F445781

General Info

Members Datasets Scaffolds Average Seq Length
446 312 892 248

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0152794|Ga0451576_0152794_489_1328
Length 279
Sequence MGANSLEYDQEFGGRVGVEISGRIGKMTEKKTVLITGAGGGIGRACVQHFSKKGWRVIGVDRSDFGDDFPKDGRFIQADISHPDSAEEIFKHARGFTSTLDALVNNAAVQVAKPLVETTVEEWDAVMASNLRSVFLFVKLAHPLMKAAGSGAIVNVSSVHAIQTSANIAAYAASKGGLLALTRAMAIEFAADNIRANAILPGAVDTPMLRAGLSRGHVGGSDMQERLDNLAKKTVNGKVGRPEEIASAVYFLADNEQSSFMTGQALVVDGGATARLSTE

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
57 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
58 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
59 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
60 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
87 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
101 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
102 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
107 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
108 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
109 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
110 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
111 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
112 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
113 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
114 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
119 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
120 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
121 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
122 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
123 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
124 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
125 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
126 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
127 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
128 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
129 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
130 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
131 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
132 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
133 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
134 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
135 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
136 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
137 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
138 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
139 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
140 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
141 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
150 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
151 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
152 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
153 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
154 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
155 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
156 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
160 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
161 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
162 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
163 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
169 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
170 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
171 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
174 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
175 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
176 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
177 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
178 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
179 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
180 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
181 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
182 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
183 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
184 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
185 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
186 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
187 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
188 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
189 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
190 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
191 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
192 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
193 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
194 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
195 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
196 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
197 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
198 2643221582 Rhizobium sp. Root651 Isolate Unclassified
199 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
200 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
201 2643221723 Ensifer sp. Root278 Isolate Unclassified
202 2718218365 Rhizobium sp. N731 Isolate Nodule
203 2728369397 Rhizobium sp. N1314 Isolate Nodule
204 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
205 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
206 2773857925 Microvirga vignae BR3299 Isolate Unclassified
207 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
208 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
209 2791355261 Rhizobium sp. J15 Isolate Nodule
210 2791355265 Rhizobium sp. H4 Isolate Nodule
211 2791355266 Rhizobium sp. L43 Isolate Nodule
212 2802429633 Rhizobium anhuiense J3 Isolate Nodule
213 2802429634 Rhizobium anhuiense S10 Isolate Nodule
214 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
215 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
216 2802429637 Rhizobium anhuiense C15 Isolate Nodule
217 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
218 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
219 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
220 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
221 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
222 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
223 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
224 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
225 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
226 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
227 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
228 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
229 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
230 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
231 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
232 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
233 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
234 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
235 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
236 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
237 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
238 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
239 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
240 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
241 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
242 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
243 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
244 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
245 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
246 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
247 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
248 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
249 2936381700 Rhizobium chutanense C16 Isolate Unclassified
250 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
251 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
252 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
253 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
254 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
255 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
256 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
257 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
258 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
259 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
260 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
261 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
262 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
263 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
264 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
265 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
266 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
267 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
268 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
269 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
270 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
271 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
272 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
273 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
274 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
275 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
276 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
277 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
278 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
279 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
280 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
281 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
282 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
283 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
284 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
285 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
286 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
287 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
288 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
289 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
290 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
291 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
292 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
293 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
294 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
295 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
296 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
297 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
298 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
299 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
300 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
301 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
302 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
303 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
304 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
305 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
306 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
307 8005395548 Rhizobium sp. R339 Isolate Nodule
308 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
309 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
310 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
311 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
312 8056375014 Rhizobium redzepovicii 18T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 68.39
Metatranscriptomes 0
Isolates 31.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.31
Nodule 27.58
Rhizoplane 2.02
Rhizosphere 52.69
Stem 0
Stem Tuber 0
Unclassified 5.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0152794 3300045051 Unclassified 2407
2 SwRhRL2b_contig_134543 2162886007 Bacteria 3387
3 SwRhRL2b_contig_3384074 2162886007 Bacteria 3300
4 JGI25165J46597_1000276 3300003214 Bacteria 66076
5 JGI25153J46596_10002963 3300003215 Bacteria 9618
6 rootH2_10150611 3300003320 Bacteria 5362
7 Ga0055524_1001595 3300003775 Bacteria 12719
8 Ga0055536_1039835 3300003781 Bacteria 1124
9 Ga0055528_1000496 3300003790 Bacteria 31066
10 Ga0055540_1000077 3300003792 Bacteria 114283
11 Ga0055540_1000095 3300003792 Bacteria 97555
12 Ga0055531_10001938 3300003794 Bacteria 14455
13 Ga0055531_10006174 3300003794 Bacteria 6851
14 Ga0065704_10000545 3300005289 Bacteria 21648
15 Ga0065704_10096964 3300005289 Bacteria 2415
16 Ga0065707_10003358 3300005295 Bacteria 4001
17 Ga0065707_10082082 3300005295 Bacteria 22476
18 Ga0065707_10086992 3300005295 Bacteria 5213
19 Ga0065707_10093019 3300005295 Unclassified 3686
20 Ga0070658_10087523 3300005327 Unclassified 2564
21 Ga0070680_100651903 3300005336 Unclassified 905
22 Ga0070689_100003812 3300005340 Bacteria 10101
23 Ga0070689_100314317 3300005340 Bacteria 1307
24 Ga0070668_100159273 3300005347 Bacteria 1831
25 Ga0070705_100068880 3300005440 Bacteria 2131
26 Ga0070705_100097430 3300005440 Unclassified 1849
27 Ga0070700_100012627 3300005441 Bacteria 4722
28 Ga0070694_100017812 3300005444 Bacteria 4493
29 Ga0070694_100094885 3300005444 Unclassified 2100
30 Ga0070694_100147937 3300005444 Bacteria 1712
31 Ga0070707_100132121 3300005468 Bacteria 2428
32 Ga0070698_100033902 3300005471 Bacteria 5288
33 Ga0070699_100012037 3300005518 Bacteria 7469
34 Ga0070699_100027856 3300005518 Unclassified 4873
35 Ga0070699_100221165 3300005518 Bacteria 1687
36 Ga0070697_100100273 3300005536 Bacteria 2405
37 Ga0070697_100246415 3300005536 Bacteria 1527
38 Ga0070697_100314105 3300005536 Bacteria 1349
39 Ga0070686_100073194 3300005544 Bacteria 2249
40 Ga0070696_100670418 3300005546 Unclassified 843
41 Ga0070704_100142614 3300005549 Bacteria 1873
42 Ga0068855_100004220 3300005563 Bacteria 17542
43 Ga0068857_100144797 3300005577 Bacteria 2150
44 Ga0068859_100036786 3300005617 Bacteria 4914
45 Ga0068859_100064405 3300005617 Bacteria 3698
46 Ga0068859_100116523 3300005617 Bacteria 2736
47 Ga0068859_100552625 3300005617 Bacteria 1246
48 Ga0068858_100001349 3300005842 Bacteria 25309
49 Ga0068860_100021029 3300005843 Bacteria 6321
50 Ga0068862_100061656 3300005844 Bacteria 3224
51 Ga0068862_100321822 3300005844 Bacteria 1428
52 Ga0081539_10000859 3300005985 Bacteria 58193
53 Ga0081539_10005055 3300005985 Bacteria 13849
54 Ga0075365_10225182 3300006038 Bacteria 1316
55 Ga0075362_10000763 3300006177 Bacteria 9576
56 Ga0075367_10023659 3300006178 Bacteria 3459
57 Ga0075369_10000669 3300006186 Bacteria 10916
58 Ga0075366_10001056 3300006195 Bacteria 13511
59 Ga0075370_10172522 3300006353 Bacteria 1271
60 Ga0075428_100078235 3300006844 Bacteria 3610
61 Ga0075428_100098958 3300006844 Unclassified 3180
62 Ga0075428_100220064 3300006844 Bacteria 2050
63 Ga0075428_100359003 3300006844 Bacteria 1563
64 Ga0075430_100291467 3300006846 Bacteria 1350
65 Ga0075430_100361033 3300006846 Bacteria 1199
66 Ga0075431_100217804 3300006847 Bacteria 1948
67 Ga0075431_100657262 3300006847 Unclassified 1028
68 Ga0075434_100027694 3300006871 Bacteria 5565
69 Ga0075429_100008920 3300006880 Bacteria 8716
70 Ga0075429_100027464 3300006880 Unclassified 4941
71 Ga0075429_100172171 3300006880 Bacteria 1896
72 Ga0075429_100256034 3300006880 Bacteria 1532
73 Ga0097620_100036784 3300006931 Bacteria 4914
74 Ga0097620_100064405 3300006931 Bacteria 3698
75 Ga0097620_100116516 3300006931 Bacteria 2736
76 Ga0097620_100552632 3300006931 Bacteria 1246
77 Ga0105251_10000038 3300009011 Bacteria 116060
78 Ga0105240_10014809 3300009093 Bacteria 10629
79 Ga0105240_10128732 3300009093 Bacteria 3039
80 Ga0105240_10314520 3300009093 Unclassified 1787
81 Ga0111539_10092543 3300009094 Bacteria 3553
82 Ga0111539_10501965 3300009094 Bacteria 1413
83 Ga0114129_10001366 3300009147 Bacteria 32807
84 Ga0114129_10009931 3300009147 Bacteria 13567
85 Ga0114129_10015137 3300009147 Bacteria 10979
86 Ga0114129_10494722 3300009147 Bacteria 1598
87 Ga0105243_10263093 3300009148 Bacteria 1545
88 Ga0105248_10036537 3300009177 Bacteria 5495
89 Ga0105237_10004469 3300009545 Bacteria 16167
90 Ga0105239_10000524 3300010375 Bacteria 55447
91 Ga0157371_10391092 3300013102 Bacteria 1016
92 Ga0157378_10285884 3300013297 Bacteria 1591
93 Ga0209437_100023 3300025233 Bacteria 614195
94 Ga0207425_1002543 3300025245 Bacteria 6352
95 Ga0209129_1000917 3300025258 Bacteria 18018
96 Ga0209233_1000062 3300025261 Bacteria 399685
97 Ga0209673_1000294 3300025273 Bacteria 93050
98 Ga0209673_1000921 3300025273 Bacteria 37249
99 Ga0209676_1001179 3300025292 Bacteria 28285
100 Ga0209676_1002471 3300025292 Bacteria 13041
101 Ga0209676_1031254 3300025292 Bacteria 1618
102 Ga0209025_1000260 3300025294 Bacteria 124240
103 Ga0209025_1001911 3300025294 Bacteria 24216
104 Ga0209564_1000341 3300025295 Bacteria 89262
105 Ga0209564_1001129 3300025295 Bacteria 31419
106 Ga0209758_1001982 3300025297 Bacteria 22133
107 Ga0209050_1009398 3300025298 Bacteria 5011
108 Ga0209256_1000719 3300025299 Bacteria 43868
109 Ga0209256_1003376 3300025299 Bacteria 11297
110 Ga0207426_1001199 3300025302 Bacteria 23041
111 Ga0209051_1000027 3300025303 Bacteria 412172
112 Ga0209051_1000534 3300025303 Bacteria 46804
113 Ga0209257_1000245 3300025304 Bacteria 125987
114 Ga0209257_1000599 3300025304 Bacteria 59865
115 Ga0209257_1015356 3300025304 Bacteria 3195
116 Ga0207655_1012261 3300025728 Bacteria 5026
117 Ga0207713_1000185 3300025735 Bacteria 88697
118 Ga0207695_10224810 3300025913 Unclassified 1783
119 Ga0207671_10005075 3300025914 Bacteria 12297
120 Ga0207662_10063825 3300025918 Unclassified 2215
121 Ga0207662_10261560 3300025918 Bacteria 1139
122 Ga0207694_10330809 3300025924 Bacteria 1259
123 Ga0207670_10035859 3300025936 Bacteria 3221
124 Ga0207667_10007813 3300025949 Bacteria 12784
125 Ga0207640_10036504 3300025981 Bacteria 3086
126 Ga0207677_10695519 3300026023 Bacteria 902
127 Ga0207703_10001781 3300026035 Bacteria 19226
128 Ga0207708_10025007 3300026075 Bacteria 4517
129 Ga0268265_10039773 3300028380 Bacteria 3468
130 Ga0268265_10129323 3300028380 Bacteria 2096
131 Ga0268265_10269229 3300028380 Bacteria 1519
132 Ga0268264_10045555 3300028381 Unclassified 3641
133 Ga0265320_10172407 3300031240 Bacteria 972
134 Ga0307408_100526194 3300031548 Bacteria 1039
135 Ga0307408_100669895 3300031548 Bacteria 929
136 Ga0307408_100701813 3300031548 Bacteria 909
137 Ga0316575_10030218 3300031665 Bacteria 2117
138 Ga0316579_10037271 3300031691 Bacteria 2246
139 Ga0307405_10007380 3300031731 Bacteria 5492
140 Ga0307405_10288282 3300031731 Bacteria 1239
141 Ga0316577_10014388 3300031733 Bacteria 4342
142 Ga0307413_10155014 3300031824 Bacteria 1601
143 Ga0307413_10256614 3300031824 Bacteria 1300
144 Ga0307410_10036117 3300031852 Bacteria 3214
145 Ga0307410_10040220 3300031852 Bacteria 3076
146 Ga0307410_10227382 3300031852 Bacteria 1438
147 Ga0307410_10249059 3300031852 Bacteria 1380
148 Ga0307410_10313642 3300031852 Bacteria 1242
149 Ga0307406_10026720 3300031901 Bacteria 3470
150 Ga0307407_10059866 3300031903 Bacteria 2220
151 Ga0307407_10360166 3300031903 Bacteria 1032
152 Ga0307412_10011597 3300031911 Bacteria 5110
153 Ga0307409_100076039 3300031995 Bacteria 2691
154 Ga0307409_100760698 3300031995 Bacteria 973
155 Ga0307416_100102310 3300032002 Bacteria 2497
156 Ga0307416_100190254 3300032002 Bacteria 1934
157 Ga0307416_100383972 3300032002 Bacteria 1436
158 Ga0307414_10096947 3300032004 Bacteria 2208
159 Ga0307414_10305458 3300032004 Bacteria 1348
160 Ga0307414_10451235 3300032004 Bacteria 1128
161 Ga0307411_10082549 3300032005 Bacteria 2217
162 Ga0307411_10248149 3300032005 Bacteria 1398
163 Ga0307415_100055017 3300032126 Bacteria 2720
164 Ga0307415_100055974 3300032126 Bacteria 2702
165 Ga0316585_10090239 3300032137 Bacteria 1001
166 Ga0316582_0029866 3300036647 Bacteria 3314
167 Ga0316582_0250420 3300036647 Bacteria 1214
168 Ga0316584_0006146 3300036712 Archaea 8123
169 Ga0316584_0024133 3300036712 Bacteria 4448
170 Ga0316584_0087737 3300036712 Archaea 2329
171 Ga0316584_0217616 3300036712 Bacteria 1404
172 Ga0395900_0344698 3300037418 Bacteria 1464
173 Ga0395898_0064324 3300037466 Bacteria 3557
174 Ga0395898_0195577 3300037466 Unclassified 1932
175 Ga0395905_0006922 3300037471 Bacteria 11333
176 Ga0316581_0020351 3300037588 Bacteria 1943
177 Ga0436363_1345356 3300039450 Bacteria 833
178 Ga0451800_0401769 3300041459 Bacteria 1838
179 Ga0451833_0068607 3300041491 Bacteria 1438
180 Ga0451837_0730833 3300041494 Bacteria 2983
181 Ga0451841_0461209 3300041498 Bacteria 2636
182 Ga0451845_0024217 3300041501 Bacteria 4537
183 Ga0451851_0778015 3300041507 Bacteria 4382
184 Ga0451843_0169011 3300041509 Bacteria 1498
185 Ga0451843_0980372 3300041509 Bacteria 1426
186 Ga0451577_0008588 3300042876 Bacteria 9932
187 Ga0451577_0037050 3300042876 Unclassified 4391
188 Ga0451577_0043839 3300042876 Bacteria 4005
189 Ga0451577_0052914 3300042876 Bacteria 3626
190 Ga0451577_0102919 3300042876 Bacteria 2552
191 Ga0451577_0285800 3300042876 Bacteria 1494
192 Ga0451577_0340988 3300042876 Bacteria 1359
193 Ga0451577_0349805 3300042876 Unclassified 1341
194 Ga0451577_0582793 3300042876 Bacteria 1015
195 Ga0453683_0000731 3300044673 Bacteria 33613
196 Ga0453683_0001275 3300044673 Bacteria 22350
197 Ga0453683_0004127 3300044673 Bacteria 10428
198 Ga0453683_0118160 3300044673 Unclassified 1669
199 Ga0453683_0250853 3300044673 Bacteria 1128
200 Ga0453684_0000012 3300044712 Bacteria 1062512
201 Ga0453684_0000535 3300044712 Bacteria 144635
202 Ga0453684_0000718 3300044712 Bacteria 117108
203 Ga0453684_0000899 3300044712 Bacteria 99196
204 Ga0453684_0006997 3300044712 Bacteria 21096
205 Ga0453684_0016234 3300044712 Bacteria 11666
206 Ga0453684_0027195 3300044712 Bacteria 8214
207 Ga0453684_0061771 3300044712 Bacteria 4807
208 Ga0453684_0066141 3300044712 Bacteria 4604
209 Ga0453684_0068091 3300044712 Bacteria 4522
210 Ga0453684_0071752 3300044712 Bacteria 4377
211 Ga0453684_0160712 3300044712 Unclassified 2657
212 Ga0453684_0174199 3300044712 Bacteria 2532
213 Ga0453684_0199929 3300044712 Bacteria 2330
214 Ga0453684_0204800 3300044712 Bacteria 2297
215 Ga0453684_0248049 3300044712 Bacteria 2046
216 Ga0453684_0254828 3300044712 Unclassified 2013
217 Ga0453684_0311960 3300044712 Unclassified 1784
218 Ga0453684_0329279 3300044712 Bacteria 1727
219 Ga0453684_0368163 3300044712 Bacteria 1616
220 Ga0453684_0390480 3300044712 Bacteria 1561
221 Ga0453684_0424347 3300044712 Bacteria 1485
222 Ga0453684_0530212 3300044712 Bacteria 1300
223 Ga0451576_0020715 3300045051 Bacteria 7158
224 Ga0451576_0391019 3300045051 Unclassified 1458
225 Ga0451576_0395779 3300045051 Bacteria 1448
226 Ga0451576_0459988 3300045051 Bacteria 1336
227 Ga0451576_0652283 3300045051 Bacteria 1106
228 Ga0495627_096085 3300046453 Bacteria 849
229 Ga0495591_001339 3300046458 Bacteria 15482
230 Ga0495650_0026464 3300046471 Bacteria 2698
231 Ga0495585_0020079 3300046492 Bacteria 3844
232 Ga0495585_0030037 3300046492 Bacteria 3092
233 Ga0495607_0033131 3300046501 Bacteria 3145
234 Ga0495607_0152217 3300046501 Bacteria 1183
235 Ga0495583_0002791 3300046506 Bacteria 14384
236 Ga0495610_0008138 3300046512 Bacteria 6848
237 Ga0495610_0013890 3300046512 Bacteria 4759
238 Ga0495620_0030659 3300046515 Bacteria 2473
239 Ga0495620_0089485 3300046515 Bacteria 1236
240 Ga0495620_0197598 3300046515 Bacteria 774
241 Ga0495637_0002338 3300046520 Bacteria 10499
242 Ga0495643_0029930 3300046522 Bacteria 3044
243 Ga0495648_0023358 3300046524 Bacteria 4236
244 Ga0495654_0052066 3300046530 Bacteria 1996
245 Ga0495665_0005676 3300046531 Bacteria 6733
246 Ga0495609_0000961 3300046538 Bacteria 20682
247 Ga0495668_0000079 3300046616 Bacteria 157703
248 Ga0495668_0045850 3300046616 Bacteria 2430
249 Ga0495625_0003332 3300046660 Bacteria 16170
250 Ga0495625_0005428 3300046660 Bacteria 11638
251 Ga0495625_0193921 3300046660 Bacteria 1344
252 Ga0495661_0198514 3300046665 Bacteria 1052
253 Ga0495588_0000638 3300046674 Bacteria 16289
254 Ga0495588_0133676 3300046674 Bacteria 1309
255 Ga0495670_0028488 3300046691 Bacteria 2769
256 Ga0495660_0062799 3300046810 Bacteria 1990
257 Ga0495660_0251400 3300046810 Bacteria 820
258 Ga0495581_0001699 3300047315 Bacteria 12258
259 Ga0495687_052451 3300047443 Bacteria 1724
260 Ga0495679_059944 3300047446 Bacteria 1118
261 Ga0495681_0007910 3300047470 Bacteria 6721
262 Ga0495686_0049022 3300047472 Bacteria 2660
263 Ga0496102_0324853 3300048905 Bacteria 1449
264 Ga0496105_0273813 3300048908 Bacteria 1363
265 Ga0496110_0146880 3300048913 Bacteria 2133
266 Ga0496111_0084282 3300048914 Bacteria 2323
267 Ga0496111_0172790 3300048914 Bacteria 1606
268 Ga0496113_0010874 3300048916 Bacteria 6038
269 Ga0496115_0012469 3300048918 Bacteria 6398
270 Ga0496115_0397575 3300048918 Bacteria 1119
271 Ga0496117_0100737 3300048920 Bacteria 1829
272 Ga0496119_0091224 3300048922 Bacteria 1731
273 Ga0496121_0000078 3300048924 Bacteria 233455
274 Ga0496121_0000293 3300048924 Bacteria 103372
275 Ga0496121_0009631 3300048924 Bacteria 11067
276 Ga0496122_0000244 3300048925 Bacteria 122107
277 Ga0496122_0074815 3300048925 Bacteria 2393
278 Ga0496123_0000201 3300048926 Bacteria 121915
279 Ga0496123_0031727 3300048926 Bacteria 3838
280 Ga0496125_0041715 3300048928 Bacteria 3920
281 Ga0496126_0012733 3300048929 Bacteria 8598
282 Ga0496126_0022079 3300048929 Bacteria 6200
283 Ga0501292_019870 3300049515 Bacteria 1078
284 Ga0501038_0051386 3300049574 Bacteria 3557
285 Ga0501043_0010826 3300049579 Bacteria 7141
286 Ga0501075_0280091 3300049591 Bacteria 1271
287 Ga0501076_0529777 3300049592 Bacteria 971
288 nmdc:mga0yw44_281254_c1 3300050492 Bacteria 1112
289 nmdc:mga0yw44_404903_c1 3300050492 Bacteria 923
290 nmdc:mga0k408_333929_c1 3300050493 Bacteria 904
291 nmdc:mga06z11_4618_c1 3300050494 Bacteria 5432
292 nmdc:mga05p37_130947_c1 3300050507 Unclassified 3078
293 nmdc:mga05p37_937_c1 3300050507 Bacteria 32838
294 nmdc:mga09592_141429_c1 3300050508 Bacteria 2075
295 nmdc:mga09592_2099_c1 3300050508 Bacteria 16089
296 nmdc:mga09592_33667_c1 3300050508 Unclassified 4279
297 nmdc:mga0qj67_270980_c1 3300050509 Bacteria 1376
298 nmdc:mga06r32_155001_c1 3300050510 Bacteria 2271
299 nmdc:mga06r32_726507_c1 3300050510 Unclassified 957
300 nmdc:mga06r32_812527_c1 3300050510 Bacteria 895
301 Ga0500610_0123346 3300053079 Bacteria 1323
302 Ga0500560_030948 3300053107 Bacteria 1617
303 Ga0500569_035620 3300053109 Bacteria 1428
304 Ga0500658_0026698 3300053134 Bacteria 2227
305 Ga0501084_0272388 3300054114 Bacteria 1429
306 2509391284 2509276021 Bacteria 7634384
307 2509445469 2509276033 Bacteria 7180565
308 2510892565 2510461076 Bacteria 8618824
309 2511499497 2511231052 Bacteria 6974333
310 2513568323 2513237084 Bacteria 7231967
311 2513586229 2513237086 Bacteria 7265287
312 2513634771 2513237093 Bacteria 7545552
313 2514018562 2513237162 Bacteria 7468464
314 2524612327 2524023250 Bacteria 5457705
315 2551676110 2551306084 Bacteria 8942552
316 2551683919 2551306085 Bacteria 7347181
317 2551693263 2551306086 Bacteria 6843938
318 2551701924 2551306087 Bacteria 7351905
319 2551721483 2551306090 Bacteria 7953713
320 2551732165 2551306092 Bacteria 6992595
321 2551739674 2551306093 Bacteria 7064773
322 2585270140 2582581306 Bacteria 6450535
323 2585391215 2582581865 Bacteria 6644329
324 2585397924 2582581866 Bacteria 6859583
325 2585541723 2585427528 Bacteria 6842387
326 2585840058 2585427593 Bacteria 7141551
327 2585902479 2585427608 Bacteria 6544331
328 2599416154 2599185170 Bacteria 7295545
329 2616294931 2615840624 Bacteria 6557588
330 2617384093 2617270742 Bacteria 6808054
331 2643918419 2643221582 Bacteria 5804683
332 2644194474 2643221634 Bacteria 6705461
333 2644200477 2643221636 Bacteria 6583769
334 2644672373 2643221723 Bacteria 7095460
335 2721156121 2718218365 Bacteria 6274507
336 2730295654 2728369397 Bacteria 6274511
337 2739036337 2738541333 Bacteria 7106503
338 2739790689 2739367756 Bacteria 4553612
339 2774872463 2773857925 Bacteria 6472445
340 2778176599 2775507266 Bacteria 7392367
341 2793317418 2791355259 Bacteria 7254731
342 2793327987 2791355261 Bacteria 6661293
343 2793354513 2791355265 Bacteria 6539969
344 2793362360 2791355266 Bacteria 7116587
345 2806046440 2802429633 Bacteria 7341974
346 2806053024 2802429634 Bacteria 7083200
347 2806059768 2802429635 Bacteria 7650140
348 2806068494 2802429636 Bacteria 7597525
349 2806074916 2802429637 Bacteria 7067217
350 2808828815 2808606357 Bacteria 4466944
351 2838027428 2838022645 Bacteria 6494267
352 2841868591 2841864319 Bacteria 6742987
353 2842202968 2842198810 Bacteria 6608673
354 2842303049 2842298080 Bacteria 6123127
355 2842342540 2842341865 Bacteria 7003929
356 2842361543 2842357229 Bacteria 6485165
357 2842365687 2842363717 Bacteria 6844742
358 2842487394 2842482326 Bacteria 7212537
359 2842513556 2842509118 Bacteria 6850950
360 2855830287 2855825444 Bacteria 6785811
361 2855845935 2855839649 Bacteria 7135830
362 2915995868 2915993759 Bacteria 7016183
363 2916012831 2916007675 Bacteria 6898660
364 2916017682 2916014648 Bacteria 6946486
365 2916031359 2916028427 Bacteria 6748433
366 2916058098 2916055098 Bacteria 6758838
367 2916071670 2916068649 Bacteria 6943657
368 2921206825 2921201388 Bacteria 6926299
369 2921239181 2921237296 Bacteria 6876710
370 2921266811 2921263974 Bacteria 6864552
371 2921293904 2921289301 Bacteria 7316391
372 2921303169 2921296804 Bacteria 7176999
373 2923560448 2923556063 Bacteria 6793593
374 2924155609 2924150972 Bacteria 7169444
375 2924162929 2924158325 Bacteria 7188855
376 2924169614 2924165586 Bacteria 7260590
377 2924175579 2924172951 Bacteria 6749356
378 2924190055 2924186466 Bacteria 6876637
379 2924220385 2924214083 Bacteria 7080103
380 2924224564 2924221636 Bacteria 7113495
381 2924233311 2924228884 Bacteria 6633132
382 2936383190 2936381700 Bacteria 7006523
383 2937006558 2937002841 Bacteria 6934057
384 2937043081 2937042894 Bacteria 6741576
385 2937055856 2937049772 Bacteria 6757901
386 2937061245 2937056579 Bacteria 7107896
387 2937072515 2937071275 Bacteria 6984483
388 2937096259 2937091812 Bacteria 6979387
389 2937103877 2937098957 Bacteria 7249374
390 2937110453 2937106411 Bacteria 6947143
391 2937132811 2937126314 Bacteria 6771275
392 2957428787 2957422303 Bacteria 7172205
393 2957436230 2957430029 Bacteria 7022557
394 2957458292 2957457609 Bacteria 6967680
395 2957474977 2957471148 Bacteria 6797643
396 2957480820 2957478035 Bacteria 6756658
397 2957485181 2957484790 Bacteria 6703082
398 2957503158 2957498199 Bacteria 7126688
399 2957509534 2957505466 Bacteria 7253085
400 2960608205 2960603979 Bacteria 6898737
401 2960627507 2960624210 Bacteria 6875384
402 2960644963 2960637947 Bacteria 7296468
403 2960649319 2960645483 Bacteria 7211087
404 2960656454 2960652885 Bacteria 7083688
405 2964612642 2964607997 Bacteria 7101408
406 2964633448 2964628898 Bacteria 7083044
407 2964654220 2964649959 Bacteria 6675118
408 2964661354 2964656573 Bacteria 7100150
409 2964683984 2964678106 Bacteria 6792020
410 2964726381 2964719344 Bacteria 7286602
411 2967670903 2967664464 Bacteria 6948836
412 2967683582 2967678726 Bacteria 7264382
413 2967695856 2967693043 Bacteria 6804451
414 2967708752 2967706974 Bacteria 7186053
415 2967719142 2967714385 Bacteria 7000047
416 2967725620 2967721400 Bacteria 7073753
417 2967739096 2967735183 Bacteria 6827012
418 2967763042 2967762386 Bacteria 6923502
419 2967777434 2967775926 Bacteria 6738189
420 2970026301 2970019648 Bacteria 7072033
421 2970043105 2970040964 Bacteria 6731123
422 2970047749 2970047711 Bacteria 7088379
423 2970058122 2970054988 Bacteria 6611507
424 2970066062 2970061556 Bacteria 7099761
425 2970092970 2970088815 Bacteria 6933825
426 2970114860 2970109326 Bacteria 6863976
427 2970117488 2970116247 Bacteria 6501857
428 2970132350 2970129317 Bacteria 6806560
429 2970139477 2970136068 Bacteria 7207982
430 2970150941 2970149975 Bacteria 6779706
431 2970168028 2970164137 Bacteria 6861252
432 2970174599 2970170962 Bacteria 6876229
433 2970189098 2970184632 Bacteria 7054431
434 2970195510 2970191845 Bacteria 7032787
435 2977542130 2977537788 Bacteria 6929320
436 2977556602 2977551784 Bacteria 7125765
437 2977575829 2977572785 Bacteria 6763888
438 2977581913 2977579622 Bacteria 6772100
439 8005380056 8005376324 Bacteria 6590079
440 8005380250 8005376324 Bacteria 6590079
441 8005398589 8005395548 Bacteria 6806915
442 8005563502 8005556819 Bacteria 6908598
443 8005565281 8005563573 Bacteria 7153261
444 8005572445 8005570704 Bacteria 6957481
445 8018168686 8018163183 Bacteria 7277977
446 8056377664 8056375014 Bacteria 7006639
447 Ga0451576_0152794
448 SwRhRL2b_contig_134543
449 SwRhRL2b_contig_3384074
450 JGI25165J46597_1000276
451 JGI25153J46596_10002963
452 rootH2_10150611
453 Ga0055524_1001595
454 Ga0055536_1039835
455 Ga0055528_1000496
456 Ga0055540_1000077
457 Ga0055540_1000095
458 Ga0055531_10001938
459 Ga0055531_10006174
460 Ga0065704_10000545
461 Ga0065704_10096964
462 Ga0065707_10003358
463 Ga0065707_10082082
464 Ga0065707_10086992
465 Ga0065707_10093019
466 Ga0070658_10087523
467 Ga0070680_100651903
468 Ga0070689_100003812
469 Ga0070689_100314317
470 Ga0070668_100159273
471 Ga0070705_100068880
472 Ga0070705_100097430
473 Ga0070700_100012627
474 Ga0070694_100017812
475 Ga0070694_100094885
476 Ga0070694_100147937
477 Ga0070707_100132121
478 Ga0070698_100033902
479 Ga0070699_100012037
480 Ga0070699_100027856
481 Ga0070699_100221165
482 Ga0070697_100100273
483 Ga0070697_100246415
484 Ga0070697_100314105
485 Ga0070686_100073194
486 Ga0070696_100670418
487 Ga0070704_100142614
488 Ga0068855_100004220
489 Ga0068857_100144797
490 Ga0068859_100036786
491 Ga0068859_100064405
492 Ga0068859_100116523
493 Ga0068859_100552625
494 Ga0068858_100001349
495 Ga0068860_100021029
496 Ga0068862_100061656
497 Ga0068862_100321822
498 Ga0081539_10000859
499 Ga0081539_10005055
500 Ga0075365_10225182
501 Ga0075362_10000763
502 Ga0075367_10023659
503 Ga0075369_10000669
504 Ga0075366_10001056
505 Ga0075370_10172522
506 Ga0075428_100078235
507 Ga0075428_100098958
508 Ga0075428_100220064
509 Ga0075428_100359003
510 Ga0075430_100291467
511 Ga0075430_100361033
512 Ga0075431_100217804
513 Ga0075431_100657262
514 Ga0075434_100027694
515 Ga0075429_100008920
516 Ga0075429_100027464
517 Ga0075429_100172171
518 Ga0075429_100256034
519 Ga0097620_100036784
520 Ga0097620_100064405
521 Ga0097620_100116516
522 Ga0097620_100552632
523 Ga0105251_10000038
524 Ga0105240_10014809
525 Ga0105240_10128732
526 Ga0105240_10314520
527 Ga0111539_10092543
528 Ga0111539_10501965
529 Ga0114129_10001366
530 Ga0114129_10009931
531 Ga0114129_10015137
532 Ga0114129_10494722
533 Ga0105243_10263093
534 Ga0105248_10036537
535 Ga0105237_10004469
536 Ga0105239_10000524
537 Ga0157371_10391092
538 Ga0157378_10285884
539 Ga0209437_100023
540 Ga0207425_1002543
541 Ga0209129_1000917
542 Ga0209233_1000062
543 Ga0209673_1000294
544 Ga0209673_1000921
545 Ga0209676_1001179
546 Ga0209676_1002471
547 Ga0209676_1031254
548 Ga0209025_1000260
549 Ga0209025_1001911
550 Ga0209564_1000341
551 Ga0209564_1001129
552 Ga0209758_1001982
553 Ga0209050_1009398
554 Ga0209256_1000719
555 Ga0209256_1003376
556 Ga0207426_1001199
557 Ga0209051_1000027
558 Ga0209051_1000534
559 Ga0209257_1000245
560 Ga0209257_1000599
561 Ga0209257_1015356
562 Ga0207655_1012261
563 Ga0207713_1000185
564 Ga0207695_10224810
565 Ga0207671_10005075
566 Ga0207662_10063825
567 Ga0207662_10261560
568 Ga0207694_10330809
569 Ga0207670_10035859
570 Ga0207667_10007813
571 Ga0207640_10036504
572 Ga0207677_10695519
573 Ga0207703_10001781
574 Ga0207708_10025007
575 Ga0268265_10039773
576 Ga0268265_10129323
577 Ga0268265_10269229
578 Ga0268264_10045555
579 Ga0265320_10172407
580 Ga0307408_100526194
581 Ga0307408_100669895
582 Ga0307408_100701813
583 Ga0316575_10030218
584 Ga0316579_10037271
585 Ga0307405_10007380
586 Ga0307405_10288282
587 Ga0316577_10014388
588 Ga0307413_10155014
589 Ga0307413_10256614
590 Ga0307410_10036117
591 Ga0307410_10040220
592 Ga0307410_10227382
593 Ga0307410_10249059
594 Ga0307410_10313642
595 Ga0307406_10026720
596 Ga0307407_10059866
597 Ga0307407_10360166
598 Ga0307412_10011597
599 Ga0307409_100076039
600 Ga0307409_100760698
601 Ga0307416_100102310
602 Ga0307416_100190254
603 Ga0307416_100383972
604 Ga0307414_10096947
605 Ga0307414_10305458
606 Ga0307414_10451235
607 Ga0307411_10082549
608 Ga0307411_10248149
609 Ga0307415_100055017
610 Ga0307415_100055974
611 Ga0316585_10090239
612 Ga0316582_0029866
613 Ga0316582_0250420
614 Ga0316584_0006146
615 Ga0316584_0024133
616 Ga0316584_0087737
617 Ga0316584_0217616
618 Ga0395900_0344698
619 Ga0395898_0064324
620 Ga0395898_0195577
621 Ga0395905_0006922
622 Ga0316581_0020351
623 Ga0436363_1345356
624 Ga0451800_0401769
625 Ga0451833_0068607
626 Ga0451837_0730833
627 Ga0451841_0461209
628 Ga0451845_0024217
629 Ga0451851_0778015
630 Ga0451843_0169011
631 Ga0451843_0980372
632 Ga0451577_0008588
633 Ga0451577_0037050
634 Ga0451577_0043839
635 Ga0451577_0052914
636 Ga0451577_0102919
637 Ga0451577_0285800
638 Ga0451577_0340988
639 Ga0451577_0349805
640 Ga0451577_0582793
641 Ga0453683_0000731
642 Ga0453683_0001275
643 Ga0453683_0004127
644 Ga0453683_0118160
645 Ga0453683_0250853
646 Ga0453684_0000012
647 Ga0453684_0000535
648 Ga0453684_0000718
649 Ga0453684_0000899
650 Ga0453684_0006997
651 Ga0453684_0016234
652 Ga0453684_0027195
653 Ga0453684_0061771
654 Ga0453684_0066141
655 Ga0453684_0068091
656 Ga0453684_0071752
657 Ga0453684_0160712
658 Ga0453684_0174199
659 Ga0453684_0199929
660 Ga0453684_0204800
661 Ga0453684_0248049
662 Ga0453684_0254828
663 Ga0453684_0311960
664 Ga0453684_0329279
665 Ga0453684_0368163
666 Ga0453684_0390480
667 Ga0453684_0424347
668 Ga0453684_0530212
669 Ga0451576_0020715
670 Ga0451576_0391019
671 Ga0451576_0395779
672 Ga0451576_0459988
673 Ga0451576_0652283
674 Ga0495627_096085
675 Ga0495591_001339
676 Ga0495650_0026464
677 Ga0495585_0020079
678 Ga0495585_0030037
679 Ga0495607_0033131
680 Ga0495607_0152217
681 Ga0495583_0002791
682 Ga0495610_0008138
683 Ga0495610_0013890
684 Ga0495620_0030659
685 Ga0495620_0089485
686 Ga0495620_0197598
687 Ga0495637_0002338
688 Ga0495643_0029930
689 Ga0495648_0023358
690 Ga0495654_0052066
691 Ga0495665_0005676
692 Ga0495609_0000961
693 Ga0495668_0000079
694 Ga0495668_0045850
695 Ga0495625_0003332
696 Ga0495625_0005428
697 Ga0495625_0193921
698 Ga0495661_0198514
699 Ga0495588_0000638
700 Ga0495588_0133676
701 Ga0495670_0028488
702 Ga0495660_0062799
703 Ga0495660_0251400
704 Ga0495581_0001699
705 Ga0495687_052451
706 Ga0495679_059944
707 Ga0495681_0007910
708 Ga0495686_0049022
709 Ga0496102_0324853
710 Ga0496105_0273813
711 Ga0496110_0146880
712 Ga0496111_0084282
713 Ga0496111_0172790
714 Ga0496113_0010874
715 Ga0496115_0012469
716 Ga0496115_0397575
717 Ga0496117_0100737
718 Ga0496119_0091224
719 Ga0496121_0000078
720 Ga0496121_0000293
721 Ga0496121_0009631
722 Ga0496122_0000244
723 Ga0496122_0074815
724 Ga0496123_0000201
725 Ga0496123_0031727
726 Ga0496125_0041715
727 Ga0496126_0012733
728 Ga0496126_0022079
729 Ga0501292_019870
730 Ga0501038_0051386
731 Ga0501043_0010826
732 Ga0501075_0280091
733 Ga0501076_0529777
734 nmdc:mga0yw44_281254_c1
735 nmdc:mga0yw44_404903_c1
736 nmdc:mga0k408_333929_c1
737 nmdc:mga06z11_4618_c1
738 nmdc:mga05p37_130947_c1
739 nmdc:mga05p37_937_c1
740 nmdc:mga09592_141429_c1
741 nmdc:mga09592_2099_c1
742 nmdc:mga09592_33667_c1
743 nmdc:mga0qj67_270980_c1
744 nmdc:mga06r32_155001_c1
745 nmdc:mga06r32_726507_c1
746 nmdc:mga06r32_812527_c1
747 Ga0500610_0123346
748 Ga0500560_030948
749 Ga0500569_035620
750 Ga0500658_0026698
751 Ga0501084_0272388
752 2509391284
753 2509445469
754 2510892565
755 2511499497
756 2513568323
757 2513586229
758 2513634771
759 2514018562
760 2524612327
761 2551676110
762 2551683919
763 2551693263
764 2551701924
765 2551721483
766 2551732165
767 2551739674
768 2585270140
769 2585391215
770 2585397924
771 2585541723
772 2585840058
773 2585902479
774 2599416154
775 2616294931
776 2617384093
777 2643918419
778 2644194474
779 2644200477
780 2644672373
781 2721156121
782 2730295654
783 2739036337
784 2739790689
785 2774872463
786 2778176599
787 2793317418
788 2793327987
789 2793354513
790 2793362360
791 2806046440
792 2806053024
793 2806059768
794 2806068494
795 2806074916
796 2808828815
797 2838027428
798 2841868591
799 2842202968
800 2842303049
801 2842342540
802 2842361543
803 2842365687
804 2842487394
805 2842513556
806 2855830287
807 2855845935
808 2915995868
809 2916012831
810 2916017682
811 2916031359
812 2916058098
813 2916071670
814 2921206825
815 2921239181
816 2921266811
817 2921293904
818 2921303169
819 2923560448
820 2924155609
821 2924162929
822 2924169614
823 2924175579
824 2924190055
825 2924220385
826 2924224564
827 2924233311
828 2936383190
829 2937006558
830 2937043081
831 2937055856
832 2937061245
833 2937072515
834 2937096259
835 2937103877
836 2937110453
837 2937132811
838 2957428787
839 2957436230
840 2957458292
841 2957474977
842 2957480820
843 2957485181
844 2957503158
845 2957509534
846 2960608205
847 2960627507
848 2960644963
849 2960649319
850 2960656454
851 2964612642
852 2964633448
853 2964654220
854 2964661354
855 2964683984
856 2964726381
857 2967670903
858 2967683582
859 2967695856
860 2967708752
861 2967719142
862 2967725620
863 2967739096
864 2967763042
865 2967777434
866 2970026301
867 2970043105
868 2970047749
869 2970058122
870 2970066062
871 2970092970
872 2970114860
873 2970117488
874 2970132350
875 2970139477
876 2970150941
877 2970168028
878 2970174599
879 2970189098
880 2970195510
881 2977542130
882 2977556602
883 2977575829
884 2977581913
885 8005380056
886 8005380250
887 8005398589
888 8005563502
889 8005565281
890 8005572445
891 8018168686
892 8056377664

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

31

215

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

37

273

0.92

PF08659

KR

KR domain

71

196

0.87

PF23441

90

274

0.77

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

33

191

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3uxy-assembly1.cif.gz_D the crystal structure of short chain dehydrogenase from rhodobacter sphaeroides 0.9579 5 245
4ni5-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from brucella suis 0.9541 2 249
2d1y-assembly1.cif.gz_C crystal structure of tt0321 from thermus thermophilus hb8 0.9522 5 250
2d1y-assembly1.cif.gz_D crystal structure of tt0321 from thermus thermophilus hb8 0.9502 5 250
5itv-assembly1.cif.gz_A crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase in complex with nadh 0.9498 5 249
ID Description Score Start End Superfamily
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9573 3 172 3.40.50.720
3uxyD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9559 5 245 3.40.50.720
af_A0A0R0JBZ9_6_171_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9551 78 247 3.40.50.720
4ni5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9541 2 249 3.40.50.720
2d1yC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9522 5 250 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3N5S1U9-F1-model_v4 SDR family oxidoreductase 0.9944 45 253 GO:0016491
AF-A0A533SSM5-F1-model_v4 SDR family oxidoreductase 0.9918 2 226 GO:0016491
AF-A0A3N5S1U9-F1-model_v4 SDR family oxidoreductase 0.9896 45 253 GO:0016491
AF-A0A1M3KEM3-F1-model_v4 Short-chain dehydrogenase 0.9849 4 253 GO:0016491
AF-A0A662CS22-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9796 3 171 GO:0016491

Map