
403 Ga0501082_0100205 3300060353 Bacteria 2505
404 Ga0501082_0238396 3300060353 Bacteria 1583
405 Ga0466962_0046297 3300061719 Bacteria 2078
406 Ga0530510_0005416 3300061734 Bacteria 8834
407 Ga0530510_0031738 3300061734 Bacteria 3798
408 Ga0530510_0041620 3300061734 Bacteria 3318
409 Ga0530510_0073321 3300061734 Bacteria 2485

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026116 Ga0207674_10133062 Ga0207674_101330621 263
2 3300044694 Ga0466963_0092636 Ga0466963_0092636_29_991 298
3 3300049591 Ga0501075_0185502 Ga0501075_0185502_255_1205 298
4 3300005471 Ga0070698_100060610 Ga0070698_1000606103 302
5 3300041496 Ga0451839_1058945 Ga0451839_1058945_447_1436 303
6 3300045976 Ga0466967_0038172 Ga0466967_0038172_2006_3058 303
7 3300005355 Ga0070671_100000123 Ga0070671_10000012340 304
8 3300005548 Ga0070665_100274608 Ga0070665_1002746082 304
9 3300028379 Ga0268266_10208715 Ga0268266_102087152 304
10 3300048913 Ga0496110_0003627 Ga0496110_0003627_2454_3464 304
11 3300048918 Ga0496115_0078734 Ga0496115_0078734_685_1695 304
12 3300049585 Ga0501069_0269644 Ga0501069_0269644_12_980 304
13 3300046492 Ga0495585_0189257 Ga0495585_0189257_33_1004 305
14 3300037471 Ga0395905_0010044 Ga0395905_0010044_31_1005 306
15 3300048905 Ga0496102_0195057 Ga0496102_0195057_882_1856 306
16 3300053077 Ga0495601_0049518 Ga0495601_0049518_864_1838 306
17 iso_pu_bacteria 2775506925 2776370690 306
18 3300037853 Ga0436364_0980570 Ga0436364_0980570_202_1182 308
19 3300048917 Ga0496114_0206423 Ga0496114_0206423_272_1261 309
20 3300047323 Ga0495683_0002356 Ga0495683_0002356_3170_4279 311
21 3300005329 Ga0070683_100020733 Ga0070683_1000207336 313
22 3300005336 Ga0070680_100007781 Ga0070680_1000077814 313
23 3300005577 Ga0068857_100065448 Ga0068857_1000654483 313
24 3300005578 Ga0068854_100042056 Ga0068854_1000420563 313
25 3300009551 Ga0105238_10021151 Ga0105238_100211515 313
26 3300025909 Ga0207705_10013300 Ga0207705_100133004 313
27 3300037312 Ga0395899_0032993 Ga0395899_0032993_2116_3120 313
28 3300037466 Ga0395898_0211395 Ga0395898_0211395_718_1722 313
29 3300037471 Ga0395905_0455454 Ga0395905_0455454_107_1111 313
30 3300038443 Ga0395901_0033900 Ga0395901_0033900_313_1317 313
31 3300014325 Ga0163163_10164553 Ga0163163_101645532 314
32 3300041452 Ga0451793_0330630 Ga0451793_0330630_70_1098 314
33 3300037418 Ga0395900_0142831 Ga0395900_0142831_775_1830 316
34 iso_pu_bacteria 2751185734 2753076176 316
35 iso_pu_bacteria 2870721527 2870726158 316
36 iso_pu_bacteria 2891326441 2891327160 316
37 3300030731 Ga0316177_1197294 Ga0316177_11972942 317
38 3300030732 Ga0316176_1218664 Ga0316176_12186643 317
39 3300030736 Ga0316180_1091681 Ga0316180_10916812 317
40 3300005437 Ga0070710_10000813 Ga0070710_1000081313 318
41 3300006038 Ga0075365_10040412 Ga0075365_100404123 318
42 3300025898 Ga0207692_10034552 Ga0207692_100345522 318
43 3300042004 Ga0439445_0024137 Ga0439445_0024137_126_1160 318
44 3300044683 Ga0466965_0004855 Ga0466965_0004855_3912_4931 318
45 iso_pu_bacteria 2842888712 2842889538 318
46 iso_pu_bacteria 8047710418 8047719499 318
47 3300032004 Ga0307414_10402933 Ga0307414_104029331 319
48 3300042007 Ga0439449_0038223 Ga0439449_0038223_498_1514 319
49 3300044683 Ga0466965_0000499 Ga0466965_0000499_858_1886 319
50 3300044735 Ga0466968_0038608 Ga0466968_0038608_149_1177 319
51 3300044901 Ga0466960_0055443 Ga0466960_0055443_563_1591 319
52 3300045976 Ga0466967_0001086 Ga0466967_0001086_9743_10762 319
53 iso_pu_bacteria 2558860112 2558914163 319
54 iso_pu_bacteria 2751185725 2753038768 319
55 iso_pu_bacteria 2751185792 2753327280 319
56 iso_pu_bacteria 2870782633 2870785426 319
57 iso_pu_bacteria 2904770941 2904776325 319
58 iso_pu_bacteria 2908811453 2908814411 319
59 3300005617 Ga0068859_100016266 Ga0068859_1000162662 320
60 3300006048 Ga0075363_100054407 Ga0075363_1000544072 320
61 3300006353 Ga0075370_10162993 Ga0075370_101629931 320
62 3300006871 Ga0075434_100202169 Ga0075434_1002021692 320
63 3300006931 Ga0097620_100016266 Ga0097620_1000162666 320
64 3300009101 Ga0105247_10024033 Ga0105247_100240333 320
65 3300025900 Ga0207710_10006216 Ga0207710_100062165 320
66 3300031251 Ga0265327_10000041 Ga0265327_10000041264 320
67 3300048904 Ga0496101_0018653 Ga0496101_0018653_1019_2041 320
68 3300048905 Ga0496102_0000287 Ga0496102_0000287_51318_52340 320
69 3300048906 Ga0496103_0000192 Ga0496103_0000192_12258_13280 320
70 3300048921 Ga0496118_0045741 Ga0496118_0045741_1241_2263 320
71 3300048922 Ga0496119_0087314 Ga0496119_0087314_13_1035 320
72 3300048923 Ga0496120_0053621 Ga0496120_0053621_976_1998 320
73 3300048924 Ga0496121_0022246 Ga0496121_0022246_3642_4664 320
74 3300049586 Ga0501070_0051689 Ga0501070_0051689_1574_2584 320
75 iso_pu_bacteria 2643221641 2644232311 320
76 iso_pu_bacteria 2857481737 2857485720 320
77 iso_pu_bacteria 2863067949 2863072241 320
78 iso_pu_bacteria 2899359706 2899368031 320
79 3300005455 Ga0070663_100042115 Ga0070663_1000421152 321
80 3300005535 Ga0070684_100077629 Ga0070684_1000776292 321
81 3300005548 Ga0070665_100001499 Ga0070665_1000014999 321
82 3300005617 Ga0068859_100120968 Ga0068859_1001209682 321
83 3300005841 Ga0068863_100004293 Ga0068863_10000429314 321
84 3300005841 Ga0068863_100286788 Ga0068863_1002867881 321
85 3300006931 Ga0097620_100120965 Ga0097620_1001209652 321
86 3300013296 Ga0157374_10147219 Ga0157374_101472192 321
87 3300014969 Ga0157376_10147542 Ga0157376_101475422 321
88 3300025907 Ga0207645_10024353 Ga0207645_100243533 321
89 3300025931 Ga0207644_10001264 Ga0207644_100012647 321
90 3300025942 Ga0207689_10096922 Ga0207689_100969223 321
91 3300025944 Ga0207661_10153855 Ga0207661_101538552 321
92 3300026067 Ga0207678_10048427 Ga0207678_100484272 321
93 3300026088 Ga0207641_10003429 Ga0207641_100034294 321
94 3300028379 Ga0268266_10036031 Ga0268266_100360314 321
95 3300031456 Ga0307513_10009318 Ga0307513_1000931811 321
96 3300031838 Ga0307518_10011209 Ga0307518_100112093 321
97 3300033179 Ga0307507_10009773 Ga0307507_1000977312 321
98 3300044658 Ga0466972_0009592 Ga0466972_0009592_1728_2753 321
99 3300044683 Ga0466965_0000233 Ga0466965_0000233_5412_6437 321
100 3300044694 Ga0466963_0131830 Ga0466963_0131830_391_1416 321
101 3300044765 Ga0466970_0004577 Ga0466970_0004577_4122_5147 321
102 3300044842 Ga0466957_0196256 Ga0466957_0196256_254_1279 321
103 3300044901 Ga0466960_0010557 Ga0466960_0010557_218_1243 321
104 3300045836 Ga0466958_0057063 Ga0466958_0057063_876_1901 321
105 3300045976 Ga0466967_0108890 Ga0466967_0108890_1256_2281 321
106 3300048903 Ga0496100_0027505 Ga0496100_0027505_361_1380 321
107 3300048905 Ga0496102_0000282 Ga0496102_0000282_52842_53861 321
108 3300048906 Ga0496103_0000502 Ga0496103_0000502_20381_21400 321
109 3300048907 Ga0496104_0065738 Ga0496104_0065738_632_1651 321
110 3300048908 Ga0496105_0022396 Ga0496105_0022396_1866_2885 321
111 3300048911 Ga0496108_0280124 Ga0496108_0280124_261_1286 321
112 3300048913 Ga0496110_0087050 Ga0496110_0087050_23_1042 321
113 3300048914 Ga0496111_0134170 Ga0496111_0134170_163_1182 321
114 3300048919 Ga0496116_0000490 Ga0496116_0000490_10973_11992 321
115 3300048920 Ga0496117_0001571 Ga0496117_0001571_10927_11946 321
116 3300048921 Ga0496118_0000502 Ga0496118_0000502_10928_11947 321
117 3300048922 Ga0496119_0001014 Ga0496119_0001014_10866_11885 321
118 3300048923 Ga0496120_0007637 Ga0496120_0007637_3314_4333 321
119 3300048924 Ga0496121_0004243 Ga0496121_0004243_9575_10594 321
120 3300048927 Ga0496124_0021004 Ga0496124_0021004_3314_4333 321
121 3300048929 Ga0496126_0001733 Ga0496126_0001733_10928_11947 321
122 iso_pu_bacteria 2515154155 2515851910 321
123 iso_pu_bacteria 2675903058 2676476041 321
124 iso_pu_bacteria 2738543005 2739203823 321
125 iso_pu_bacteria 2827628540 2827630603 321
126 iso_pu_bacteria 2855386786 2855391142 321
127 iso_pu_bacteria 2928142448 2928147273 321
128 iso_pu_bacteria 2974315732 2974317799 321
129 iso_pu_bacteria 2984523437 2984526009 321
130 3300005329 Ga0070683_100018309 Ga0070683_1000183094 322
131 3300005329 Ga0070683_100063766 Ga0070683_1000637662 322
132 3300005345 Ga0070692_10016467 Ga0070692_100164674 322
133 3300005354 Ga0070675_100154855 Ga0070675_1001548552 322
134 3300005356 Ga0070674_100026508 Ga0070674_1000265083 322
135 3300005435 Ga0070714_100003821 Ga0070714_1000038216 322
136 3300005438 Ga0070701_10111241 Ga0070701_101112412 322
137 3300005441 Ga0070700_100044964 Ga0070700_1000449643 322
138 3300005455 Ga0070663_100275982 Ga0070663_1002759822 322
139 3300005535 Ga0070684_100164060 Ga0070684_1001640603 322
140 3300005543 Ga0070672_100001030 Ga0070672_1000010304 322
141 3300005616 Ga0068852_100012616 Ga0068852_1000126165 322
142 3300005719 Ga0068861_100019491 Ga0068861_1000194912 322
143 3300005840 Ga0068870_10005350 Ga0068870_100053505 322
144 3300005985 Ga0081539_10018128 Ga0081539_100181285 322
145 3300009094 Ga0111539_10184081 Ga0111539_101840813 322
146 3300009098 Ga0105245_10396787 Ga0105245_103967872 322
147 3300009148 Ga0105243_10014044 Ga0105243_100140445 322
148 3300009177 Ga0105248_10069580 Ga0105248_100695802 322
149 3300009545 Ga0105237_10216642 Ga0105237_102166423 322
150 3300013102 Ga0157371_10280051 Ga0157371_102800511 322
151 3300013307 Ga0157372_10025547 Ga0157372_100255474 322
152 3300013307 Ga0157372_10080062 Ga0157372_100800624 322
153 3300013307 Ga0157372_10122030 Ga0157372_101220302 322
154 3300014325 Ga0163163_10116810 Ga0163163_101168103 322
155 3300014326 Ga0157380_10178793 Ga0157380_101787933 322
156 3300014497 Ga0182008_10064627 Ga0182008_100646272 322
157 3300014745 Ga0157377_10110342 Ga0157377_101103422 322
158 3300025901 Ga0207688_10014810 Ga0207688_100148103 322
159 3300025907 Ga0207645_10145398 Ga0207645_101453982 322
160 3300025908 Ga0207643_10002264 Ga0207643_100022646 322
161 3300025927 Ga0207687_10059878 Ga0207687_100598782 322
162 3300025929 Ga0207664_10072855 Ga0207664_100728552 322
163 3300025935 Ga0207709_10014110 Ga0207709_100141104 322
164 3300025937 Ga0207669_10035018 Ga0207669_100350182 322
165 3300025938 Ga0207704_10214376 Ga0207704_102143762 322
166 3300025940 Ga0207691_10001201 Ga0207691_100012017 322
167 3300025941 Ga0207711_10054391 Ga0207711_100543913 322
168 3300025944 Ga0207661_10087570 Ga0207661_100875703 322
169 3300026075 Ga0207708_10000513 Ga0207708_100005137 322
170 3300026075 Ga0207708_10072156 Ga0207708_100721562 322
171 3300026089 Ga0207648_10015694 Ga0207648_100156944 322
172 3300026095 Ga0207676_10290314 Ga0207676_102903142 322
173 3300026118 Ga0207675_100004561 Ga0207675_1000045617 322
174 3300027907 Ga0207428_10030952 Ga0207428_100309523 322
175 3300033179 Ga0307507_10002765 Ga0307507_1000276510 322
176 3300038443 Ga0395901_0079722 Ga0395901_0079722_758_1792 322
177 3300044656 Ga0466969_0000669 Ga0466969_0000669_8507_9550 322
178 3300044656 Ga0466969_0096205 Ga0466969_0096205_53_1168 322
179 3300044684 Ga0466966_0034402 Ga0466966_0034402_1832_2875 322
180 3300044693 Ga0466961_0015068 Ga0466961_0015068_3111_4187 322
181 3300044693 Ga0466961_0017239 Ga0466961_0017239_97_1140 322
182 3300044719 Ga0466971_0000099 Ga0466971_0000099_6099_7142 322
183 3300044765 Ga0466970_0020585 Ga0466970_0020585_2333_3367 322
184 3300044901 Ga0466960_0019826 Ga0466960_0019826_32_1066 322
185 3300044901 Ga0466960_0039069 Ga0466960_0039069_968_2002 322
186 3300044901 Ga0466960_0053131 Ga0466960_0053131_159_1196 322
187 3300045049 Ga0466959_0003341 Ga0466959_0003341_1419_2462 322
188 3300045836 Ga0466958_0076912 Ga0466958_0076912_157_1200 322
189 3300048904 Ga0496101_0128964 Ga0496101_0128964_798_1871 322
190 3300048909 Ga0496106_0007015 Ga0496106_0007015_861_1895 322
191 3300048910 Ga0496107_0168549 Ga0496107_0168549_536_1570 322
192 3300048912 Ga0496109_0131348 Ga0496109_0131348_275_1309 322
193 3300048912 Ga0496109_0300640 Ga0496109_0300640_34_1098 322
194 3300048914 Ga0496111_0006814 Ga0496111_0006814_1943_2977 322
195 3300048915 Ga0496112_0088581 Ga0496112_0088581_575_1615 322
196 3300048916 Ga0496113_0079096 Ga0496113_0079096_712_1746 322
197 3300048917 Ga0496114_0060954 Ga0496114_0060954_920_1993 322
198 3300048918 Ga0496115_0157555 Ga0496115_0157555_342_1373 322
199 3300049575 Ga0501039_0220576 Ga0501039_0220576_369_1409 322
200 3300049577 Ga0501041_0102040 Ga0501041_0102040_435_1478 322
201 3300049583 Ga0501067_0005747 Ga0501067_0005747_4719_5753 322
202 3300049583 Ga0501067_0018513 Ga0501067_0018513_138_1211 322
203 3300049585 Ga0501069_0020465 Ga0501069_0020465_2143_3177 322
204 3300049592 Ga0501076_0266401 Ga0501076_0266401_221_1261 322
205 3300049824 Ga0501045_0217051 Ga0501045_0217051_145_1185 322
206 3300053077 Ga0495601_0032655 Ga0495601_0032655_514_1542 322
207 3300053078 Ga0495612_0000472 Ga0495612_0000472_10358_11386 322
208 3300053085 Ga0495619_0105319 Ga0495619_0105319_658_1686 322
209 3300061734 Ga0530510_0073321 Ga0530510_0073321_203_1276 322
210 iso_pu_bacteria 2643221615 2644093985 322
211 iso_pu_bacteria 2643221657 2644323829 322
212 iso_pu_bacteria 2643221696 2644535271 322
213 iso_pu_bacteria 2739367898 2740169268 322
214 iso_pu_bacteria 2808606365 2808874550 322
215 iso_pu_bacteria 2883821847 2883823760 322
216 iso_pu_bacteria 2919713450 2919718909 322
217 iso_pu_bacteria 2984576629 2984580006 322
218 iso_pu_bacteria 2990256926 2990260787 322
219 3300001990 JGI24737J22298_10006918 JGI24737J22298_100069181 323
220 3300005329 Ga0070683_100004858 Ga0070683_1000048589 323
221 3300005329 Ga0070683_100198977 Ga0070683_1001989772 323
222 3300005329 Ga0070683_100286446 Ga0070683_1002864461 323
223 3300005345 Ga0070692_10012349 Ga0070692_100123493 323
224 3300005367 Ga0070667_100037890 Ga0070667_1000378901 323
225 3300005441 Ga0070700_100029988 Ga0070700_1000299882 323
226 3300005535 Ga0070684_100002926 Ga0070684_1000029262 323
227 3300005548 Ga0070665_100009827 Ga0070665_1000098274 323
228 3300005548 Ga0070665_100322523 Ga0070665_1003225232 323
229 3300005614 Ga0068856_100165210 Ga0068856_1001652102 323
230 3300005615 Ga0070702_100081238 Ga0070702_1000812382 323
231 3300005719 Ga0068861_100083006 Ga0068861_1000830062 323
232 3300005842 Ga0068858_100184599 Ga0068858_1001845991 323
233 3300005843 Ga0068860_100001541 Ga0068860_10000154113 323
234 3300005981 Ga0081538_10001227 Ga0081538_1000122723 323
235 3300006038 Ga0075365_10000618 Ga0075365_1000061810 323
236 3300006038 Ga0075365_10149307 Ga0075365_101493072 323
237 3300006048 Ga0075363_100003598 Ga0075363_1000035983 323
238 3300006048 Ga0075363_100065739 Ga0075363_1000657392 323
239 3300006178 Ga0075367_10010052 Ga0075367_100100524 323
240 3300006178 Ga0075367_10024916 Ga0075367_100249162 323
241 3300006353 Ga0075370_10029470 Ga0075370_100294702 323
242 3300006881 Ga0068865_100036074 Ga0068865_1000360742 323
243 3300006881 Ga0068865_100400622 Ga0068865_1004006221 323
244 3300009098 Ga0105245_10006602 Ga0105245_100066024 323
245 3300009098 Ga0105245_10266750 Ga0105245_102667502 323
246 3300009176 Ga0105242_10329124 Ga0105242_103291242 323
247 3300009553 Ga0105249_10063642 Ga0105249_100636423 323
248 3300010375 Ga0105239_10015679 Ga0105239_100156795 323
249 3300013105 Ga0157369_10169056 Ga0157369_101690562 323
250 3300013306 Ga0163162_10019899 Ga0163162_100198993 323
251 3300013307 Ga0157372_10044921 Ga0157372_100449213 323
252 3300013308 Ga0157375_10012926 Ga0157375_100129265 323
253 3300014325 Ga0163163_10056704 Ga0163163_100567043 323
254 3300014968 Ga0157379_10042400 Ga0157379_100424003 323
255 3300020082 Ga0206353_10512837 Ga0206353_105128372 323
256 3300025938 Ga0207704_10082965 Ga0207704_100829652 323
257 3300025961 Ga0207712_10197683 Ga0207712_101976832 323
258 3300025986 Ga0207658_10371428 Ga0207658_103714282 323
259 3300026095 Ga0207676_10042938 Ga0207676_100429383 323
260 3300026116 Ga0207674_10048489 Ga0207674_100484892 323
261 3300026116 Ga0207674_10119740 Ga0207674_101197403 323
262 3300026118 Ga0207675_100014826 Ga0207675_1000148263 323
263 3300027866 Ga0209813_10000804 Ga0209813_100008048 323
264 3300028381 Ga0268264_10001453 Ga0268264_1000145314 323
265 3300031824 Ga0307413_10013799 Ga0307413_100137994 323
266 3300031852 Ga0307410_10234638 Ga0307410_102346382 323
267 3300031995 Ga0307409_100015002 Ga0307409_1000150024 323
268 3300032002 Ga0307416_100037561 Ga0307416_1000375613 323
269 3300032005 Ga0307411_10076288 Ga0307411_100762882 323
270 3300032126 Ga0307415_100001865 Ga0307415_1000018654 323
271 3300037418 Ga0395900_0056892 Ga0395900_0056892_676_1719 323
272 3300037466 Ga0395898_0014692 Ga0395898_0014692_3288_4331 323
273 3300037471 Ga0395905_0480981 Ga0395905_0480981_33_1076 323
274 3300038443 Ga0395901_0039115 Ga0395901_0039115_3199_4242 323
275 3300038443 Ga0395901_0242868 Ga0395901_0242868_156_1184 323
276 3300041494 Ga0451837_0346962 Ga0451837_0346962_97_1128 323
277 3300041512 Ga0451853_0222545 Ga0451853_0222545_1789_2820 323
278 3300044658 Ga0466972_0022176 Ga0466972_0022176_407_1513 323
279 3300044683 Ga0466965_0137665 Ga0466965_0137665_101_1138 323
280 3300044684 Ga0466966_0033565 Ga0466966_0033565_54_1100 323
281 3300044693 Ga0466961_0089242 Ga0466961_0089242_549_1595 323
282 3300044694 Ga0466963_0194220 Ga0466963_0194220_55_1086 323
283 3300044735 Ga0466968_0004749 Ga0466968_0004749_2827_3873 323
284 3300044765 Ga0466970_0005927 Ga0466970_0005927_2756_3802 323
285 3300044765 Ga0466970_0121586 Ga0466970_0121586_210_1262 323
286 3300044842 Ga0466957_0036761 Ga0466957_0036761_412_1458 323
287 3300044842 Ga0466957_0041847 Ga0466957_0041847_503_1555 323
288 3300044842 Ga0466957_0063409 Ga0466957_0063409_1198_2244 323
289 3300045836 Ga0466958_0041609 Ga0466958_0041609_522_1574 323
290 3300045976 Ga0466967_0099921 Ga0466967_0099921_534_1580 323
291 3300046453 Ga0495627_034962 Ga0495627_034962_101_1168 323
292 3300048905 Ga0496102_0161136 Ga0496102_0161136_135_1178 323
293 3300048905 Ga0496102_0229326 Ga0496102_0229326_547_1590 323
294 3300048909 Ga0496106_0163522 Ga0496106_0163522_53_1096 323
295 3300048910 Ga0496107_0197758 Ga0496107_0197758_230_1273 323
296 3300048910 Ga0496107_0277163 Ga0496107_0277163_182_1225 323
297 3300048911 Ga0496108_0301992 Ga0496108_0301992_16_1059 323
298 3300048912 Ga0496109_0005602 Ga0496109_0005602_1564_2607 323
299 3300048927 Ga0496124_0129066 Ga0496124_0129066_490_1521 323
300 3300049568 Ga0501031_0000063 Ga0501031_0000063_186_1223 323
301 3300049569 Ga0501032_0000427 Ga0501032_0000427_23345_24382 323
302 3300049570 Ga0501033_0000817 Ga0501033_0000817_8826_9863 323
303 3300049571 Ga0501034_0009177 Ga0501034_0009177_8052_9089 323
304 3300049572 Ga0501036_0000408 Ga0501036_0000408_9641_10678 323
305 3300049573 Ga0501037_0000703 Ga0501037_0000703_1304_2341 323
306 3300049574 Ga0501038_0000146 Ga0501038_0000146_46834_47871 323
307 3300049574 Ga0501038_0074521 Ga0501038_0074521_1672_2703 323
308 3300049575 Ga0501039_0000075 Ga0501039_0000075_8622_9659 323
309 3300049575 Ga0501039_0003865 Ga0501039_0003865_6860_7891 323
310 3300049575 Ga0501039_0119753 Ga0501039_0119753_972_2006 323
311 3300049577 Ga0501041_0021412 Ga0501041_0021412_153_1184 323
312 3300049579 Ga0501043_0000882 Ga0501043_0000882_12271_13308 323
313 3300049580 Ga0501046_0000324 Ga0501046_0000324_11832_12869 323
314 3300049580 Ga0501046_0041874 Ga0501046_0041874_1034_2098 323
315 3300049580 Ga0501046_0066054 Ga0501046_0066054_173_1204 323
316 3300049581 Ga0501047_0034877 Ga0501047_0034877_1251_2288 323
317 3300049582 Ga0501048_0003472 Ga0501048_0003472_1598_2635 323
318 3300049583 Ga0501067_0001393 Ga0501067_0001393_2452_3489 323
319 3300049583 Ga0501067_0196447 Ga0501067_0196447_15_1061 323
320 3300049584 Ga0501068_0085213 Ga0501068_0085213_77_1108 323
321 3300049585 Ga0501069_0000137 Ga0501069_0000137_9104_10141 323
322 3300049586 Ga0501070_0001107 Ga0501070_0001107_21598_22635 323
323 3300049586 Ga0501070_0030880 Ga0501070_0030880_126_1163 323
324 3300049586 Ga0501070_0206237 Ga0501070_0206237_49_1086 323
325 3300049587 Ga0501071_0011397 Ga0501071_0011397_4921_5952 323
326 3300049588 Ga0501072_0019728 Ga0501072_0019728_1373_2410 323
327 3300049589 Ga0501073_0034392 Ga0501073_0034392_1514_2551 323
328 3300049590 Ga0501074_0001667 Ga0501074_0001667_4331_5368 323
329 3300049591 Ga0501075_0008760 Ga0501075_0008760_2930_3961 323
330 3300049592 Ga0501076_0004208 Ga0501076_0004208_7232_8263 323
331 3300049741 Ga0501079_0102363 Ga0501079_0102363_681_1724 323
332 3300049741 Ga0501079_0151778 Ga0501079_0151778_546_1577 323
333 3300049742 Ga0501080_0000531 Ga0501080_0000531_8807_9844 323
334 3300049742 Ga0501080_0187116 Ga0501080_0187116_312_1346 323
335 3300049744 Ga0501083_0001876 Ga0501083_0001876_9425_10462 323
336 3300049822 Ga0501035_0000822 Ga0501035_0000822_3125_4162 323
337 3300049822 Ga0501035_0007420 Ga0501035_0007420_5783_6814 323
338 3300049823 Ga0501044_0001346 Ga0501044_0001346_26476_27513 323
339 3300049823 Ga0501044_0400992 Ga0501044_0400992_37_1074 323
340 3300049824 Ga0501045_0057814 Ga0501045_0057814_483_1514 323
341 3300049824 Ga0501045_0067712 Ga0501045_0067712_626_1660 323
342 3300050490 nmdc:mga03n38_1302_c1 nmdc:mga03n38_1302_c1_5280_6317 323
343 3300050490 nmdc:mga03n38_5349_c1 nmdc:mga03n38_5349_c1_2419_3459 323
344 3300050491 nmdc:mga00v17_190214_c1 nmdc:mga00v17_190214_c1_256_1284 323
345 3300050492 nmdc:mga0yw44_115999_c1 nmdc:mga0yw44_115999_c1_426_1472 323
346 3300050492 nmdc:mga0yw44_62051_c1 nmdc:mga0yw44_62051_c1_641_1681 323
347 3300050494 nmdc:mga06z11_10804_c1 nmdc:mga06z11_10804_c1_2010_3047 323
348 3300050495 nmdc:mga04h51_2416_c1 nmdc:mga04h51_2416_c1_1050_2087 323
349 3300053088 Ga0500644_0000679 Ga0500644_0000679_1900_2940 323
350 3300053117 Ga0500593_000172 Ga0500593_000172_10849_11892 323
351 3300053140 Ga0500573_0018007 Ga0500573_0018007_2548_3594 323
352 3300054114 Ga0501084_0004341 Ga0501084_0004341_1289_2326 323
353 3300060353 Ga0501082_0029304 Ga0501082_0029304_21_1052 323
354 3300060353 Ga0501082_0238396 Ga0501082_0238396_319_1356 323
355 3300061719 Ga0466962_0046297 Ga0466962_0046297_914_1960 323
356 3300061734 Ga0530510_0031738 Ga0530510_0031738_2691_3722 323
357 iso_pu_bacteria 2547132424 2548694801 323
358 iso_pu_bacteria 2643221561 2643823590 323
359 iso_pu_bacteria 2773857762 2774392832 323
360 iso_pu_bacteria 2816332119 2816427689 323
361 3300005327 Ga0070658_10041312 Ga0070658_100413122 324
362 3300005341 Ga0070691_10024734 Ga0070691_100247341 324
363 3300005366 Ga0070659_100026103 Ga0070659_1000261033 324
364 3300005366 Ga0070659_100106706 Ga0070659_1001067062 324
365 3300005471 Ga0070698_100001494 Ga0070698_10000149423 324
366 3300005577 Ga0068857_100015467 Ga0068857_1000154673 324
367 3300006038 Ga0075365_10179165 Ga0075365_101791652 324
368 3300010375 Ga0105239_10138718 Ga0105239_101387181 324
369 3300021388 Ga0213875_10022850 Ga0213875_100228503 324
370 3300025904 Ga0207647_10161446 Ga0207647_101614462 324
371 3300025919 Ga0207657_10007406 Ga0207657_1000740610 324
372 3300025921 Ga0207652_10102131 Ga0207652_101021313 324
373 3300025932 Ga0207690_10133013 Ga0207690_101330132 324
374 3300025944 Ga0207661_10292324 Ga0207661_102923242 324
375 3300026067 Ga0207678_10054792 Ga0207678_100547922 324
376 3300026116 Ga0207674_10102848 Ga0207674_101028483 324
377 3300037466 Ga0395898_0053418 Ga0395898_0053418_271_1341 324
378 3300037853 Ga0436364_0606713 Ga0436364_0606713_2907_3959 324
379 3300038443 Ga0395901_0015285 Ga0395901_0015285_6168_7343 324
380 3300038443 Ga0395901_0091852 Ga0395901_0091852_242_1294 324
381 3300044683 Ga0466965_0015526 Ga0466965_0015526_1432_2472 324
382 3300044694 Ga0466963_0098219 Ga0466963_0098219_803_1849 324
383 3300044901 Ga0466960_0123616 Ga0466960_0123616_60_1112 324
384 3300045049 Ga0466959_0118013 Ga0466959_0118013_728_1774 324
385 3300045976 Ga0466967_0150100 Ga0466967_0150100_40_1092 324
386 3300048907 Ga0496104_0360027 Ga0496104_0360027_153_1193 324
387 3300048912 Ga0496109_0435556 Ga0496109_0435556_121_1161 324
388 3300048913 Ga0496110_0273601 Ga0496110_0273601_171_1208 324
389 3300049568 Ga0501031_0007822 Ga0501031_0007822_2299_3351 324
390 3300049572 Ga0501036_0003852 Ga0501036_0003852_1621_2673 324
391 3300049574 Ga0501038_0022636 Ga0501038_0022636_29_1081 324
392 3300049575 Ga0501039_0006498 Ga0501039_0006498_7771_8823 324
393 3300049576 Ga0501040_0008963 Ga0501040_0008963_2972_4024 324
394 3300049576 Ga0501040_0045792 Ga0501040_0045792_1214_2278 324
395 3300049577 Ga0501041_0000703 Ga0501041_0000703_2599_3651 324
396 3300049578 Ga0501042_0005120 Ga0501042_0005120_4837_5889 324
397 3300049579 Ga0501043_0048166 Ga0501043_0048166_793_1845 324
398 3300049580 Ga0501046_0002135 Ga0501046_0002135_2599_3651 324
399 3300049582 Ga0501048_0003331 Ga0501048_0003331_8784_9836 324
400 3300049582 Ga0501048_0240800 Ga0501048_0240800_193_1260 324
401 3300049584 Ga0501068_0039851 Ga0501068_0039851_304_1356 324
402 3300049586 Ga0501070_0331205 Ga0501070_0331205_180_1220 324
403 3300049590 Ga0501074_0021611 Ga0501074_0021611_825_1877 324
404 3300049591 Ga0501075_0008542 Ga0501075_0008542_1083_2135 324
405 3300049591 Ga0501075_0200335 Ga0501075_0200335_109_1155 324
406 3300049592 Ga0501076_0003989 Ga0501076_0003989_4232_5284 324
407 3300049741 Ga0501079_0061037 Ga0501079_0061037_1293_2345 324
408 3300049824 Ga0501045_0023854 Ga0501045_0023854_2436_3485 324
409 3300049824 Ga0501045_0264715 Ga0501045_0264715_42_1106 324
410 3300054114 Ga0501084_0002094 Ga0501084_0002094_4192_5244 324
411 3300060353 Ga0501082_0100205 Ga0501082_0100205_1220_2272 324
412 3300061734 Ga0530510_0005416 Ga0530510_0005416_1766_2818 324
413 3300061734 Ga0530510_0041620 Ga0530510_0041620_1152_2207 324
414 3300030744 Ga0316181_1291543 Ga0316181_12915432 328
415 3300030745 Ga0316182_1108171 Ga0316182_11081717 328
416 3300041491 Ga0451833_1052414 Ga0451833_1052414_5401_6447 328
417 3300045976 Ga0466967_0006791 Ga0466967_0006791_6881_7954 328
418 3300053104 Ga0500556_0000981 Ga0500556_0000981_9031_10077 328
419 3300039062 Ga0400483_062358 Ga0400483_062358_1149_2195 333
420 3300039062 Ga0400483_276618 Ga0400483_276618_22391_23437 333
421 3300001990 JGI24737J22298_10000855 JGI24737J22298_100008558 334
422 3300005337 Ga0070682_100096859 Ga0070682_1000968592 334
423 3300005355 Ga0070671_100230510 Ga0070671_1002305101 334
424 3300005366 Ga0070659_100330598 Ga0070659_1003305981 334
425 3300005563 Ga0068855_100698752 Ga0068855_1006987521 334
426 3300009093 Ga0105240_10086954 Ga0105240_100869544 334
427 3300009545 Ga0105237_10232455 Ga0105237_102324551 334
428 3300013100 Ga0157373_10013580 Ga0157373_100135802 334
429 3300013104 Ga0157370_10105906 Ga0157370_101059063 334
430 3300021384 Ga0213876_10018813 Ga0213876_100188132 334
431 3300025904 Ga0207647_10010951 Ga0207647_100109512 334
432 3300025913 Ga0207695_10012451 Ga0207695_100124516 334
433 3300025914 Ga0207671_10114299 Ga0207671_101142992 334
434 3300025917 Ga0207660_10006893 Ga0207660_100068934 334
435 3300025920 Ga0207649_10021518 Ga0207649_100215184 334
436 3300025981 Ga0207640_10049634 Ga0207640_100496342 334
437 3300026078 Ga0207702_10017335 Ga0207702_100173351 334
438 3300026116 Ga0207674_10017010 Ga0207674_100170104 334
439 3300026142 Ga0207698_10029954 Ga0207698_100299544 334
440 3300039437 Ga0436365_1648284 Ga0436365_1648284_3483_4487 334
441 3300044694 Ga0466963_0033329 Ga0466963_0033329_28_1032 334
442 3300044694 Ga0466963_0114480 Ga0466963_0114480_495_1502 334
443 3300045049 Ga0466959_0075101 Ga0466959_0075101_719_1723 334
444 3300045976 Ga0466967_0076156 Ga0466967_0076156_1028_2032 334
445 3300046616 Ga0495668_0009885 Ga0495668_0009885_522_1526 334
446 3300053134 Ga0500658_0000188 Ga0500658_0000188_9042_10046 334

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22698

Semialdhyde_dhC_1

Semialdehyde dehydrogenase, dimerisation domain

194

359

1

PF02774

Semialdhyde_dhC

Semialdehyde dehydrogenase, dimerisation domain

203

362

0.98

PF01118

Semialdhyde_dh

Semialdehyde dehydrogenase, NAD binding domain

52

184

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xyg-assembly1.cif.gz_D x-ray structure of gene product from arabidopsis thaliana at2g19940 0.9461 2 330
1xyg-assembly1.cif.gz_D x-ray structure of gene product from arabidopsis thaliana at2g19940 0.9405 2 330
1vkn-assembly1.cif.gz_B crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (tm1782) from thermotoga maritima at 1.80 a resolution 0.9351 1 330
8afu-assembly2.cif.gz_A-2 daargc - n-acetyl-gamma-glutamyl-phosphate reductase of denitrovibrio acetiphilus 0.9338 1 323
2cvo-assembly1.cif.gz_C crystal structure of putative n-acetyl-gamma-glutamyl-phosphate reductase (ak071544) from rice (oryza sativa) 0.9337 2 330
ID Description Score Start End Superfamily
af_Q93Z70_59_202_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9437 2 141 3.40.50.720
af_Q2G1H4_2_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.925 2 128 3.40.50.720
af_P11446_1_104_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9225 1 95 3.40.50.720
2i3gB02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.914 144 298 3.30.360.10
af_Q93Z70_59_202_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9122 2 141 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7X7D8W6-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase 0.9724 204 330
AF-A0A4Q3XSG0-F1-model_v4 deleted 0.9719 220 330
AF-A0A2W6C967-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase 0.9712 204 330
AF-X0TGS3-F1-model_v4 Semialdehyde dehydrogenase dimerisation domain-containing protein 0.9672 246 330
AF-A0A349PVV3-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase 0.9659 205 330

Feature Viewer

pLDDT pTM Quality
91.9 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map