F445771

General Info

Members Datasets Scaffolds Average Seq Length
446 322 892 383

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0168918|Ga0436361_0168918_122_1405
Length 427
Sequence LHKSCRAKHANHLEGISPVAAEEMRSANLEGSQMIRFTRRTLIAVAAATVAATLSPLALAADTIKIGLVTALSGQSAQAGEALTRGMSIAIDEINAKGGLLGGRTLELVRRDDEGNPAKGVVAARELIFKEKVAVLFGGLDTPVSMAIVPIINQEKVPFVGPWAAGTGVTRNGANPNYAFRVSAVDELVDKAMLNYAQKTFKSSKAGLILVNNPWGESNEKGITAALAEKGMKPVGVEKFEASDVDLVPQLSRLKAAGADTLFLVGNVGPSAQVVKSLDRMGWKVPVVSHWGPAGGRFTELAGPNAKNVHFVQTFSFFGKLSPVGEKVVAELKAKYPAIKGPDDITPAVGVANAYDGMQLAALAIAKAGSTNGDAVREGFYKIDRYDGLIKTYVKPFSASVHDALQADDYVWAQFIDNRILPVGLNQ

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
5 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
6 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
7 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
65 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
85 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
86 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
144 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
155 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
156 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
157 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
158 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
159 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
160 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
161 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
174 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
176 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
177 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
180 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
187 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
188 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
193 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
202 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
209 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
210 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
213 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
214 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
223 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
224 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
237 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
238 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
239 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
240 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
241 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
242 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
243 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
244 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
250 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
251 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
252 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
253 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
254 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
261 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
262 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
263 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
264 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
265 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
266 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
267 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
268 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
269 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
272 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
273 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
274 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
275 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
276 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
277 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
278 2643221569 Achromobacter sp. Root565 Isolate Unclassified
279 2643221594 Achromobacter sp. Root170 Isolate Unclassified
280 2643221609 Acidovorax sp. Root217 Isolate Unclassified
281 2643221611 Acidovorax sp. Root219 Isolate Unclassified
282 2643221621 Achromobacter sp. Root83 Isolate Unclassified
283 2738541277 Variovorax sp. GV051 Isolate Unclassified
284 2738543012 Acidovorax sp. CF301 Isolate Unclassified
285 2738543013 Variovorax sp. BT01 Isolate Unclassified
286 2738543019 Variovorax sp. GV040 Isolate Unclassified
287 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
288 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
289 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
290 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
291 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
292 2816332133 Acidovorax radicis 2721A Isolate Unclassified
293 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
294 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
295 2842677519 Variovorax sp. R-72495 Isolate Unclassified
296 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
297 2842733646 Variovorax sp. R-72446 Isolate Unclassified
298 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
299 2855730933 Achromobacter sp. HZ28 Isolate Nodule
300 2855767633 Achromobacter sp. HZ34 Isolate Nodule
301 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
302 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
303 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
304 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
305 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
306 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
307 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
308 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
309 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
310 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
311 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
312 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
313 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
314 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
315 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
316 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
317 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
318 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
319 2929520902 Variovorax beijingensis 502 Isolate Unclassified
320 2941479691
321 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
322 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.57
Metatranscriptomes 0.22
Isolates 11.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.23
Nodule 1.79
Rhizoplane 2.91
Rhizosphere 68.83
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_0168918 3300039447 Bacteria 13423
2 JGI25162J39368_1004586 3300002737 Bacteria 3133
3 JGI25151J46595_10013441 3300003187 Bacteria 3683
4 Ga0055538_1000141 3300003751 Bacteria 50563
5 Ga0055539_1000192 3300003752 Bacteria 50563
6 Ga0055533_1000192 3300003756 Bacteria 50563
7 Ga0055525_1000260 3300003759 Bacteria 50563
8 Ga0055526_1006883 3300003771 Bacteria 6057
9 Ga0055526_1006931 3300003771 Bacteria 6029
10 Ga0055524_1000158 3300003775 Bacteria 78973
11 Ga0055536_1000677 3300003781 Bacteria 22946
12 Ga0055534_1000904 3300003784 Bacteria 13385
13 Ga0055534_1000985 3300003784 Bacteria 12573
14 Ga0055534_1001105 3300003784 Bacteria 11469
15 Ga0055530_10003217 3300003791 Bacteria 9557
16 Ga0055540_1000035 3300003792 Bacteria 166843
17 Ga0055531_10011903 3300003794 Bacteria 4142
18 Ga0055541_1000127 3300003841 Bacteria 50563
19 Ga0070676_10006449 3300005328 Bacteria 6272
20 Ga0070690_100001379 3300005330 Bacteria 12655
21 Ga0070670_100135094 3300005331 Bacteria 2131
22 Ga0070677_10091672 3300005333 Bacteria 1323
23 Ga0070666_10030465 3300005335 Bacteria 3555
24 Ga0068868_100000620 3300005338 Bacteria 23878
25 Ga0070660_100005338 3300005339 Bacteria 8891
26 Ga0070669_100069692 3300005353 Bacteria 2598
27 Ga0070675_100000657 3300005354 Bacteria 23889
28 Ga0070675_100006788 3300005354 Bacteria 8789
29 Ga0070675_100015987 3300005354 Bacteria 5946
30 Ga0070675_100146949 3300005354 Bacteria 2019
31 Ga0070671_100003866 3300005355 Bacteria 11774
32 Ga0070671_100011204 3300005355 Bacteria 7202
33 Ga0070671_100024730 3300005355 Bacteria 4919
34 Ga0070674_100057254 3300005356 Bacteria 2705
35 Ga0070673_100023967 3300005364 Bacteria 4466
36 Ga0070673_100090814 3300005364 Bacteria 2495
37 Ga0070673_100101773 3300005364 Bacteria 2367
38 Ga0070659_100003900 3300005366 Bacteria 10621
39 Ga0070659_100139421 3300005366 Bacteria 1974
40 Ga0070667_100125127 3300005367 Bacteria 2240
41 Ga0070705_100034293 3300005440 Bacteria 2836
42 Ga0070663_100005608 3300005455 Bacteria 7471
43 Ga0070678_100204936 3300005456 Bacteria 1630
44 Ga0070662_100000114 3300005457 Bacteria 45016
45 Ga0068867_100112621 3300005459 Bacteria 2092
46 Ga0068867_100115405 3300005459 Bacteria 2068
47 Ga0070707_100095896 3300005468 Bacteria 2873
48 Ga0070698_100004336 3300005471 Bacteria 15595
49 Ga0070699_100003076 3300005518 Bacteria 14790
50 Ga0070699_100008557 3300005518 Bacteria 8866
51 Ga0070699_100079418 3300005518 Bacteria 2858
52 Ga0070679_100108404 3300005530 Bacteria 2763
53 Ga0070697_100016288 3300005536 Bacteria 5846
54 Ga0070697_100236743 3300005536 Bacteria 1558
55 Ga0068853_100013366 3300005539 Bacteria 6702
56 Ga0070672_100013802 3300005543 Bacteria 5713
57 Ga0070672_100027953 3300005543 Bacteria 4213
58 Ga0070672_100042182 3300005543 Bacteria 3512
59 Ga0070672_100053736 3300005543 Bacteria 3150
60 Ga0070672_100055826 3300005543 Bacteria 3095
61 Ga0070672_100104701 3300005543 Bacteria 2299
62 Ga0070686_100004065 3300005544 Bacteria 8045
63 Ga0070695_100011344 3300005545 Bacteria 5331
64 Ga0070696_100018308 3300005546 Bacteria 4733
65 Ga0070665_100001724 3300005548 Bacteria 25012
66 Ga0070665_100050322 3300005548 Bacteria 4181
67 Ga0068855_100000832 3300005563 Bacteria 38157
68 Ga0068855_100047077 3300005563 Bacteria 5096
69 Ga0068855_100119379 3300005563 Bacteria 3019
70 Ga0070664_100000514 3300005564 Bacteria 29415
71 Ga0068856_100000679 3300005614 Bacteria 36874
72 Ga0068852_100184890 3300005616 Bacteria 1962
73 Ga0068859_100141282 3300005617 Bacteria 2481
74 Ga0068864_100000413 3300005618 Bacteria 37037
75 Ga0068863_100001085 3300005841 Bacteria 27245
76 Ga0068863_100007527 3300005841 Bacteria 10650
77 Ga0068863_100213756 3300005841 Bacteria 1857
78 Ga0068858_100003733 3300005842 Bacteria 15071
79 Ga0068860_100195910 3300005843 Bacteria 1956
80 Ga0068862_100006430 3300005844 Bacteria 9767
81 Ga0075365_10001468 3300006038 Bacteria 10712
82 Ga0075365_10051041 3300006038 Bacteria 2730
83 Ga0075366_10146294 3300006195 Bacteria 1430
84 Ga0097621_100004313 3300006237 Bacteria 9881
85 Ga0097621_100024442 3300006237 Bacteria 4718
86 Ga0097621_100056910 3300006237 Bacteria 3195
87 Ga0068871_100008335 3300006358 Bacteria 7451
88 Ga0068871_100015571 3300006358 Bacteria 5698
89 Ga0075434_100036572 3300006871 Bacteria 4857
90 Ga0068865_100033065 3300006881 Bacteria 3460
91 Ga0075436_100000152 3300006914 Bacteria 42960
92 Ga0097620_100141285 3300006931 Bacteria 2481
93 Ga0079104_1000024 3300006946 Bacteria 219543
94 Ga0099826_10000113 3300006948 Bacteria 36930
95 Ga0105240_10002050 3300009093 Bacteria 33144
96 Ga0105240_10006656 3300009093 Bacteria 16948
97 Ga0105240_10030486 3300009093 Bacteria 7010
98 Ga0111539_10101724 3300009094 Bacteria 3374
99 Ga0111539_10165546 3300009094 Bacteria 2585
100 Ga0114129_10058647 3300009147 Bacteria 5384
101 Ga0105248_10017581 3300009177 Bacteria 7886
102 Ga0105248_10068130 3300009177 Bacteria 3996
103 Ga0105248_10280463 3300009177 Bacteria 1876
104 Ga0105237_10021166 3300009545 Bacteria 6689
105 Ga0105238_10000006 3300009551 Bacteria 346249
106 Ga0105239_10002999 3300010375 Bacteria 21046
107 Ga0157373_10091852 3300013100 Bacteria 2138
108 Ga0157371_10000273 3300013102 Bacteria 70036
109 Ga0157369_10027101 3300013105 Bacteria 6354
110 Ga0157369_10453631 3300013105 Bacteria 1328
111 Ga0157378_10026912 3300013297 Bacteria 5072
112 Ga0157372_10002025 3300013307 Bacteria 22020
113 Ga0157375_10033534 3300013308 Bacteria 4879
114 Ga0157375_10104919 3300013308 Bacteria 2916
115 Ga0157380_10046333 3300014326 Bacteria 3414
116 Ga0157379_10003077 3300014968 Bacteria 14101
117 Ga0157379_10283436 3300014968 Bacteria 1508
118 Ga0157376_10002703 3300014969 Bacteria 12074
119 Ga0182006_1001498 3300015261 Bacteria 14002
120 Ga0182006_1037449 3300015261 Bacteria 1922
121 Ga0163161_10022160 3300017792 Bacteria 4471
122 Ga0213872_10018675 3300021361 Bacteria 3195
123 Ga0213875_10000045 3300021388 Bacteria 150013
124 Ga0209784_100009 3300025224 Bacteria 688031
125 Ga0209566_100007 3300025225 Bacteria 688031
126 Ga0209674_100018 3300025226 Bacteria 688031
127 Ga0209563_100020 3300025230 Bacteria 688031
128 Ga0209437_100117 3300025233 Bacteria 209271
129 Ga0209677_100010 3300025253 Bacteria 688031
130 Ga0209565_1000426 3300025263 Bacteria 34052
131 Ga0209130_1012022 3300025284 Bacteria 2287
132 Ga0209675_1000174 3300025291 Bacteria 74594
133 Ga0209675_1000426 3300025291 Bacteria 34022
134 Ga0209675_1001705 3300025291 Bacteria 12141
135 Ga0209675_1003777 3300025291 Bacteria 7010
136 Ga0209675_1005891 3300025291 Bacteria 5027
137 Ga0209676_1001413 3300025292 Bacteria 22998
138 Ga0209676_1003226 3300025292 Bacteria 10303
139 Ga0209025_1000019 3300025294 Bacteria 631548
140 Ga0209025_1001481 3300025294 Bacteria 30488
141 Ga0209025_1001800 3300025294 Bacteria 25408
142 Ga0209025_1012535 3300025294 Bacteria 5424
143 Ga0209564_1000145 3300025295 Bacteria 175251
144 Ga0209564_1001261 3300025295 Bacteria 27868
145 Ga0209564_1004730 3300025295 Bacteria 8150
146 Ga0209758_1015363 3300025297 Bacteria 3972
147 Ga0209050_1000995 3300025298 Bacteria 35798
148 Ga0209050_1002538 3300025298 Bacteria 15264
149 Ga0209050_1011490 3300025298 Bacteria 4189
150 Ga0209256_1000011 3300025299 Bacteria 865309
151 Ga0209256_1003493 3300025299 Bacteria 10955
152 Ga0209051_1000016 3300025303 Bacteria 541891
153 Ga0209257_1000102 3300025304 Bacteria 251074
154 Ga0209257_1011872 3300025304 Bacteria 4119
155 Ga0207656_10024353 3300025321 Bacteria 2447
156 Ga0207682_10001414 3300025893 Bacteria 11095
157 Ga0207680_10143542 3300025903 Bacteria 1585
158 Ga0207680_10246582 3300025903 Bacteria 1232
159 Ga0207685_10028511 3300025905 Bacteria 1967
160 Ga0207699_10096866 3300025906 Bacteria 1863
161 Ga0207645_10029835 3300025907 Bacteria 3514
162 Ga0207645_10076706 3300025907 Bacteria 2141
163 Ga0207684_10002044 3300025910 Bacteria 20769
164 Ga0207684_10003548 3300025910 Bacteria 15204
165 Ga0207695_10002139 3300025913 Bacteria 29918
166 Ga0207695_10004925 3300025913 Bacteria 17994
167 Ga0207695_10163480 3300025913 Bacteria 2155
168 Ga0207671_10009496 3300025914 Bacteria 8125
169 Ga0207657_10000751 3300025919 Bacteria 34386
170 Ga0207652_10078365 3300025921 Bacteria 2885
171 Ga0207652_10161059 3300025921 Bacteria 2012
172 Ga0207681_10049443 3300025923 Bacteria 2842
173 Ga0207681_10057988 3300025923 Bacteria 2649
174 Ga0207694_10000110 3300025924 Bacteria 85854
175 Ga0207650_10006132 3300025925 Bacteria 8189
176 Ga0207659_10009868 3300025926 Bacteria 5977
177 Ga0207659_10034922 3300025926 Bacteria 3471
178 Ga0207659_10119529 3300025926 Bacteria 2017
179 Ga0207659_10180678 3300025926 Bacteria 1671
180 Ga0207644_10010435 3300025931 Bacteria 6122
181 Ga0207644_10011942 3300025931 Bacteria 5759
182 Ga0207644_10023170 3300025931 Bacteria 4249
183 Ga0207690_10000861 3300025932 Bacteria 19453
184 Ga0207706_10000386 3300025933 Bacteria 48203
185 Ga0207706_10041990 3300025933 Bacteria 4052
186 Ga0207706_10224636 3300025933 Bacteria 1644
187 Ga0207670_10039906 3300025936 Bacteria 3078
188 Ga0207669_10055768 3300025937 Bacteria 2395
189 Ga0207669_10081515 3300025937 Bacteria 2073
190 Ga0207704_10031264 3300025938 Bacteria 2997
191 Ga0207665_10003961 3300025939 Bacteria 9907
192 Ga0207665_10165952 3300025939 Bacteria 1591
193 Ga0207691_10021182 3300025940 Bacteria 6142
194 Ga0207691_10025603 3300025940 Bacteria 5538
195 Ga0207691_10025760 3300025940 Bacteria 5520
196 Ga0207691_10159540 3300025940 Bacteria 1979
197 Ga0207711_10018500 3300025941 Bacteria 5793
198 Ga0207711_10027259 3300025941 Bacteria 4798
199 Ga0207711_10120386 3300025941 Bacteria 2343
200 Ga0207711_10130440 3300025941 Bacteria 2253
201 Ga0207679_10003757 3300025945 Bacteria 9409
202 Ga0207679_10072842 3300025945 Bacteria 2596
203 Ga0207667_10006563 3300025949 Bacteria 14075
204 Ga0207667_10009687 3300025949 Bacteria 11334
205 Ga0207667_10016670 3300025949 Bacteria 8292
206 Ga0207667_10022444 3300025949 Bacteria 6971
207 Ga0207651_10012347 3300025960 Bacteria 4830
208 Ga0207651_10040198 3300025960 Bacteria 3091
209 Ga0207651_10047941 3300025960 Bacteria 2884
210 Ga0207712_10017156 3300025961 Bacteria 4698
211 Ga0207640_10085914 3300025981 Bacteria 2164
212 Ga0207658_10094268 3300025986 Bacteria 2329
213 Ga0207703_10018295 3300026035 Bacteria 5472
214 Ga0207639_10002272 3300026041 Bacteria 12924
215 Ga0207639_10093290 3300026041 Bacteria 2414
216 Ga0207678_10118830 3300026067 Bacteria 2256
217 Ga0207702_10012900 3300026078 Bacteria 6950
218 Ga0207702_10023862 3300026078 Bacteria 5074
219 Ga0207641_10001191 3300026088 Bacteria 26088
220 Ga0207641_10001998 3300026088 Bacteria 19461
221 Ga0207641_10184377 3300026088 Bacteria 1914
222 Ga0207648_10063998 3300026089 Bacteria 3205
223 Ga0207676_10000453 3300026095 Bacteria 34510
224 Ga0207676_10076869 3300026095 Bacteria 2699
225 Ga0207676_10251720 3300026095 Bacteria 1590
226 Ga0207675_100054172 3300026118 Bacteria 3742
227 Ga0207675_100096651 3300026118 Bacteria 2781
228 Ga0207675_100135936 3300026118 Bacteria 2332
229 Ga0207683_10063706 3300026121 Bacteria 3248
230 Ga0207698_10026389 3300026142 Bacteria 4109
231 Ga0207698_10246277 3300026142 Bacteria 1632
232 Ga0209281_1000104 3300027111 Bacteria 221056
233 Ga0209371_1010344 3300027312 Bacteria 2880
234 Ga0209969_1009871 3300027360 Bacteria 1363
235 Ga0209995_1001845 3300027471 Bacteria 3306
236 Ga0209968_1003707 3300027526 Bacteria 2291
237 Ga0209970_1000507 3300027614 Bacteria 6685
238 Ga0209983_1002261 3300027665 Bacteria 4231
239 Ga0209966_1001408 3300027695 Bacteria 4199
240 Ga0209974_10001561 3300027876 Bacteria 8314
241 Ga0209974_10010175 3300027876 Bacteria 3176
242 Ga0268266_10049171 3300028379 Bacteria 3615
243 Ga0268265_10034016 3300028380 Bacteria 3711
244 Ga0268256_1010656 3300030500 Bacteria 2963
245 Ga0316177_1014409 3300030731 Bacteria 1649
246 Ga0314311_1073099 3300030733 Bacteria 10180
247 Ga0316178_1052160 3300030735 Bacteria 3081
248 Ga0316180_1060727 3300030736 Bacteria 3607
249 Ga0316181_1164487 3300030744 Bacteria 4254
250 Ga0316182_1166823 3300030745 Bacteria 2521
251 Ga0265760_10031859 3300031090 Bacteria 1555
252 Ga0307408_100004825 3300031548 Bacteria 9086
253 Ga0307408_100041232 3300031548 Bacteria 3272
254 Ga0307408_100075171 3300031548 Bacteria 2509
255 Ga0307408_100228062 3300031548 Bacteria 1523
256 Ga0307405_10001413 3300031731 Bacteria 10109
257 Ga0307413_10012313 3300031824 Bacteria 4253
258 Ga0307410_10012649 3300031852 Bacteria 4889
259 Ga0307406_10000689 3300031901 Bacteria 19156
260 Ga0307406_10005939 3300031901 Bacteria 6700
261 Ga0307412_10000106 3300031911 Bacteria 67067
262 Ga0307412_10004832 3300031911 Bacteria 7519
263 Ga0307409_100018299 3300031995 Bacteria 4705
264 Ga0307416_100040546 3300032002 Bacteria 3618
265 Ga0307414_10048259 3300032004 Bacteria 2936
266 Ga0307411_10022114 3300032005 Bacteria 3737
267 Ga0307415_100021137 3300032126 Bacteria 3993
268 Ga0307510_10037495 3300033180 Bacteria 5377
269 Ga0373923_0005608 3300035111 Bacteria 4273
270 Ga0373954_0003159 3300035118 Bacteria 6963
271 Ga0373956_0016609 3300035119 Bacteria 3093
272 Ga0373946_0013795 3300035171 Bacteria 3042
273 Ga0373955_0001386 3300035172 Bacteria 10297
274 Ga0316574_0002857 3300035398 Bacteria 8770
275 Ga0373924_0010132 3300035410 Bacteria 3470
276 Ga0373935_0022754 3300035692 Bacteria 3847
277 Ga0373927_0057904 3300035695 Bacteria 2506
278 Ga0373933_0005542 3300035724 Bacteria 6877
279 Ga0373937_0002028 3300036401 Bacteria 16914
280 Ga0373937_0088349 3300036401 Bacteria 2869
281 Ga0373937_0151730 3300036401 Bacteria 2171
282 Ga0373925_0024184 3300037068 Bacteria 4434
283 Ga0373925_0157331 3300037068 Bacteria 1788
284 Ga0373925_0275735 3300037068 Bacteria 1354
285 Ga0436364_0195675 3300037853 Bacteria 22937
286 Ga0451807_1918916 3300041486 Bacteria 1999
287 Ga0450911_000322 3300042115 Bacteria 17149
288 Ga0451576_0258790 3300045051 Bacteria 1819
289 Ga0495592_0103981 3300046454 Unclassified 2020
290 Ga0495629_0002190 3300046459 Bacteria 15079
291 Ga0495638_0172116 3300046460 Bacteria 1241
292 Ga0495641_0039006 3300046461 Bacteria 2217
293 Ga0495651_0001006 3300046462 Bacteria 21897
294 Ga0495653_0011823 3300046463 Bacteria 7128
295 Ga0495582_0086577 3300046473 Bacteria 1744
296 Ga0495662_0072540 3300046476 Bacteria 1669
297 Ga0495664_0003228 3300046477 Bacteria 8854
298 Ga0495607_0000468 3300046501 Bacteria 40674
299 Ga0495608_0004042 3300046511 Bacteria 10529
300 Ga0495618_0000741 3300046514 Bacteria 22826
301 Ga0495654_0003050 3300046530 Bacteria 10432
302 Ga0495640_0005375 3300046533 Bacteria 10189
303 Ga0495586_0003565 3300046535 Bacteria 8342
304 Ga0495621_0034949 3300046539 Bacteria 1738
305 Ga0495621_0036317 3300046539 Bacteria 1710
306 Ga0495645_0076077 3300046543 Bacteria 2416
307 Ga0495667_0000654 3300046559 Bacteria 22139
308 Ga0495656_0000176 3300046615 Bacteria 22627
309 Ga0495634_0004062 3300046642 Bacteria 11588
310 Ga0495625_0002799 3300046660 Bacteria 18380
311 Ga0495635_0003108 3300046663 Bacteria 11421
312 Ga0495657_0010768 3300046675 Bacteria 6870
313 Ga0495623_0005708 3300046679 Bacteria 8129
314 Ga0495646_0001331 3300046680 Bacteria 14585
315 Ga0495658_0009649 3300046683 Bacteria 4813
316 Ga0495658_0141609 3300046683 Bacteria 1471
317 Ga0495613_0335844 3300046689 Bacteria 1040
318 Ga0495624_0009016 3300046690 Bacteria 6933
319 Ga0495600_0027570 3300046809 Bacteria 3670
320 Ga0495581_0224721 3300047315 Bacteria 1098
321 Ga0495604_0001231 3300047317 Bacteria 20971
322 Ga0495674_0002137 3300047319 Bacteria 19412
323 Ga0495680_0002906 3300047322 Bacteria 17209
324 Ga0495687_006653 3300047443 Bacteria 7023
325 Ga0495675_0017647 3300047444 Bacteria 4525
326 Ga0495684_0002299 3300047471 Bacteria 15301
327 Ga0495602_0011794 3300048088 Bacteria 9027
328 Ga0495615_0007864 3300048090 Bacteria 2039
329 Ga0495615_0008656 3300048090 Bacteria 1976
330 Ga0496102_0064195 3300048905 Bacteria 3363
331 Ga0496102_0372928 3300048905 Bacteria 1343
332 Ga0496103_0048741 3300048906 Bacteria 2618
333 Ga0496104_0068141 3300048907 Bacteria 3381
334 Ga0496105_0139402 3300048908 Bacteria 1997
335 Ga0496108_0175913 3300048911 Bacteria 1853
336 Ga0496109_0421429 3300048912 Bacteria 1261
337 Ga0496110_0087967 3300048913 Bacteria 2774
338 Ga0496110_0299077 3300048913 Bacteria 1466
339 Ga0496114_0007110 3300048917 Bacteria 8831
340 Ga0496114_0128126 3300048917 Bacteria 2190
341 Ga0496116_0010215 3300048919 Bacteria 7896
342 Ga0496116_0015566 3300048919 Bacteria 6007
343 Ga0496116_0041832 3300048919 Bacteria 3140
344 Ga0496118_0009498 3300048921 Bacteria 9806
345 Ga0496120_0003586 3300048923 Bacteria 13947
346 Ga0496121_0000165 3300048924 Bacteria 145052
347 Ga0496121_0003822 3300048924 Bacteria 20965
348 Ga0496121_0004161 3300048924 Bacteria 19780
349 Ga0496121_0013484 3300048924 Bacteria 8774
350 Ga0496121_0016988 3300048924 Bacteria 7470
351 Ga0496121_0085333 3300048924 Bacteria 2486
352 Ga0496122_0000618 3300048925 Bacteria 72850
353 Ga0496122_0000936 3300048925 Bacteria 53067
354 Ga0496122_0001626 3300048925 Bacteria 35051
355 Ga0496122_0144006 3300048925 Bacteria 1485
356 Ga0496123_0001075 3300048926 Bacteria 41273
357 Ga0496123_0001275 3300048926 Bacteria 36068
358 Ga0496123_0001319 3300048926 Bacteria 35071
359 Ga0496124_0000046 3300048927 Bacteria 287043
360 Ga0496124_0055511 3300048927 Bacteria 3347
361 Ga0496124_0084004 3300048927 Bacteria 2611
362 Ga0496124_0112734 3300048927 Bacteria 2186
363 Ga0496125_0000121 3300048928 Bacteria 174971
364 Ga0496125_0002327 3300048928 Bacteria 25024
365 Ga0501039_0020589 3300049575 Bacteria 5055
366 Ga0501040_0025479 3300049576 Bacteria 3976
367 Ga0501041_0007764 3300049577 Bacteria 6299
368 Ga0501042_0016216 3300049578 Bacteria 5111
369 Ga0501046_0063123 3300049580 Bacteria 2893
370 Ga0501069_0041582 3300049585 Bacteria 2541
371 Ga0501071_0089139 3300049587 Bacteria 2263
372 Ga0501072_0034096 3300049588 Bacteria 3989
373 Ga0501075_0084581 3300049591 Bacteria 2403
374 Ga0501076_0053398 3300049592 Bacteria 3202
375 Ga0501225_0004004 3300049705 Bacteria 4410
376 Ga0501081_0011654 3300049743 Bacteria 5755
377 Ga0501262_000429 3300049759 Bacteria 5047
378 Ga0501045_0002422 3300049824 Bacteria 12679
379 nmdc:mga0yw44_109886_c1 3300050492 Bacteria 1765
380 nmdc:mga0yw44_12493_c1 3300050492 Bacteria 4430
381 nmdc:mga0n895_8462_c1 3300050512 Bacteria 8908
382 nmdc:mga08x19_7794_c1 3300050514 Bacteria 6361
383 Ga0495601_0014875 3300053077 Bacteria 4697
384 Ga0495601_0048126 3300053077 Bacteria 2685
385 Ga0495612_0005438 3300053078 Bacteria 5265
386 Ga0495595_0005927 3300053084 Bacteria 4956
387 Ga0495619_0049364 3300053085 Bacteria 2775
388 Ga0500562_002948 3300053108 Bacteria 4246
389 Ga0500593_043661 3300053117 Bacteria 2000
390 Ga0500618_000716 3300053125 Bacteria 19145
391 Ga0500618_000823 3300053125 Bacteria 17028
392 Ga0500559_0003326 3300053136 Bacteria 7962
393 Ga0500637_0118115 3300053178 Bacteria 1539
394 Ga0501084_0045106 3300054114 Bacteria 3692
395 Ga0501082_0013050 3300060353 Bacteria 7141
396 Ga0530510_0002791 3300061734 Bacteria 12020
397 2509152683 2508501128 Bacteria 8613869
398 2511384283 2511231026 Bacteria 5225445
399 2521559702 2521172590 Bacteria 5047645
400 2574432084 2574179768 Bacteria 4907129
401 2599904323 2599185292 Bacteria 6290804
402 2643863731 2643221569 Bacteria 6064337
403 2643982934 2643221594 Bacteria 5811388
404 2644057885 2643221609 Bacteria 6756331
405 2644072921 2643221611 Bacteria 6820941
406 2644123225 2643221621 Bacteria 6212786
407 2738719510 2738541277 Bacteria 7458140
408 2739242161 2738543012 Bacteria 7115078
409 2739248112 2738543013 Bacteria 5618633
410 2739283668 2738543019 Bacteria 7459457
411 2765570960 2765235838 Bacteria 5445269
412 2808984867 2808606386 Bacteria 4471946
413 2809033524 2808606395 Bacteria 6020352
414 2809128273 2808606415 Bacteria 4576710
415 2809147894 2808606419 Bacteria 4576925
416 2816470222 2816332133 Bacteria 7249298
417 2819616075 2818991449 Bacteria 5518009
418 2839099349 2839094727 Bacteria 5534556
419 2842681310 2842677519 Bacteria 5615038
420 2842720437 2842718218 Bacteria 4560148
421 2842738841 2842733646 Bacteria 5716726
422 2852620694 2852618963 Bacteria 4577824
423 2855732899 2855730933 Bacteria 7047938
424 2855771651 2855767633 Bacteria 7049357
425 2857537976 2857537821 Bacteria 5248181
426 2857546545 2857542790 Bacteria 5326616
427 2881103912 2881101125 Bacteria 4590519
428 2881413796 2881412998 Bacteria 6492157
429 2884815356 2884811622 Bacteria 5552861
430 2884841088 2884836552 Bacteria 5219991
431 2884855963 2884852848 Bacteria 5221161
432 2896157112 2896154374 Bacteria 5221518
433 2904443339 2904439833 Bacteria 5931679
434 2904481437 2904479285 Bacteria 5073931
435 2904533048 2904530477 Bacteria 5876334
436 2904585603 2904584206 Bacteria 6028872
437 2904593952 2904589729 Bacteria 6113573
438 2904603895 2904601388 Bacteria 5884906
439 2919047604 2919046199 Bacteria 5567169
440 2919081867 2919079590 Bacteria 5946433
441 2919464647 2919462493 Bacteria 5817112
442 2919708644 2919704043 Bacteria 5560311
443 2929526697 2929520902 Bacteria 6765052
444 2941484217
445 2954770245 2954767861 Bacteria 5535784
446 2974321382 2974320154 Bacteria 4571377
447 Ga0436361_0168918
448 JGI25162J39368_1004586
449 JGI25151J46595_10013441
450 Ga0055538_1000141
451 Ga0055539_1000192
452 Ga0055533_1000192
453 Ga0055525_1000260
454 Ga0055526_1006883
455 Ga0055526_1006931
456 Ga0055524_1000158
457 Ga0055536_1000677
458 Ga0055534_1000904
459 Ga0055534_1000985
460 Ga0055534_1001105
461 Ga0055530_10003217
462 Ga0055540_1000035
463 Ga0055531_10011903
464 Ga0055541_1000127
465 Ga0070676_10006449
466 Ga0070690_100001379
467 Ga0070670_100135094
468 Ga0070677_10091672
469 Ga0070666_10030465
470 Ga0068868_100000620
471 Ga0070660_100005338
472 Ga0070669_100069692
473 Ga0070675_100000657
474 Ga0070675_100006788
475 Ga0070675_100015987
476 Ga0070675_100146949
477 Ga0070671_100003866
478 Ga0070671_100011204
479 Ga0070671_100024730
480 Ga0070674_100057254
481 Ga0070673_100023967
482 Ga0070673_100090814
483 Ga0070673_100101773
484 Ga0070659_100003900
485 Ga0070659_100139421
486 Ga0070667_100125127
487 Ga0070705_100034293
488 Ga0070663_100005608
489 Ga0070678_100204936
490 Ga0070662_100000114
491 Ga0068867_100112621
492 Ga0068867_100115405
493 Ga0070707_100095896
494 Ga0070698_100004336
495 Ga0070699_100003076
496 Ga0070699_100008557
497 Ga0070699_100079418
498 Ga0070679_100108404
499 Ga0070697_100016288
500 Ga0070697_100236743
501 Ga0068853_100013366
502 Ga0070672_100013802
503 Ga0070672_100027953
504 Ga0070672_100042182
505 Ga0070672_100053736
506 Ga0070672_100055826
507 Ga0070672_100104701
508 Ga0070686_100004065
509 Ga0070695_100011344
510 Ga0070696_100018308
511 Ga0070665_100001724
512 Ga0070665_100050322
513 Ga0068855_100000832
514 Ga0068855_100047077
515 Ga0068855_100119379
516 Ga0070664_100000514
517 Ga0068856_100000679
518 Ga0068852_100184890
519 Ga0068859_100141282
520 Ga0068864_100000413
521 Ga0068863_100001085
522 Ga0068863_100007527
523 Ga0068863_100213756
524 Ga0068858_100003733
525 Ga0068860_100195910
526 Ga0068862_100006430
527 Ga0075365_10001468
528 Ga0075365_10051041
529 Ga0075366_10146294
530 Ga0097621_100004313
531 Ga0097621_100024442
532 Ga0097621_100056910
533 Ga0068871_100008335
534 Ga0068871_100015571
535 Ga0075434_100036572
536 Ga0068865_100033065
537 Ga0075436_100000152
538 Ga0097620_100141285
539 Ga0079104_1000024
540 Ga0099826_10000113
541 Ga0105240_10002050
542 Ga0105240_10006656
543 Ga0105240_10030486
544 Ga0111539_10101724
545 Ga0111539_10165546
546 Ga0114129_10058647
547 Ga0105248_10017581
548 Ga0105248_10068130
549 Ga0105248_10280463
550 Ga0105237_10021166
551 Ga0105238_10000006
552 Ga0105239_10002999
553 Ga0157373_10091852
554 Ga0157371_10000273
555 Ga0157369_10027101
556 Ga0157369_10453631
557 Ga0157378_10026912
558 Ga0157372_10002025
559 Ga0157375_10033534
560 Ga0157375_10104919
561 Ga0157380_10046333
562 Ga0157379_10003077
563 Ga0157379_10283436
564 Ga0157376_10002703
565 Ga0182006_1001498
566 Ga0182006_1037449
567 Ga0163161_10022160
568 Ga0213872_10018675
569 Ga0213875_10000045
570 Ga0209784_100009
571 Ga0209566_100007
572 Ga0209674_100018
573 Ga0209563_100020
574 Ga0209437_100117
575 Ga0209677_100010
576 Ga0209565_1000426
577 Ga0209130_1012022
578 Ga0209675_1000174
579 Ga0209675_1000426
580 Ga0209675_1001705
581 Ga0209675_1003777
582 Ga0209675_1005891
583 Ga0209676_1001413
584 Ga0209676_1003226
585 Ga0209025_1000019
586 Ga0209025_1001481
587 Ga0209025_1001800
588 Ga0209025_1012535
589 Ga0209564_1000145
590 Ga0209564_1001261
591 Ga0209564_1004730
592 Ga0209758_1015363
593 Ga0209050_1000995
594 Ga0209050_1002538
595 Ga0209050_1011490
596 Ga0209256_1000011
597 Ga0209256_1003493
598 Ga0209051_1000016
599 Ga0209257_1000102
600 Ga0209257_1011872
601 Ga0207656_10024353
602 Ga0207682_10001414
603 Ga0207680_10143542
604 Ga0207680_10246582
605 Ga0207685_10028511
606 Ga0207699_10096866
607 Ga0207645_10029835
608 Ga0207645_10076706
609 Ga0207684_10002044
610 Ga0207684_10003548
611 Ga0207695_10002139
612 Ga0207695_10004925
613 Ga0207695_10163480
614 Ga0207671_10009496
615 Ga0207657_10000751
616 Ga0207652_10078365
617 Ga0207652_10161059
618 Ga0207681_10049443
619 Ga0207681_10057988
620 Ga0207694_10000110
621 Ga0207650_10006132
622 Ga0207659_10009868
623 Ga0207659_10034922
624 Ga0207659_10119529
625 Ga0207659_10180678
626 Ga0207644_10010435
627 Ga0207644_10011942
628 Ga0207644_10023170
629 Ga0207690_10000861
630 Ga0207706_10000386
631 Ga0207706_10041990
632 Ga0207706_10224636
633 Ga0207670_10039906
634 Ga0207669_10055768
635 Ga0207669_10081515
636 Ga0207704_10031264
637 Ga0207665_10003961
638 Ga0207665_10165952
639 Ga0207691_10021182
640 Ga0207691_10025603
641 Ga0207691_10025760
642 Ga0207691_10159540
643 Ga0207711_10018500
644 Ga0207711_10027259
645 Ga0207711_10120386
646 Ga0207711_10130440
647 Ga0207679_10003757
648 Ga0207679_10072842
649 Ga0207667_10006563
650 Ga0207667_10009687
651 Ga0207667_10016670
652 Ga0207667_10022444
653 Ga0207651_10012347
654 Ga0207651_10040198
655 Ga0207651_10047941
656 Ga0207712_10017156
657 Ga0207640_10085914
658 Ga0207658_10094268
659 Ga0207703_10018295
660 Ga0207639_10002272
661 Ga0207639_10093290
662 Ga0207678_10118830
663 Ga0207702_10012900
664 Ga0207702_10023862
665 Ga0207641_10001191
666 Ga0207641_10001998
667 Ga0207641_10184377
668 Ga0207648_10063998
669 Ga0207676_10000453
670 Ga0207676_10076869
671 Ga0207676_10251720
672 Ga0207675_100054172
673 Ga0207675_100096651
674 Ga0207675_100135936
675 Ga0207683_10063706
676 Ga0207698_10026389
677 Ga0207698_10246277
678 Ga0209281_1000104
679 Ga0209371_1010344
680 Ga0209969_1009871
681 Ga0209995_1001845
682 Ga0209968_1003707
683 Ga0209970_1000507
684 Ga0209983_1002261
685 Ga0209966_1001408
686 Ga0209974_10001561
687 Ga0209974_10010175
688 Ga0268266_10049171
689 Ga0268265_10034016
690 Ga0268256_1010656
691 Ga0316177_1014409
692 Ga0314311_1073099
693 Ga0316178_1052160
694 Ga0316180_1060727
695 Ga0316181_1164487
696 Ga0316182_1166823
697 Ga0265760_10031859
698 Ga0307408_100004825
699 Ga0307408_100041232
700 Ga0307408_100075171
701 Ga0307408_100228062
702 Ga0307405_10001413
703 Ga0307413_10012313
704 Ga0307410_10012649
705 Ga0307406_10000689
706 Ga0307406_10005939
707 Ga0307412_10000106
708 Ga0307412_10004832
709 Ga0307409_100018299
710 Ga0307416_100040546
711 Ga0307414_10048259
712 Ga0307411_10022114
713 Ga0307415_100021137
714 Ga0307510_10037495
715 Ga0373923_0005608
716 Ga0373954_0003159
717 Ga0373956_0016609
718 Ga0373946_0013795
719 Ga0373955_0001386
720 Ga0316574_0002857
721 Ga0373924_0010132
722 Ga0373935_0022754
723 Ga0373927_0057904
724 Ga0373933_0005542
725 Ga0373937_0002028
726 Ga0373937_0088349
727 Ga0373937_0151730
728 Ga0373925_0024184
729 Ga0373925_0157331
730 Ga0373925_0275735
731 Ga0436364_0195675
732 Ga0451807_1918916
733 Ga0450911_000322
734 Ga0451576_0258790
735 Ga0495592_0103981
736 Ga0495629_0002190
737 Ga0495638_0172116
738 Ga0495641_0039006
739 Ga0495651_0001006
740 Ga0495653_0011823
741 Ga0495582_0086577
742 Ga0495662_0072540
743 Ga0495664_0003228
744 Ga0495607_0000468
745 Ga0495608_0004042
746 Ga0495618_0000741
747 Ga0495654_0003050
748 Ga0495640_0005375
749 Ga0495586_0003565
750 Ga0495621_0034949
751 Ga0495621_0036317
752 Ga0495645_0076077
753 Ga0495667_0000654
754 Ga0495656_0000176
755 Ga0495634_0004062
756 Ga0495625_0002799
757 Ga0495635_0003108
758 Ga0495657_0010768
759 Ga0495623_0005708
760 Ga0495646_0001331
761 Ga0495658_0009649
762 Ga0495658_0141609
763 Ga0495613_0335844
764 Ga0495624_0009016
765 Ga0495600_0027570
766 Ga0495581_0224721
767 Ga0495604_0001231
768 Ga0495674_0002137
769 Ga0495680_0002906
770 Ga0495687_006653
771 Ga0495675_0017647
772 Ga0495684_0002299
773 Ga0495602_0011794
774 Ga0495615_0007864
775 Ga0495615_0008656
776 Ga0496102_0064195
777 Ga0496102_0372928
778 Ga0496103_0048741
779 Ga0496104_0068141
780 Ga0496105_0139402
781 Ga0496108_0175913
782 Ga0496109_0421429
783 Ga0496110_0087967
784 Ga0496110_0299077
785 Ga0496114_0007110
786 Ga0496114_0128126
787 Ga0496116_0010215
788 Ga0496116_0015566
789 Ga0496116_0041832
790 Ga0496118_0009498
791 Ga0496120_0003586
792 Ga0496121_0000165
793 Ga0496121_0003822
794 Ga0496121_0004161
795 Ga0496121_0013484
796 Ga0496121_0016988
797 Ga0496121_0085333
798 Ga0496122_0000618
799 Ga0496122_0000936
800 Ga0496122_0001626
801 Ga0496122_0144006
802 Ga0496123_0001075
803 Ga0496123_0001275
804 Ga0496123_0001319
805 Ga0496124_0000046
806 Ga0496124_0055511
807 Ga0496124_0084004
808 Ga0496124_0112734
809 Ga0496125_0000121
810 Ga0496125_0002327
811 Ga0501039_0020589
812 Ga0501040_0025479
813 Ga0501041_0007764
814 Ga0501042_0016216
815 Ga0501046_0063123
816 Ga0501069_0041582
817 Ga0501071_0089139
818 Ga0501072_0034096
819 Ga0501075_0084581
820 Ga0501076_0053398
821 Ga0501225_0004004
822 Ga0501081_0011654
823 Ga0501262_000429
824 Ga0501045_0002422
825 nmdc:mga0yw44_109886_c1
826 nmdc:mga0yw44_12493_c1
827 nmdc:mga0n895_8462_c1
828 nmdc:mga08x19_7794_c1
829 Ga0495601_0014875
830 Ga0495601_0048126
831 Ga0495612_0005438
832 Ga0495595_0005927
833 Ga0495619_0049364
834 Ga0500562_002948
835 Ga0500593_043661
836 Ga0500618_000716
837 Ga0500618_000823
838 Ga0500559_0003326
839 Ga0500637_0118115
840 Ga0501084_0045106
841 Ga0501082_0013050
842 Ga0530510_0002791
843 2509152683
844 2511384283
845 2521559702
846 2574432084
847 2599904323
848 2643863731
849 2643982934
850 2644057885
851 2644072921
852 2644123225
853 2738719510
854 2739242161
855 2739248112
856 2739283668
857 2765570960
858 2808984867
859 2809033524
860 2809128273
861 2809147894
862 2816470222
863 2819616075
864 2839099349
865 2842681310
866 2842720437
867 2842738841
868 2852620694
869 2855732899
870 2855771651
871 2857537976
872 2857546545
873 2881103912
874 2881413796
875 2884815356
876 2884841088
877 2884855963
878 2896157112
879 2904443339
880 2904481437
881 2904533048
882 2904585603
883 2904593952
884 2904603895
885 2919047604
886 2919081867
887 2919464647
888 2919708644
889 2929526697
890 2941484217
891 2954770245
892 2974321382

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13458

Peripla_BP_6

Periplasmic binding protein

63

404

0.9

PF13433

Peripla_BP_5

Periplasmic binding protein domain

64

392

0.78

PF01094

ANF_receptor

Receptor family ligand binding region

83

407

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n0q-assembly1.cif.gz_A crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic) 0.8792 15 374
4mlc-assembly1.cif.gz_A abc transporter substrate-binding protein fromdesulfitobacterium hafniense 0.8786 14 374
4n0q-assembly1.cif.gz_A crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic) 0.8745 15 374
4mlc-assembly1.cif.gz_A abc transporter substrate-binding protein fromdesulfitobacterium hafniense 0.8738 14 374
4q6w-assembly1.cif.gz_A crystal structure of periplasmic binding protein type 1 from bordetella pertussis tohama i complexed with 3-hydroxy benzoic acid 0.8736 16 375
ID Description Score Start End Superfamily
af_A0A0R0JFH4_66_156_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9219 56 137 3.40.50.2300
af_Q69L07_59_152_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9198 56 132 3.40.50.2300
af_A0A0R0GSR6_1_159_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9014 14 112 3.40.50.2300
af_P55205_42_169_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9009 13 111 3.40.50.2300
3i45A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9009 16 354 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2V7FVW6-F1-model_v4 Ethanolamine utilization protein EutN 0.958 99 374
AF-A0A847ZN37-F1-model_v4 deleted 0.9542 16 148
AF-A0A661RT29-F1-model_v4 Leucine-binding protein domain-containing protein 0.9481 15 151
AF-A0A6B3IFG0-F1-model_v4 ABC transporter substrate-binding protein 0.9479 14 115
AF-A0A2V6S585-F1-model_v4 ABC transporter substrate-binding protein 0.9464 14 116 GO:0006865

Map