metagRoot

F445785

General Info

Members	Datasets	Scaffolds	Average Seq Length
446	246	438	197

Family's Representative Sequence

Representative Sequence	3300046459\|Ga0495629_0008622\|Ga0495629_0008622_2556_3236
Length	226
Sequence	MSVKPCSLLNSHCSSPEGLIELEQRSGYGSRVQLHKRDVVAAATAILDNYGIADLTMRRLGRELNVSPGALYWHFANKQQLLGAIADRILEPVGDEPGEWQARVVGICGRLRDALLSHTDGAELVSASFAAGQSEAMAQIVAHLAQAAIDAGVDSGHAELAARTVVYYVLGFTADEQSRLQWDAAGAELPDEQSVLADDAGERFGFGLALLVDGIAAHRAVVGLSD

Samples

	Sample ID	Description	Type	Environment
1	2738541264	Mycobacterium sp. OK889	Isolate	Unclassified
2	2738541274	Mycobacterium sp. YR708	Isolate	Unclassified
3	2738541356	Mycobacterium sp. OK887	Isolate	Unclassified
4	2738543028	Mycobacterium sp. YR782	Isolate	Unclassified
5	2902799365	Mycolicibacterium sp. P1-5	Isolate	Unclassified
6	2902810491	Mycolicibacterium sp. P9-22	Isolate	Unclassified
7	2929212328	Mycolicibacterium sp. R-73050 Hybrid assembly	Isolate	Unclassified
8	2946080515	Microbacterium sp. W4I20	Isolate	Rhizosphere
9	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
10	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
11	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
12	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
13	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
14	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
15	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
16	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
17	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
18	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
19	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
20	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
21	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
22	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
23	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
24	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
25	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
26	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
27	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
28	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
29	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
30	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
31	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
32	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
33	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
34	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
35	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
36	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
37	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
38	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
39	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
40	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
41	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
42	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
43	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
44	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
45	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
46	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
47	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
48	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
49	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
50	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
51	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
52	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
53	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
54	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
55	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
56	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
57	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
58	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
59	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
60	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
61	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
62	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
63	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
64	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
65	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
66	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
67	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
68	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
69	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
70	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
71	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
72	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
73	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
74	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
75	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
76	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
77	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
78	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
79	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
80	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
81	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
82	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
83	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
84	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
85	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
86	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
87	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
88	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
89	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
90	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
91	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
92	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
93	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
94	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
95	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
96	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
97	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
98	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
99	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
100	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
101	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
102	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
103	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
104	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
105	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
106	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
107	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
150	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
154	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
155	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
156	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
157	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
158	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
159	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
160	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
161	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
162	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
163	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
164	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
165	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
166	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
167	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
168	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
169	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
170	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
171	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
172	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
173	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
174	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
175	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
176	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
177	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
178	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
179	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
180	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
181	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
182	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
183	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
184	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
185	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
186	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
187	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
188	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
189	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
190	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
191	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
192	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
193	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
194	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
195	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
196	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
197	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
198	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
199	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
200	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
201	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
202	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
203	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
204	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
205	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
206	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
207	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
208	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
209	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
210	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
211	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
212	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
213	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
214	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
215	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
216	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
217	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
218	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
219	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
220	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
221	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
222	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
223	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
224	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
225	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
226	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
227	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
228	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
229	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
230	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
231	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
232	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
233	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
234	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
235	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
236	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
237	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
238	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
239	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
240	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
241	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
242	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
243	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
244	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
245	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
246	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	98.21
Metatranscriptomes	0
Isolates	1.79

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	11.43
Nodule	0
Rhizoplane	10.99
Rhizosphere	74.66
Stem	0
Stem Tuber	0
Unclassified	2.91

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24746J21847_1002992	3300001977	Bacteria	2657
2	JGI24737J22298_10037621	3300001990	Bacteria	1491
3	JGI24034J26672_10002872	3300002239	Bacteria	2381
4	JGI24742J22300_10001807	3300002244	Bacteria	3405
5	JGI24751J29686_10001487	3300002459	Bacteria	4876
6	Ga0070676_10176761	3300005328	Bacteria	1385
7	Ga0070690_100181232	3300005330	Bacteria	1456
8	Ga0070690_100435985	3300005330	Bacteria	969
9	Ga0070670_100261800	3300005331	Bacteria	1508
10	Ga0068869_100005048	3300005334	Bacteria	8272
11	Ga0068869_100059988	3300005334	Bacteria	2787
12	Ga0070680_100173873	3300005336	Bacteria	1813
13	Ga0070682_100110120	3300005337	Bacteria	1834
14	Ga0068868_100147117	3300005338	Bacteria	1938
15	Ga0068868_100588515	3300005338	Bacteria	984
16	Ga0070689_100090925	3300005340	Bacteria	2406
17	Ga0070689_100093245	3300005340	Bacteria	2376
18	Ga0070691_10001448	3300005341	Bacteria	10161
19	Ga0070692_10127011	3300005345	Bacteria	1429
20	Ga0070668_100000568	3300005347	Bacteria	24706
21	Ga0070668_100183945	3300005347	Bacteria	1708
22	Ga0070668_100383867	3300005347	Bacteria	1196
23	Ga0070668_100677971	3300005347	Bacteria	907
24	Ga0070669_100009018	3300005353	Bacteria	7114
25	Ga0070675_100074976	3300005354	Bacteria	2812
26	Ga0070671_100027334	3300005355	Bacteria	4695
27	Ga0070671_100044728	3300005355	Bacteria	3680
28	Ga0070671_100174854	3300005355	Bacteria	1816
29	Ga0070674_100001914	3300005356	Bacteria	11329
30	Ga0070674_100351538	3300005356	Bacteria	1191
31	Ga0070673_100876285	3300005364	Bacteria	832
32	Ga0070688_100051988	3300005365	Bacteria	2558
33	Ga0070659_100099965	3300005366	Bacteria	2334
34	Ga0070667_100003391	3300005367	Bacteria	13569
35	Ga0070667_100005403	3300005367	Bacteria	10671
36	Ga0070667_100166644	3300005367	Bacteria	1943
37	Ga0070703_10013783	3300005406	Bacteria	2298
38	Ga0070709_10294370	3300005434	Bacteria	1184
39	Ga0070710_10000932	3300005437	Bacteria	13915
40	Ga0070710_10201351	3300005437	Bacteria	1257
41	Ga0070701_10014939	3300005438	Bacteria	3572
42	Ga0070711_100001643	3300005439	Bacteria	12357
43	Ga0070711_100014398	3300005439	Bacteria	4984
44	Ga0070705_100367406	3300005440	Bacteria	1055
45	Ga0070700_100002582	3300005441	Bacteria	9259
46	Ga0070663_100056245	3300005455	Bacteria	2818
47	Ga0070663_100068846	3300005455	Bacteria	2570
48	Ga0070663_100244274	3300005455	Bacteria	1418
49	Ga0070678_100001757	3300005456	Bacteria	11669
50	Ga0070678_100089151	3300005456	Bacteria	2360
51	Ga0070678_100517449	3300005456	Bacteria	1055
52	Ga0070678_100640969	3300005456	Bacteria	952
53	Ga0070662_100001601	3300005457	Bacteria	13975
54	Ga0070662_100120682	3300005457	Bacteria	2009
55	Ga0070662_100645198	3300005457	Bacteria	893
56	Ga0068867_100020871	3300005459	Bacteria	4672
57	Ga0070685_10057839	3300005466	Bacteria	2258
58	Ga0070698_100346879	3300005471	Bacteria	1416
59	Ga0070697_100393286	3300005536	Bacteria	1202
60	Ga0068853_100010926	3300005539	Bacteria	7359
61	Ga0070672_100469940	3300005543	Bacteria	1085
62	Ga0070686_100131918	3300005544	Bacteria	1729
63	Ga0070686_100306404	3300005544	Bacteria	1180
64	Ga0070695_100011006	3300005545	Bacteria	5408
65	Ga0070695_100026193	3300005545	Bacteria	3606
66	Ga0070696_100017971	3300005546	Bacteria	4776
67	Ga0070696_100032827	3300005546	Bacteria	3563
68	Ga0070693_100037896	3300005547	Bacteria	2691
69	Ga0070665_100004596	3300005548	Bacteria	14442
70	Ga0070665_100027133	3300005548	Bacteria	5768
71	Ga0070704_100012664	3300005549	Bacteria	5218
72	Ga0070704_100016151	3300005549	Bacteria	4711
73	Ga0070704_100991477	3300005549	Bacteria	759
74	Ga0068855_100086324	3300005563	Bacteria	3629
75	Ga0068855_100664676	3300005563	Bacteria	1118
76	Ga0068854_100000704	3300005578	Bacteria	19787
77	Ga0068854_100202450	3300005578	Bacteria	1561
78	Ga0068854_100211153	3300005578	Bacteria	1531
79	Ga0070702_100027914	3300005615	Bacteria	3051
80	Ga0068852_100082950	3300005616	Bacteria	2850
81	Ga0068859_100005722	3300005617	Bacteria	12646
82	Ga0068859_101625809	3300005617	Bacteria	713
83	Ga0068859_101680804	3300005617	Bacteria	701
84	Ga0068864_100698572	3300005618	Bacteria	991
85	Ga0068866_10001957	3300005718	Bacteria	8588
86	Ga0068866_10089446	3300005718	Bacteria	1673
87	Ga0068861_100000622	3300005719	Bacteria	20950
88	Ga0068861_100045107	3300005719	Bacteria	3317
89	Ga0068863_100000886	3300005841	Bacteria	30122
90	Ga0068858_100028212	3300005842	Bacteria	5215
91	Ga0068858_100401647	3300005842	Bacteria	1317
92	Ga0068860_100013606	3300005843	Bacteria	7976
93	Ga0068860_100108679	3300005843	Bacteria	2651
94	Ga0068860_100338305	3300005843	Bacteria	1479
95	Ga0068862_100030020	3300005844	Bacteria	4580
96	Ga0068862_100132653	3300005844	Bacteria	2205
97	Ga0068862_100193029	3300005844	Bacteria	1833
98	Ga0081540_1036399	3300005983	Bacteria	2625
99	Ga0075365_10033311	3300006038	Bacteria	3319
100	Ga0075365_10042254	3300006038	Bacteria	2980
101	Ga0075365_10470431	3300006038	Bacteria	888
102	Ga0075363_100006370	3300006048	Bacteria	5349
103	Ga0075363_100014341	3300006048	Bacteria	3869
104	Ga0075363_100069613	3300006048	Bacteria	1909
105	Ga0075363_100136131	3300006048	Bacteria	1380
106	Ga0075363_100495954	3300006048	Bacteria	725
107	Ga0075363_100596675	3300006048	Bacteria	661
108	Ga0075364_10000234	3300006051	Bacteria	26412
109	Ga0075364_10077290	3300006051	Bacteria	2197
110	Ga0075432_10163310	3300006058	Bacteria	862
111	Ga0070715_10225742	3300006163	Bacteria	965
112	Ga0070715_10239062	3300006163	Bacteria	943
113	Ga0070716_100007560	3300006173	Bacteria	5360
114	Ga0070716_100222708	3300006173	Bacteria	1268
115	Ga0070716_100279275	3300006173	Bacteria	1152
116	Ga0070716_100521102	3300006173	Bacteria	881
117	Ga0070712_100009953	3300006175	Bacteria	5993
118	Ga0070712_100013437	3300006175	Bacteria	5234
119	Ga0070712_100050114	3300006175	Bacteria	2903
120	Ga0070712_100971515	3300006175	Bacteria	734
121	Ga0075367_10054540	3300006178	Bacteria	2370
122	Ga0075369_10001288	3300006186	Bacteria	8528
123	Ga0075369_10011608	3300006186	Bacteria	3468
124	Ga0075369_10017858	3300006186	Bacteria	2882
125	Ga0075369_10033187	3300006186	Bacteria	2187
126	Ga0075369_10042309	3300006186	Bacteria	1953
127	Ga0075369_10210980	3300006186	Bacteria	898
128	Ga0097621_100144689	3300006237	Bacteria	2034
129	Ga0068871_100870975	3300006358	Bacteria	833
130	Ga0075428_100086149	3300006844	Bacteria	3426
131	Ga0075430_100185897	3300006846	Bacteria	1728
132	Ga0075430_100552476	3300006846	Bacteria	950
133	Ga0075431_100084062	3300006847	Bacteria	3286
134	Ga0068865_100012022	3300006881	Bacteria	5439
135	Ga0068865_100366384	3300006881	Bacteria	1171
136	Ga0068865_100620449	3300006881	Bacteria	916
137	Ga0068865_101196613	3300006881	Bacteria	672
138	Ga0097620_100005722	3300006931	Bacteria	12646
139	Ga0097620_101625809	3300006931	Bacteria	713
140	Ga0097620_101681174	3300006931	Bacteria	701
141	Ga0105250_10070660	3300009092	Bacteria	1410
142	Ga0111539_10410530	3300009094	Bacteria	1577
143	Ga0111539_10860799	3300009094	Bacteria	1054
144	Ga0105245_10007406	3300009098	Bacteria	9613
145	Ga0105245_10398866	3300009098	Bacteria	1374
146	Ga0105247_10003220	3300009101	Bacteria	10742
147	Ga0105247_10227204	3300009101	Bacteria	1266
148	Ga0105247_10597969	3300009101	Bacteria	818
149	Ga0114129_10052042	3300009147	Bacteria	5747
150	Ga0105243_10033352	3300009148	Bacteria	3982
151	Ga0105241_10151788	3300009174	Bacteria	1896
152	Ga0105242_10001104	3300009176	Bacteria	21251
153	Ga0105248_10010806	3300009177	Bacteria	10081
154	Ga0105248_10153551	3300009177	Bacteria	2597
155	Ga0105248_11235541	3300009177	Bacteria	845
156	Ga0105237_10588047	3300009545	Bacteria	1120
157	Ga0105249_10000571	3300009553	Bacteria	33782
158	Ga0105249_10059665	3300009553	Bacteria	3499
159	Ga0105249_10137483	3300009553	Bacteria	2340
160	Ga0105249_11720535	3300009553	Bacteria	700
161	Ga0099796_10003973	3300010159	Bacteria	3514
162	Ga0105239_10062405	3300010375	Bacteria	4090
163	Ga0105239_11012166	3300010375	Bacteria	955
164	Ga0105246_10729884	3300011119	Bacteria	871
165	Ga0157369_10488432	3300013105	Bacteria	1274
166	Ga0157378_10030839	3300013297	Bacteria	4733
167	Ga0163162_10151319	3300013306	Bacteria	2438
168	Ga0163162_10163330	3300013306	Bacteria	2350
169	Ga0163162_10543049	3300013306	Bacteria	1291
170	Ga0163162_11350696	3300013306	Bacteria	810
171	Ga0157372_10208893	3300013307	Bacteria	2262
172	Ga0157372_11052004	3300013307	Bacteria	942
173	Ga0157375_10005667	3300013308	Bacteria	10866
174	Ga0157375_10042543	3300013308	Bacteria	4397
175	Ga0157375_10426753	3300013308	Bacteria	1492
176	Ga0163163_10956220	3300014325	Bacteria	920
177	Ga0157380_10017017	3300014326	Bacteria	5371
178	Ga0157380_10723406	3300014326	Bacteria	1003
179	Ga0157379_10018092	3300014968	Bacteria	6210
180	Ga0163161_10018132	3300017792	Bacteria	4935
181	Ga0207692_10007629	3300025898	Bacteria	4439
182	Ga0207642_10000205	3300025899	Bacteria	17391
183	Ga0207642_10004430	3300025899	Bacteria	4530
184	Ga0207710_10011183	3300025900	Bacteria	3778
185	Ga0207710_10216329	3300025900	Bacteria	950
186	Ga0207688_10003825	3300025901	Bacteria	8212
187	Ga0207688_10004459	3300025901	Bacteria	7623
188	Ga0207688_10147166	3300025901	Bacteria	1389
189	Ga0207685_10028767	3300025905	Bacteria	1961
190	Ga0207699_10019740	3300025906	Bacteria	3600
191	Ga0207645_10061030	3300025907	Bacteria	2408
192	Ga0207654_10016336	3300025911	Bacteria	3864
193	Ga0207693_10000705	3300025915	Bacteria	30041
194	Ga0207693_10002182	3300025915	Bacteria	17058
195	Ga0207663_10012077	3300025916	Bacteria	4657
196	Ga0207663_10156414	3300025916	Bacteria	1604
197	Ga0207663_10474471	3300025916	Bacteria	968
198	Ga0207681_10195745	3300025923	Bacteria	1549
199	Ga0207681_10245603	3300025923	Bacteria	1395
200	Ga0207694_10335555	3300025924	Bacteria	1250
201	Ga0207650_10607082	3300025925	Bacteria	920
202	Ga0207659_10010437	3300025926	Bacteria	5839
203	Ga0207687_10002750	3300025927	Bacteria	11926
204	Ga0207700_10485417	3300025928	Bacteria	1092
205	Ga0207644_10022035	3300025931	Bacteria	4347
206	Ga0207644_10143843	3300025931	Bacteria	1839
207	Ga0207706_10052081	3300025933	Bacteria	3614
208	Ga0207706_10119370	3300025933	Bacteria	2318
209	Ga0207686_10004667	3300025934	Bacteria	7343
210	Ga0207670_10093770	3300025936	Bacteria	2128
211	Ga0207670_10568623	3300025936	Bacteria	928
212	Ga0207669_10000318	3300025937	Bacteria	22011
213	Ga0207669_10013923	3300025937	Bacteria	4015
214	Ga0207669_10225459	3300025937	Bacteria	1379
215	Ga0207669_10497855	3300025937	Bacteria	974
216	Ga0207704_10001564	3300025938	Bacteria	10254
217	Ga0207704_10333783	3300025938	Bacteria	1174
218	Ga0207665_10006323	3300025939	Bacteria	7855
219	Ga0207665_10025277	3300025939	Bacteria	3917
220	Ga0207665_10578646	3300025939	Bacteria	875
221	Ga0207691_10073301	3300025940	Bacteria	3088
222	Ga0207691_10314959	3300025940	Bacteria	1342
223	Ga0207711_10450890	3300025941	Bacteria	1197
224	Ga0207711_10944554	3300025941	Bacteria	801
225	Ga0207689_10008722	3300025942	Bacteria	8823
226	Ga0207689_10037220	3300025942	Bacteria	4037
227	Ga0207651_10976531	3300025960	Bacteria	756
228	Ga0207712_10031697	3300025961	Bacteria	3563
229	Ga0207712_11054144	3300025961	Bacteria	723
230	Ga0207668_10063791	3300025972	Bacteria	2600
231	Ga0207668_10126118	3300025972	Bacteria	1947
232	Ga0207668_10618420	3300025972	Bacteria	945
233	Ga0207668_11043925	3300025972	Bacteria	731
234	Ga0207640_10000920	3300025981	Bacteria	16509
235	Ga0207640_10221876	3300025981	Bacteria	1448
236	Ga0207640_10302518	3300025981	Bacteria	1266
237	Ga0207658_10208021	3300025986	Bacteria	1638
238	Ga0207677_10089110	3300026023	Bacteria	2239
239	Ga0207677_11093920	3300026023	Bacteria	726
240	Ga0207703_10018029	3300026035	Bacteria	5513
241	Ga0207703_10218057	3300026035	Bacteria	1704
242	Ga0207639_10117959	3300026041	Bacteria	2175
243	Ga0207639_10273054	3300026041	Bacteria	1484
244	Ga0207678_10003485	3300026067	Bacteria	14158
245	Ga0207678_10039382	3300026067	Bacteria	4102
246	Ga0207678_10065341	3300026067	Bacteria	3124
247	Ga0207708_10003132	3300026075	Bacteria	12174
248	Ga0207708_10015051	3300026075	Bacteria	5798
249	Ga0207641_10004902	3300026088	Bacteria	11504
250	Ga0207648_10033020	3300026089	Bacteria	4566
251	Ga0207648_10294248	3300026089	Bacteria	1454
252	Ga0207676_10145975	3300026095	Bacteria	2032
253	Ga0207675_100000941	3300026118	Bacteria	29074
254	Ga0207675_100020330	3300026118	Bacteria	6189
255	Ga0207675_100022250	3300026118	Bacteria	5903
256	Ga0207683_10006869	3300026121	Bacteria	9747
257	Ga0207683_10027074	3300026121	Bacteria	4955
258	Ga0207683_10043502	3300026121	Bacteria	3925
259	Ga0207683_10661588	3300026121	Bacteria	968
260	Ga0207698_10078765	3300026142	Bacteria	2648
261	Ga0207428_10175801	3300027907	Bacteria	1619
262	Ga0268266_10002908	3300028379	Bacteria	17732
263	Ga0268266_10033590	3300028379	Bacteria	4361
264	Ga0268265_10005537	3300028380	Bacteria	8621
265	Ga0268265_10141740	3300028380	Bacteria	2013
266	Ga0268265_10661622	3300028380	Bacteria	1005
267	Ga0268265_10946845	3300028380	Bacteria	848
268	Ga0268265_11580412	3300028380	Bacteria	660
269	Ga0268264_10004799	3300028381	Bacteria	11468
270	Ga0268264_10236976	3300028381	Bacteria	1688
271	Ga0268264_10631174	3300028381	Bacteria	1059
272	Ga0265327_10000081	3300031251	Bacteria	205988
273	Ga0265327_10009711	3300031251	Bacteria	6892
274	Ga0265327_10046265	3300031251	Bacteria	2305
275	Ga0316578_10235808	3300031728	Bacteria	1099
276	Ga0307413_10786408	3300031824	Bacteria	798
277	Ga0307413_11107523	3300031824	Bacteria	684
278	Ga0307406_10338895	3300031901	Bacteria	1170
279	Ga0307416_101507608	3300032002	Bacteria	778
280	Ga0307414_10649774	3300032004	Bacteria	951
281	Ga0373959_0029646	3300034820	Bacteria	1098
282	Ga0373932_0209813	3300035112	Bacteria	696
283	Ga0373960_0081325	3300035121	Bacteria	1020
284	Ga0373931_0020790	3300035691	Bacteria	3286
285	Ga0436364_0610518	3300037853	Bacteria	13173
286	Ga0439461_0000435	3300041410	Bacteria	6003
287	Ga0439461_0006899	3300041410	Bacteria	1992
288	Ga0439465_0016274	3300041413	Bacteria	2320
289	Ga0439465_0060583	3300041413	Bacteria	1253
290	Ga0439431_0003883	3300041997	Bacteria	3297
291	Ga0439442_002369	3300042002	Bacteria	3696
292	Ga0439445_0001715	3300042004	Bacteria	4820
293	Ga0439445_0015111	3300042004	Bacteria	1887
294	Ga0439448_0086396	3300042005	Bacteria	1057
295	Ga0439435_0027625	3300042436	Bacteria	1520
296	Ga0466972_0020398	3300044658	Bacteria	3312
297	Ga0466965_0000977	3300044683	Bacteria	11071
298	Ga0466965_0084687	3300044683	Bacteria	1606
299	Ga0466963_0160430	3300044694	Bacteria	1565
300	Ga0466963_0170565	3300044694	Bacteria	1517
301	Ga0466964_0223531	3300044706	Bacteria	915
302	Ga0466968_0001250	3300044735	Bacteria	9032
303	Ga0466968_0025389	3300044735	Bacteria	2427
304	Ga0466970_0011683	3300044765	Bacteria	4479
305	Ga0466970_0039512	3300044765	Bacteria	2503
306	Ga0466970_0105989	3300044765	Bacteria	1533
307	Ga0466957_0004000	3300044842	Bacteria	8149
308	Ga0466957_0050880	3300044842	Bacteria	2521
309	Ga0466960_0064038	3300044901	Bacteria	1812
310	Ga0466959_0008423	3300045049	Bacteria	7291
311	Ga0466959_0012199	3300045049	Bacteria	6201
312	Ga0466958_0033873	3300045836	Bacteria	3045
313	Ga0466967_0011056	3300045976	Bacteria	6813
314	Ga0466967_0070338	3300045976	Bacteria	3131
315	Ga0466967_0158661	3300045976	Bacteria	2122
316	Ga0466967_0220439	3300045976	Bacteria	1802
317	Ga0466967_1031798	3300045976	Bacteria	819
318	Ga0495629_0008622	3300046459	Bacteria	7507
319	Ga0495638_0030522	3300046460	Bacteria	3469
320	Ga0495582_0067322	3300046473	Bacteria	1979
321	Ga0495594_0123535	3300046499	Bacteria	1464
322	Ga0495630_0072647	3300046517	Bacteria	2590
323	Ga0495634_0176598	3300046642	Bacteria	1340
324	Ga0495588_0310130	3300046674	Bacteria	830
325	Ga0495646_0307465	3300046680	Bacteria	837
326	Ga0495581_0085003	3300047315	Bacteria	1834
327	Ga0495676_0130082	3300047321	Bacteria	1819
328	Ga0495686_0427572	3300047472	Bacteria	707
329	Ga0496100_0034082	3300048903	Bacteria	3191
330	Ga0496100_0117842	3300048903	Bacteria	1854
331	Ga0496100_0529811	3300048903	Bacteria	910
332	Ga0496101_0107635	3300048904	Bacteria	2095
333	Ga0496101_0160171	3300048904	Bacteria	1725
334	Ga0496101_0773091	3300048904	Bacteria	758
335	Ga0496102_0003474	3300048905	Bacteria	13362
336	Ga0496102_0005951	3300048905	Bacteria	10387
337	Ga0496102_0324052	3300048905	Bacteria	1451
338	Ga0496102_0448203	3300048905	Bacteria	1211
339	Ga0496102_0984352	3300048905	Bacteria	764
340	Ga0496103_0000932	3300048906	Bacteria	20970
341	Ga0496103_0157039	3300048906	Bacteria	1458
342	Ga0496103_0210841	3300048906	Bacteria	1249
343	Ga0496104_0117722	3300048907	Bacteria	2550
344	Ga0496104_0165521	3300048907	Bacteria	2120
345	Ga0496104_1584030	3300048907	Bacteria	558
346	Ga0496105_0009686	3300048908	Bacteria	7542
347	Ga0496105_0072825	3300048908	Bacteria	2839
348	Ga0496106_0038341	3300048909	Bacteria	3585
349	Ga0496106_0371161	3300048909	Bacteria	1150
350	Ga0496107_0282360	3300048910	Bacteria	1236
351	Ga0496107_0507745	3300048910	Bacteria	894
352	Ga0496108_0000404	3300048911	Bacteria	35603
353	Ga0496108_0010170	3300048911	Bacteria	7638
354	Ga0496108_0057461	3300048911	Bacteria	3269
355	Ga0496109_0000670	3300048912	Bacteria	28362
356	Ga0496109_0010226	3300048912	Bacteria	8012
357	Ga0496109_0137762	3300048912	Bacteria	2281
358	Ga0496109_0916073	3300048912	Bacteria	815
359	Ga0496110_0097586	3300048913	Bacteria	2633
360	Ga0496110_0101964	3300048913	Bacteria	2573
361	Ga0496111_0064258	3300048914	Bacteria	2662
362	Ga0496111_0495234	3300048914	Bacteria	900
363	Ga0496112_0042757	3300048915	Bacteria	4434
364	Ga0496112_0149106	3300048915	Bacteria	2306
365	Ga0496112_0150787	3300048915	Bacteria	2292
366	Ga0496112_0473131	3300048915	Bacteria	1190
367	Ga0496112_0806617	3300048915	Bacteria	863
368	Ga0496112_1292041	3300048915	Bacteria	645
369	Ga0496113_0025813	3300048916	Bacteria	4193
370	Ga0496113_0029053	3300048916	Bacteria	3987
371	Ga0496113_0104476	3300048916	Bacteria	2198
372	Ga0496113_0394308	3300048916	Bacteria	1111
373	Ga0496114_0002700	3300048917	Bacteria	13558
374	Ga0496114_0186370	3300048917	Bacteria	1814
375	Ga0496114_1071886	3300048917	Bacteria	690
376	Ga0496115_0020339	3300048918	Bacteria	5119
377	Ga0496115_0154914	3300048918	Bacteria	1893
378	Ga0496118_0234103	3300048921	Bacteria	1057
379	Ga0496122_0024627	3300048925	Bacteria	5261
380	Ga0496123_0027858	3300048926	Bacteria	4197
381	Ga0496126_0006189	3300048929	Bacteria	13394
382	Ga0496126_0046596	3300048929	Bacteria	3974
383	Ga0501034_0002996	3300049571	Bacteria	19542
384	Ga0501034_0077942	3300049571	Bacteria	3319
385	Ga0501034_0193083	3300049571	Bacteria	1997
386	Ga0501034_0421466	3300049571	Bacteria	1256
387	Ga0501036_0009512	3300049572	Bacteria	7996
388	Ga0501037_0005727	3300049573	Bacteria	9068
389	Ga0501039_0001425	3300049575	Bacteria	17614
390	Ga0501043_0000337	3300049579	Bacteria	42520
391	Ga0501047_0126125	3300049581	Bacteria	2440
392	Ga0501069_0123966	3300049585	Bacteria	1477
393	Ga0501070_0000642	3300049586	Bacteria	32168
394	Ga0501070_0619002	3300049586	Bacteria	862
395	Ga0501073_0016559	3300049589	Bacteria	5343
396	Ga0501077_0133252	3300049593	Bacteria	1576
397	Ga0501035_0709301	3300049822	Bacteria	811
398	Ga0501044_0033874	3300049823	Bacteria	5363
399	nmdc:mga03n38_106480_c1	3300050490	Bacteria	1359
400	nmdc:mga03n38_155546_c1	3300050490	Bacteria	1154
401	nmdc:mga03n38_20873_c1	3300050490	Bacteria	2627
402	nmdc:mga03n38_209360_c1	3300050490	Bacteria	1013
403	nmdc:mga03n38_321260_c1	3300050490	Bacteria	836
404	nmdc:mga03n38_36659_c1	3300050490	Bacteria	2110
405	nmdc:mga00v17_1257_c1	3300050491	Bacteria	13287
406	nmdc:mga00v17_173747_c1	3300050491	Bacteria	1390
407	nmdc:mga00v17_466921_c1	3300050491	Bacteria	819
408	nmdc:mga0yw44_151119_c1	3300050492	Bacteria	1515
409	nmdc:mga0yw44_91731_c1	3300050492	Bacteria	1187
410	nmdc:mga06z11_13411_c1	3300050494	Bacteria	3598
411	nmdc:mga06z11_529824_c1	3300050494	Bacteria	714
412	nmdc:mga07m45_281396_c1	3300050496	Bacteria	967
413	nmdc:mga07m45_595181_c1	3300050496	Bacteria	639
414	nmdc:mga07m45_64201_c1	3300050496	Bacteria	2083
415	nmdc:mga05p37_265221_c1	3300050507	Bacteria	2054
416	nmdc:mga0qj67_290122_c1	3300050509	Bacteria	1326
417	nmdc:mga06r32_107381_c1	3300050510	Bacteria	2743
418	nmdc:mga08y16_322456_c1	3300050511	Bacteria	1590
419	nmdc:mga0sz30_111697_c1	3300050516	Bacteria	843
420	nmdc:mga0sz30_15713_c1	3300050516	Bacteria	2995
421	nmdc:mga0sz30_2044_c1	3300050516	Bacteria	7207
422	nmdc:mga0sz30_32690_c1	3300050516	Bacteria	2159
423	nmdc:mga0sz30_3453_c1	3300050516	Bacteria	3625
424	nmdc:mga0sz30_53647_c1	3300050516	Bacteria	1283
425	Ga0500610_0007360	3300053079	Bacteria	4711
426	Ga0500635_0000430	3300053080	Bacteria	12188
427	Ga0495655_0058462	3300053083	Bacteria	1044
428	Ga0495619_0300140	3300053085	Bacteria	1113
429	Ga0500646_0136256	3300053090	Bacteria	802
430	Ga0500556_0025950	3300053104	Bacteria	1941
431	Ga0500562_005041	3300053108	Bacteria	3320
432	Ga0500652_000985	3300053131	Bacteria	9378
433	Ga0500652_022549	3300053131	Bacteria	2384
434	Ga0500616_0009492	3300053153	Bacteria	5915
435	Ga0500627_0017750	3300053158	Bacteria	2802
436	Ga0500645_000030	3300053730	Bacteria	121213
437	Ga0500645_128235	3300053730	Bacteria	705
438	Ga0466962_0014155	3300061719	Bacteria	3843

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300050494	nmdc:mga06z11_529824_c1	nmdc:mga06z11_529824_c1_10_498	162
2	3300037853	Ga0436364_0610518	Ga0436364_0610518_9020_9640	171
3	3300048907	Ga0496104_1584030	Ga0496104_1584030_15_539	172
4	3300049822	Ga0501035_0709301	Ga0501035_0709301_17_544	173
5	3300013105	Ga0157369_10488432	Ga0157369_104884322	176
6	3300050491	nmdc:mga00v17_466921_c1	nmdc:mga00v17_466921_c1_192_776	176
7	iso_pu_bacteria	2946080515	2946080801	176
8	3300044683	Ga0466965_0000977	Ga0466965_0000977_7470_8096	177
9	3300044735	Ga0466968_0001250	Ga0466968_0001250_7349_7975	177
10	3300044765	Ga0466970_0039512	Ga0466970_0039512_1574_2200	177
11	3300044842	Ga0466957_0004000	Ga0466957_0004000_3941_4567	177
12	3300045049	Ga0466959_0008423	Ga0466959_0008423_2782_3408	177
13	3300045976	Ga0466967_0011056	Ga0466967_0011056_4251_4877	177
14	3300049586	Ga0501070_0619002	Ga0501070_0619002_11_562	181
15	3300005347	Ga0070668_100677971	Ga0070668_1006779712	185
16	3300009553	Ga0105249_10059665	Ga0105249_100596652	185
17	3300025961	Ga0207712_11054144	Ga0207712_110541441	185
18	3300025972	Ga0207668_10126118	Ga0207668_101261182	185
19	3300048909	Ga0496106_0371161	Ga0496106_0371161_265_870	185
20	3300048915	Ga0496112_0149106	Ga0496112_0149106_20_625	185
21	3300048916	Ga0496113_0104476	Ga0496113_0104476_364_969	185
22	3300053080	Ga0500635_0000430	Ga0500635_0000430_11101_11721	186
23	3300053108	Ga0500562_005041	Ga0500562_005041_1958_2566	186
24	3300053131	Ga0500652_000985	Ga0500652_000985_4597_5217	186
25	iso_pu_bacteria	2738541274	2738707620	186
26	iso_pu_bacteria	2738543028	2739332632	186
27	3300005356	Ga0070674_100351538	Ga0070674_1003515382	187
28	3300006048	Ga0075363_100495954	Ga0075363_1004959541	187
29	3300044658	Ga0466972_0020398	Ga0466972_0020398_121_690	187
30	3300044683	Ga0466965_0084687	Ga0466965_0084687_766_1335	187
31	3300044694	Ga0466963_0170565	Ga0466963_0170565_362_931	187
32	3300044706	Ga0466964_0223531	Ga0466964_0223531_64_633	187
33	3300044735	Ga0466968_0025389	Ga0466968_0025389_305_874	187
34	3300044765	Ga0466970_0011683	Ga0466970_0011683_305_874	187
35	3300044842	Ga0466957_0050880	Ga0466957_0050880_1540_2109	187
36	3300044901	Ga0466960_0064038	Ga0466960_0064038_746_1315	187
37	3300045049	Ga0466959_0012199	Ga0466959_0012199_2765_3334	187
38	3300045836	Ga0466958_0033873	Ga0466958_0033873_705_1274	187
39	3300050490	nmdc:mga03n38_321260_c1	nmdc:mga03n38_321260_c1_122_685	187
40	3300061719	Ga0466962_0014155	Ga0466962_0014155_2194_2763	187
41	3300049571	Ga0501034_0193083	Ga0501034_0193083_337_909	188
42	3300049581	Ga0501047_0126125	Ga0501047_0126125_352_924	188
43	3300049585	Ga0501069_0123966	Ga0501069_0123966_446_1018	188
44	iso_pu_bacteria	2902799365	2902801034	188
45	3300031251	Ga0265327_10009711	Ga0265327_100097115	189
46	iso_pu_bacteria	2738541264	2738665132	189
47	iso_pu_bacteria	2738541356	2739144266	189
48	iso_pu_bacteria	2902810491	2902814944	189
49	3300006038	Ga0075365_10042254	Ga0075365_100422545	190
50	3300006038	Ga0075365_10470431	Ga0075365_104704312	190
51	3300050490	nmdc:mga03n38_106480_c1	nmdc:mga03n38_106480_c1_90_662	190
52	3300050492	nmdc:mga0yw44_91731_c1	nmdc:mga0yw44_91731_c1_173_745	190
53	3300053079	Ga0500610_0007360	Ga0500610_0007360_3937_4560	190
54	3300053730	Ga0500645_128235	Ga0500645_128235_40_627	190
55	3300006048	Ga0075363_100136131	Ga0075363_1001361312	191
56	3300031251	Ga0265327_10000081	Ga0265327_1000008188	191
57	3300035121	Ga0373960_0081325	Ga0373960_0081325_199_873	191
58	3300046460	Ga0495638_0030522	Ga0495638_0030522_1615_2199	191
59	3300048929	Ga0496126_0046596	Ga0496126_0046596_1195_1779	191
60	3300050516	nmdc:mga0sz30_53647_c1	nmdc:mga0sz30_53647_c1_666_1250	191
61	3300053090	Ga0500646_0136256	Ga0500646_0136256_23_607	191
62	3300053131	Ga0500652_022549	Ga0500652_022549_375_959	191
63	3300053158	Ga0500627_0017750	Ga0500627_0017750_139_723	191
64	3300053730	Ga0500645_000030	Ga0500645_000030_24695_25279	191
65	3300002459	JGI24751J29686_10001487	JGI24751J29686_100014875	192
66	3300005331	Ga0070670_100261800	Ga0070670_1002618001	192
67	3300005338	Ga0068868_100147117	Ga0068868_1001471172	192
68	3300005355	Ga0070671_100027334	Ga0070671_1000273342	192
69	3300005367	Ga0070667_100005403	Ga0070667_1000054036	192
70	3300005456	Ga0070678_100517449	Ga0070678_1005174492	192
71	3300005544	Ga0070686_100131918	Ga0070686_1001319182	192
72	3300005548	Ga0070665_100004596	Ga0070665_1000045962	192
73	3300005618	Ga0068864_100698572	Ga0068864_1006985722	192
74	3300005841	Ga0068863_100000886	Ga0068863_10000088631	192
75	3300005843	Ga0068860_100108679	Ga0068860_1001086792	192
76	3300005844	Ga0068862_100132653	Ga0068862_1001326532	192
77	3300006038	Ga0075365_10033311	Ga0075365_100333112	192
78	3300006048	Ga0075363_100006370	Ga0075363_1000063702	192
79	3300006048	Ga0075363_100069613	Ga0075363_1000696132	192
80	3300006048	Ga0075363_100596675	Ga0075363_1005966752	192
81	3300006051	Ga0075364_10077290	Ga0075364_100772902	192
82	3300006178	Ga0075367_10054540	Ga0075367_100545402	192
83	3300006186	Ga0075369_10017858	Ga0075369_100178582	192
84	3300006186	Ga0075369_10210980	Ga0075369_102109802	192
85	3300009177	Ga0105248_11235541	Ga0105248_112355412	192
86	3300009545	Ga0105237_10588047	Ga0105237_105880472	192
87	3300009553	Ga0105249_11720535	Ga0105249_117205351	192
88	3300013306	Ga0163162_11350696	Ga0163162_113506961	192
89	3300025925	Ga0207650_10607082	Ga0207650_106070821	192
90	3300025931	Ga0207644_10022035	Ga0207644_100220354	192
91	3300025941	Ga0207711_10944554	Ga0207711_109445542	192
92	3300025981	Ga0207640_10221876	Ga0207640_102218761	192
93	3300025986	Ga0207658_10208021	Ga0207658_102080212	192
94	3300026023	Ga0207677_10089110	Ga0207677_100891102	192
95	3300026088	Ga0207641_10004902	Ga0207641_100049025	192
96	3300026095	Ga0207676_10145975	Ga0207676_101459752	192
97	3300028379	Ga0268266_10002908	Ga0268266_1000290812	192
98	3300028380	Ga0268265_10141740	Ga0268265_101417402	192
99	3300028381	Ga0268264_10236976	Ga0268264_102369762	192
100	3300045976	Ga0466967_0158661	Ga0466967_0158661_341_919	192
101	3300045976	Ga0466967_0220439	Ga0466967_0220439_208_795	192
102	3300045976	Ga0466967_1031798	Ga0466967_1031798_211_789	192
103	3300048905	Ga0496102_0003474	Ga0496102_0003474_6162_6740	192
104	3300048905	Ga0496102_0448203	Ga0496102_0448203_603_1190	192
105	3300048905	Ga0496102_0984352	Ga0496102_0984352_173_751	192
106	3300048906	Ga0496103_0157039	Ga0496103_0157039_26_604	192
107	3300048907	Ga0496104_0165521	Ga0496104_0165521_498_1076	192
108	3300048908	Ga0496105_0009686	Ga0496105_0009686_740_1318	192
109	3300048911	Ga0496108_0057461	Ga0496108_0057461_2310_2888	192
110	3300048912	Ga0496109_0137762	Ga0496109_0137762_1346_1933	192
111	3300048913	Ga0496110_0101964	Ga0496110_0101964_1147_1725	192
112	3300048914	Ga0496111_0064258	Ga0496111_0064258_1813_2391	192
113	3300048915	Ga0496112_0150787	Ga0496112_0150787_969_1595	192
114	3300048916	Ga0496113_0025813	Ga0496113_0025813_2404_3030	192
115	3300048917	Ga0496114_1071886	Ga0496114_1071886_36_623	192
116	3300048921	Ga0496118_0234103	Ga0496118_0234103_266_844	192
117	3300048925	Ga0496122_0024627	Ga0496122_0024627_1068_1694	192
118	3300049571	Ga0501034_0002996	Ga0501034_0002996_11739_12344	192
119	3300049571	Ga0501034_0421466	Ga0501034_0421466_480_1058	192
120	3300049572	Ga0501036_0009512	Ga0501036_0009512_3404_4009	192
121	3300049573	Ga0501037_0005727	Ga0501037_0005727_5765_6370	192
122	3300049575	Ga0501039_0001425	Ga0501039_0001425_3619_4224	192
123	3300049579	Ga0501043_0000337	Ga0501043_0000337_12774_13379	192
124	3300049586	Ga0501070_0000642	Ga0501070_0000642_2679_3284	192
125	3300049589	Ga0501073_0016559	Ga0501073_0016559_4472_5077	192
126	3300049593	Ga0501077_0133252	Ga0501077_0133252_908_1513	192
127	3300049823	Ga0501044_0033874	Ga0501044_0033874_2512_3117	192
128	3300050490	nmdc:mga03n38_20873_c1	nmdc:mga03n38_20873_c1_447_1025	192
129	3300050490	nmdc:mga03n38_209360_c1	nmdc:mga03n38_209360_c1_118_696	192
130	3300050491	nmdc:mga00v17_173747_c1	nmdc:mga00v17_173747_c1_402_980	192
131	3300050492	nmdc:mga0yw44_151119_c1	nmdc:mga0yw44_151119_c1_610_1188	192
132	3300050494	nmdc:mga06z11_13411_c1	nmdc:mga06z11_13411_c1_1597_2175	192
133	3300050496	nmdc:mga07m45_281396_c1	nmdc:mga07m45_281396_c1_31_609	192
134	3300050496	nmdc:mga07m45_595181_c1	nmdc:mga07m45_595181_c1_31_609	192
135	3300050496	nmdc:mga07m45_64201_c1	nmdc:mga07m45_64201_c1_182_760	192
136	3300050516	nmdc:mga0sz30_111697_c1	nmdc:mga0sz30_111697_c1_175_753	192
137	3300050516	nmdc:mga0sz30_15713_c1	nmdc:mga0sz30_15713_c1_133_711	192
138	3300009094	Ga0111539_10860799	Ga0111539_108607992	193
139	3300009147	Ga0114129_10052042	Ga0114129_100520424	193
140	3300031728	Ga0316578_10235808	Ga0316578_102358082	193
141	3300041410	Ga0439461_0000435	Ga0439461_0000435_704_1285	193
142	3300042004	Ga0439445_0001715	Ga0439445_0001715_3266_3847	193
143	3300053104	Ga0500556_0025950	Ga0500556_0025950_71_658	193
144	3300053153	Ga0500616_0009492	Ga0500616_0009492_641_1228	193
145	3300005457	Ga0070662_100645198	Ga0070662_1006451981	194
146	3300006186	Ga0075369_10042309	Ga0075369_100423092	194
147	3300031251	Ga0265327_10046265	Ga0265327_100462652	194
148	3300049571	Ga0501034_0077942	Ga0501034_0077942_1548_2132	194
149	3300005337	Ga0070682_100110120	Ga0070682_1001101202	195
150	3300005345	Ga0070692_10127011	Ga0070692_101270113	195
151	3300005455	Ga0070663_100068846	Ga0070663_1000688462	195
152	3300005578	Ga0068854_100211153	Ga0068854_1002111532	195
153	3300006175	Ga0070712_100050114	Ga0070712_1000501141	195
154	3300006186	Ga0075369_10011608	Ga0075369_100116082	195
155	3300011119	Ga0105246_10729884	Ga0105246_107298841	195
156	3300025916	Ga0207663_10474471	Ga0207663_104744712	195
157	3300025924	Ga0207694_10335555	Ga0207694_103355552	195
158	3300025937	Ga0207669_10225459	Ga0207669_102254592	195
159	3300025981	Ga0207640_10302518	Ga0207640_103025182	195
160	3300026067	Ga0207678_10039382	Ga0207678_100393822	195
161	3300026089	Ga0207648_10294248	Ga0207648_102942482	195
162	3300046459	Ga0495629_0008622	Ga0495629_0008622_2556_3236	195
163	3300046473	Ga0495582_0067322	Ga0495582_0067322_31_711	195
164	3300046499	Ga0495594_0123535	Ga0495594_0123535_74_661	195
165	3300046517	Ga0495630_0072647	Ga0495630_0072647_146_826	195
166	3300046642	Ga0495634_0176598	Ga0495634_0176598_272_952	195
167	3300046674	Ga0495588_0310130	Ga0495588_0310130_152_811	195
168	3300046680	Ga0495646_0307465	Ga0495646_0307465_57_644	195
169	3300047315	Ga0495581_0085003	Ga0495581_0085003_467_1147	195
170	3300047321	Ga0495676_0130082	Ga0495676_0130082_303_983	195
171	3300047472	Ga0495686_0427572	Ga0495686_0427572_44_631	195
172	3300048903	Ga0496100_0529811	Ga0496100_0529811_312_899	195
173	3300048910	Ga0496107_0507745	Ga0496107_0507745_172_759	195
174	3300048911	Ga0496108_0010170	Ga0496108_0010170_6158_6745	195
175	3300048912	Ga0496109_0010226	Ga0496109_0010226_4864_5451	195
176	3300048912	Ga0496109_0916073	Ga0496109_0916073_206_793	195
177	3300048914	Ga0496111_0495234	Ga0496111_0495234_164_751	195
178	3300048915	Ga0496112_0042757	Ga0496112_0042757_1969_2556	195
179	3300048915	Ga0496112_0473131	Ga0496112_0473131_546_1133	195
180	3300048916	Ga0496113_0029053	Ga0496113_0029053_1578_2165	195
181	3300050490	nmdc:mga03n38_155546_c1	nmdc:mga03n38_155546_c1_547_1134	195
182	3300050516	nmdc:mga0sz30_3453_c1	nmdc:mga0sz30_3453_c1_489_1076	195
183	3300053083	Ga0495655_0058462	Ga0495655_0058462_40_627	195
184	3300053085	Ga0495619_0300140	Ga0495619_0300140_470_1057	195
185	iso_pu_bacteria	2929212328	2929215509	195
186	3300002239	JGI24034J26672_10002872	JGI24034J26672_100028723	196
187	3300002244	JGI24742J22300_10001807	JGI24742J22300_100018075	196
188	3300005330	Ga0070690_100181232	Ga0070690_1001812323	196
189	3300005334	Ga0068869_100005048	Ga0068869_1000050488	196
190	3300005336	Ga0070680_100173873	Ga0070680_1001738731	196
191	3300005340	Ga0070689_100093245	Ga0070689_1000932453	196
192	3300005341	Ga0070691_10001448	Ga0070691_100014483	196
193	3300005347	Ga0070668_100000568	Ga0070668_1000005688	196
194	3300005353	Ga0070669_100009018	Ga0070669_1000090185	196
195	3300005355	Ga0070671_100174854	Ga0070671_1001748542	196
196	3300005356	Ga0070674_100001914	Ga0070674_1000019149	196
197	3300005364	Ga0070673_100876285	Ga0070673_1008762852	196
198	3300005365	Ga0070688_100051988	Ga0070688_1000519882	196
199	3300005366	Ga0070659_100099965	Ga0070659_1000999652	196
200	3300005367	Ga0070667_100003391	Ga0070667_10000339111	196
201	3300005406	Ga0070703_10013783	Ga0070703_100137832	196
202	3300005437	Ga0070710_10000932	Ga0070710_100009328	196
203	3300005438	Ga0070701_10014939	Ga0070701_100149395	196
204	3300005439	Ga0070711_100001643	Ga0070711_1000016434	196
205	3300005440	Ga0070705_100367406	Ga0070705_1003674062	196
206	3300005441	Ga0070700_100002582	Ga0070700_1000025825	196
207	3300005455	Ga0070663_100056245	Ga0070663_1000562454	196
208	3300005456	Ga0070678_100001757	Ga0070678_1000017579	196
209	3300005457	Ga0070662_100001601	Ga0070662_1000016012	196
210	3300005459	Ga0068867_100020871	Ga0068867_1000208712	196
211	3300005466	Ga0070685_10057839	Ga0070685_100578393	196
212	3300005536	Ga0070697_100393286	Ga0070697_1003932862	196
213	3300005539	Ga0068853_100010926	Ga0068853_1000109265	196
214	3300005543	Ga0070672_100469940	Ga0070672_1004699402	196
215	3300005544	Ga0070686_100306404	Ga0070686_1003064042	196
216	3300005545	Ga0070695_100011006	Ga0070695_1000110061	196
217	3300005546	Ga0070696_100032827	Ga0070696_1000328271	196
218	3300005547	Ga0070693_100037896	Ga0070693_1000378964	196
219	3300005549	Ga0070704_100012664	Ga0070704_1000126643	196
220	3300005563	Ga0068855_100086324	Ga0068855_1000863242	196
221	3300005578	Ga0068854_100000704	Ga0068854_1000007047	196
222	3300005616	Ga0068852_100082950	Ga0068852_1000829504	196
223	3300005617	Ga0068859_100005722	Ga0068859_1000057226	196
224	3300005718	Ga0068866_10001957	Ga0068866_100019574	196
225	3300005719	Ga0068861_100000622	Ga0068861_10000062227	196
226	3300005842	Ga0068858_100028212	Ga0068858_1000282122	196
227	3300005843	Ga0068860_100013606	Ga0068860_1000136063	196
228	3300005844	Ga0068862_100030020	Ga0068862_1000300204	196
229	3300006048	Ga0075363_100014341	Ga0075363_1000143414	196
230	3300006051	Ga0075364_10000234	Ga0075364_1000023412	196
231	3300006163	Ga0070715_10239062	Ga0070715_102390621	196
232	3300006173	Ga0070716_100007560	Ga0070716_1000075602	196
233	3300006173	Ga0070716_100521102	Ga0070716_1005211022	196
234	3300006175	Ga0070712_100013437	Ga0070712_1000134376	196
235	3300006186	Ga0075369_10001288	Ga0075369_100012885	196
236	3300006237	Ga0097621_100144689	Ga0097621_1001446894	196
237	3300006358	Ga0068871_100870975	Ga0068871_1008709751	196
238	3300006846	Ga0075430_100552476	Ga0075430_1005524761	196
239	3300006881	Ga0068865_100012022	Ga0068865_1000120221	196
240	3300006881	Ga0068865_100620449	Ga0068865_1006204492	196
241	3300006931	Ga0097620_100005722	Ga0097620_1000057226	196
242	3300009092	Ga0105250_10070660	Ga0105250_100706603	196
243	3300009098	Ga0105245_10007406	Ga0105245_100074068	196
244	3300009101	Ga0105247_10003220	Ga0105247_100032208	196
245	3300009148	Ga0105243_10033352	Ga0105243_100333521	196
246	3300009174	Ga0105241_10151788	Ga0105241_101517883	196
247	3300009176	Ga0105242_10001104	Ga0105242_1000110426	196
248	3300009177	Ga0105248_10010806	Ga0105248_100108062	196
249	3300009553	Ga0105249_10000571	Ga0105249_100005716	196
250	3300010159	Ga0099796_10003973	Ga0099796_100039734	196
251	3300010375	Ga0105239_10062405	Ga0105239_100624051	196
252	3300013297	Ga0157378_10030839	Ga0157378_100308396	196
253	3300013306	Ga0163162_10151319	Ga0163162_101513192	196
254	3300013306	Ga0163162_10543049	Ga0163162_105430491	196
255	3300013307	Ga0157372_10208893	Ga0157372_102088932	196
256	3300013308	Ga0157375_10005667	Ga0157375_100056679	196
257	3300014326	Ga0157380_10017017	Ga0157380_100170172	196
258	3300014968	Ga0157379_10018092	Ga0157379_100180925	196
259	3300017792	Ga0163161_10018132	Ga0163161_100181326	196
260	3300025898	Ga0207692_10007629	Ga0207692_100076295	196
261	3300025899	Ga0207642_10000205	Ga0207642_1000020512	196
262	3300025900	Ga0207710_10011183	Ga0207710_100111836	196
263	3300025901	Ga0207688_10003825	Ga0207688_100038257	196
264	3300025905	Ga0207685_10028767	Ga0207685_100287673	196
265	3300025911	Ga0207654_10016336	Ga0207654_100163364	196
266	3300025915	Ga0207693_10000705	Ga0207693_1000070523	196
267	3300025916	Ga0207663_10156414	Ga0207663_101564142	196
268	3300025923	Ga0207681_10245603	Ga0207681_102456032	196
269	3300025927	Ga0207687_10002750	Ga0207687_1000275011	196
270	3300025931	Ga0207644_10143843	Ga0207644_101438432	196
271	3300025933	Ga0207706_10119370	Ga0207706_101193703	196
272	3300025934	Ga0207686_10004667	Ga0207686_100046675	196
273	3300025936	Ga0207670_10093770	Ga0207670_100937702	196
274	3300025937	Ga0207669_10000318	Ga0207669_1000031826	196
275	3300025938	Ga0207704_10001564	Ga0207704_100015646	196
276	3300025939	Ga0207665_10006323	Ga0207665_100063231	196
277	3300025939	Ga0207665_10578646	Ga0207665_105786462	196
278	3300025940	Ga0207691_10314959	Ga0207691_103149592	196
279	3300025941	Ga0207711_10450890	Ga0207711_104508902	196
280	3300025942	Ga0207689_10008722	Ga0207689_100087224	196
281	3300025960	Ga0207651_10976531	Ga0207651_109765311	196
282	3300025961	Ga0207712_10031697	Ga0207712_100316976	196
283	3300025972	Ga0207668_10063791	Ga0207668_100637913	196
284	3300025981	Ga0207640_10000920	Ga0207640_1000092020	196
285	3300026035	Ga0207703_10018029	Ga0207703_100180296	196
286	3300026041	Ga0207639_10117959	Ga0207639_101179592	196
287	3300026067	Ga0207678_10065341	Ga0207678_100653414	196
288	3300026075	Ga0207708_10003132	Ga0207708_100031326	196
289	3300026089	Ga0207648_10033020	Ga0207648_100330202	196
290	3300026118	Ga0207675_100000941	Ga0207675_10000094119	196
291	3300026121	Ga0207683_10006869	Ga0207683_100068693	196
292	3300026142	Ga0207698_10078765	Ga0207698_100787654	196
293	3300028380	Ga0268265_10005537	Ga0268265_100055376	196
294	3300028380	Ga0268265_10661622	Ga0268265_106616222	196
295	3300028381	Ga0268264_10004799	Ga0268264_100047998	196
296	3300041410	Ga0439461_0006899	Ga0439461_0006899_337_927	196
297	3300041413	Ga0439465_0016274	Ga0439465_0016274_76_666	196
298	3300041413	Ga0439465_0060583	Ga0439465_0060583_224_814	196
299	3300041997	Ga0439431_0003883	Ga0439431_0003883_442_1032	196
300	3300042002	Ga0439442_002369	Ga0439442_002369_2702_3292	196
301	3300042004	Ga0439445_0015111	Ga0439445_0015111_945_1535	196
302	3300044694	Ga0466963_0160430	Ga0466963_0160430_107_697	196
303	3300045976	Ga0466967_0070338	Ga0466967_0070338_2278_2868	196
304	3300048903	Ga0496100_0034082	Ga0496100_0034082_2376_2966	196
305	3300048904	Ga0496101_0160171	Ga0496101_0160171_994_1584	196
306	3300048905	Ga0496102_0005951	Ga0496102_0005951_9129_9719	196
307	3300048906	Ga0496103_0000932	Ga0496103_0000932_7754_8344	196
308	3300048917	Ga0496114_0002700	Ga0496114_0002700_4144_4734	196
309	3300048917	Ga0496114_0186370	Ga0496114_0186370_343_939	196
310	3300048918	Ga0496115_0020339	Ga0496115_0020339_3572_4162	196
311	3300050490	nmdc:mga03n38_36659_c1	nmdc:mga03n38_36659_c1_971_1561	196
312	3300050491	nmdc:mga00v17_1257_c1	nmdc:mga00v17_1257_c1_12180_12770	196
313	3300050509	nmdc:mga0qj67_290122_c1	nmdc:mga0qj67_290122_c1_472_1062	196
314	3300050516	nmdc:mga0sz30_2044_c1	nmdc:mga0sz30_2044_c1_1527_2117	196
315	3300005617	Ga0068859_101680804	Ga0068859_1016808042	197
316	3300006931	Ga0097620_101681174	Ga0097620_1016811742	197
317	3300031824	Ga0307413_11107523	Ga0307413_111075231	197
318	3300031901	Ga0307406_10338895	Ga0307406_103388952	197
319	3300005347	Ga0070668_100383867	Ga0070668_1003838672	198
320	3300005719	Ga0068861_100045107	Ga0068861_1000451074	198
321	3300025972	Ga0207668_10618420	Ga0207668_106184202	198
322	3300026118	Ga0207675_100022250	Ga0207675_1000222502	198
323	3300005456	Ga0070678_100640969	Ga0070678_1006409692	199
324	3300006058	Ga0075432_10163310	Ga0075432_101633102	199
325	3300014325	Ga0163163_10956220	Ga0163163_109562201	199
326	3300025901	Ga0207688_10147166	Ga0207688_101471662	199
327	3300026121	Ga0207683_10661588	Ga0207683_106615882	199
328	3300027907	Ga0207428_10175801	Ga0207428_101758012	199
329	3300031824	Ga0307413_10786408	Ga0307413_107864082	199
330	3300032002	Ga0307416_101507608	Ga0307416_1015076082	199
331	3300044765	Ga0466970_0105989	Ga0466970_0105989_492_1109	199
332	3300001977	JGI24746J21847_1002992	JGI24746J21847_10029924	200
333	3300001990	JGI24737J22298_10037621	JGI24737J22298_100376212	200
334	3300005328	Ga0070676_10176761	Ga0070676_101767612	200
335	3300005330	Ga0070690_100435985	Ga0070690_1004359852	200
336	3300005334	Ga0068869_100059988	Ga0068869_1000599882	200
337	3300005338	Ga0068868_100588515	Ga0068868_1005885152	200
338	3300005340	Ga0070689_100090925	Ga0070689_1000909252	200
339	3300005347	Ga0070668_100183945	Ga0070668_1001839453	200
340	3300005354	Ga0070675_100074976	Ga0070675_1000749765	200
341	3300005355	Ga0070671_100044728	Ga0070671_1000447285	200
342	3300005367	Ga0070667_100166644	Ga0070667_1001666442	200
343	3300005434	Ga0070709_10294370	Ga0070709_102943702	200
344	3300005437	Ga0070710_10201351	Ga0070710_102013512	200
345	3300005439	Ga0070711_100014398	Ga0070711_1000143983	200
346	3300005455	Ga0070663_100244274	Ga0070663_1002442742	200
347	3300005456	Ga0070678_100089151	Ga0070678_1000891512	200
348	3300005457	Ga0070662_100120682	Ga0070662_1001206822	200
349	3300005471	Ga0070698_100346879	Ga0070698_1003468792	200
350	3300005545	Ga0070695_100026193	Ga0070695_1000261936	200
351	3300005546	Ga0070696_100017971	Ga0070696_1000179711	200
352	3300005548	Ga0070665_100027133	Ga0070665_1000271335	200
353	3300005549	Ga0070704_100016151	Ga0070704_1000161512	200
354	3300005549	Ga0070704_100991477	Ga0070704_1009914771	200
355	3300005563	Ga0068855_100664676	Ga0068855_1006646763	200
356	3300005578	Ga0068854_100202450	Ga0068854_1002024502	200
357	3300005615	Ga0070702_100027914	Ga0070702_1000279144	200
358	3300005617	Ga0068859_101625809	Ga0068859_1016258091	200
359	3300005718	Ga0068866_10089446	Ga0068866_100894462	200
360	3300005842	Ga0068858_100401647	Ga0068858_1004016472	200
361	3300005843	Ga0068860_100338305	Ga0068860_1003383052	200
362	3300005844	Ga0068862_100193029	Ga0068862_1001930293	200
363	3300005983	Ga0081540_1036399	Ga0081540_10363993	200
364	3300006163	Ga0070715_10225742	Ga0070715_102257421	200
365	3300006173	Ga0070716_100222708	Ga0070716_1002227082	200
366	3300006173	Ga0070716_100279275	Ga0070716_1002792752	200
367	3300006175	Ga0070712_100009953	Ga0070712_1000099531	200
368	3300006175	Ga0070712_100971515	Ga0070712_1009715151	200
369	3300006186	Ga0075369_10033187	Ga0075369_100331871	200
370	3300006844	Ga0075428_100086149	Ga0075428_1000861495	200
371	3300006846	Ga0075430_100185897	Ga0075430_1001858972	200
372	3300006847	Ga0075431_100084062	Ga0075431_1000840623	200
373	3300006881	Ga0068865_100366384	Ga0068865_1003663842	200
374	3300006881	Ga0068865_101196613	Ga0068865_1011966131	200
375	3300006931	Ga0097620_101625809	Ga0097620_1016258091	200
376	3300009094	Ga0111539_10410530	Ga0111539_104105302	200
377	3300009098	Ga0105245_10398866	Ga0105245_103988662	200
378	3300009101	Ga0105247_10227204	Ga0105247_102272043	200
379	3300009101	Ga0105247_10597969	Ga0105247_105979691	200
380	3300009177	Ga0105248_10153551	Ga0105248_101535512	200
381	3300009553	Ga0105249_10137483	Ga0105249_101374833	200
382	3300010375	Ga0105239_11012166	Ga0105239_110121661	200
383	3300013306	Ga0163162_10163330	Ga0163162_101633303	200
384	3300013307	Ga0157372_11052004	Ga0157372_110520042	200
385	3300013308	Ga0157375_10042543	Ga0157375_100425435	200
386	3300013308	Ga0157375_10426753	Ga0157375_104267531	200
387	3300014326	Ga0157380_10723406	Ga0157380_107234062	200
388	3300025899	Ga0207642_10004430	Ga0207642_100044302	200
389	3300025900	Ga0207710_10216329	Ga0207710_102163292	200
390	3300025901	Ga0207688_10004459	Ga0207688_100044597	200
391	3300025906	Ga0207699_10019740	Ga0207699_100197402	200
392	3300025907	Ga0207645_10061030	Ga0207645_100610302	200
393	3300025915	Ga0207693_10002182	Ga0207693_1000218216	200
394	3300025916	Ga0207663_10012077	Ga0207663_100120773	200
395	3300025923	Ga0207681_10195745	Ga0207681_101957451	200
396	3300025926	Ga0207659_10010437	Ga0207659_100104372	200
397	3300025928	Ga0207700_10485417	Ga0207700_104854172	200
398	3300025933	Ga0207706_10052081	Ga0207706_100520815	200
399	3300025936	Ga0207670_10568623	Ga0207670_105686232	200
400	3300025937	Ga0207669_10013923	Ga0207669_100139234	200
401	3300025937	Ga0207669_10497855	Ga0207669_104978552	200
402	3300025938	Ga0207704_10333783	Ga0207704_103337832	200
403	3300025939	Ga0207665_10025277	Ga0207665_100252772	200
404	3300025940	Ga0207691_10073301	Ga0207691_100733012	200
405	3300025942	Ga0207689_10037220	Ga0207689_100372202	200
406	3300025972	Ga0207668_11043925	Ga0207668_110439251	200
407	3300026023	Ga0207677_11093920	Ga0207677_110939201	200
408	3300026035	Ga0207703_10218057	Ga0207703_102180572	200
409	3300026041	Ga0207639_10273054	Ga0207639_102730542	200
410	3300026067	Ga0207678_10003485	Ga0207678_100034859	200
411	3300026075	Ga0207708_10015051	Ga0207708_100150512	200
412	3300026118	Ga0207675_100020330	Ga0207675_1000203305	200
413	3300026121	Ga0207683_10027074	Ga0207683_100270741	200
414	3300026121	Ga0207683_10043502	Ga0207683_100435022	200
415	3300028379	Ga0268266_10033590	Ga0268266_100335904	200
416	3300028380	Ga0268265_10946845	Ga0268265_109468452	200
417	3300028380	Ga0268265_11580412	Ga0268265_115804121	200
418	3300028381	Ga0268264_10631174	Ga0268264_106311742	200
419	3300032004	Ga0307414_10649774	Ga0307414_106497742	200
420	3300034820	Ga0373959_0029646	Ga0373959_0029646_25_627	200
421	3300035112	Ga0373932_0209813	Ga0373932_0209813_30_632	200
422	3300035691	Ga0373931_0020790	Ga0373931_0020790_223_825	200
423	3300042005	Ga0439448_0086396	Ga0439448_0086396_237_845	200
424	3300042436	Ga0439435_0027625	Ga0439435_0027625_271_882	200
425	3300048903	Ga0496100_0117842	Ga0496100_0117842_773_1375	200
426	3300048904	Ga0496101_0107635	Ga0496101_0107635_320_922	200
427	3300048904	Ga0496101_0773091	Ga0496101_0773091_62_664	200
428	3300048905	Ga0496102_0324052	Ga0496102_0324052_284_886	200
429	3300048906	Ga0496103_0210841	Ga0496103_0210841_31_633	200
430	3300048907	Ga0496104_0117722	Ga0496104_0117722_346_948	200
431	3300048908	Ga0496105_0072825	Ga0496105_0072825_1545_2147	200
432	3300048909	Ga0496106_0038341	Ga0496106_0038341_1543_2145	200
433	3300048910	Ga0496107_0282360	Ga0496107_0282360_374_976	200
434	3300048911	Ga0496108_0000404	Ga0496108_0000404_3418_4020	200
435	3300048912	Ga0496109_0000670	Ga0496109_0000670_7622_8224	200
436	3300048913	Ga0496110_0097586	Ga0496110_0097586_87_689	200
437	3300048915	Ga0496112_0806617	Ga0496112_0806617_68_670	200
438	3300048915	Ga0496112_1292041	Ga0496112_1292041_14_619	200
439	3300048916	Ga0496113_0394308	Ga0496113_0394308_268_870	200
440	3300048918	Ga0496115_0154914	Ga0496115_0154914_369_971	200
441	3300048926	Ga0496123_0027858	Ga0496123_0027858_162_788	200
442	3300048929	Ga0496126_0006189	Ga0496126_0006189_5656_6282	200
443	3300050507	nmdc:mga05p37_265221_c1	nmdc:mga05p37_265221_c1_876_1490	200
444	3300050510	nmdc:mga06r32_107381_c1	nmdc:mga06r32_107381_c1_1146_1760	200
445	3300050511	nmdc:mga08y16_322456_c1	nmdc:mga08y16_322456_c1_589_1191	200
446	3300050516	nmdc:mga0sz30_32690_c1	nmdc:mga0sz30_32690_c1_124_753	200

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

39

85

0.96 PF02909

TetR_C_1

Tetracyclin repressor-like, C-terminal domain

91

219

0.84 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5yek-assembly1.cif.gz_B	crystal structure of bioq	0.9811	1	185
5xs9-assembly1.cif.gz_B	crystal structure of mycobacterium smegmatis bioq	0.9728	3	187
5yek-assembly1.cif.gz_B	crystal structure of bioq	0.9695	1	185
5yek-assembly1.cif.gz_A	crystal structure of bioq	0.9641	2	187
5xs9-assembly1.cif.gz_B	crystal structure of mycobacterium smegmatis bioq	0.9618	3	187

ID	Description	Score	Start	End	Superfamily
3fiwB01	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like	1.002	4	53	1.10.10.60
3fiwD01	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like	0.9967	4	53	1.10.10.60
3fiwA01	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like	0.9769	3	53	1.10.10.60
2y2zA01	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like	0.968	3	57	1.10.10.60
3zqiA01	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like	0.9616	3	60	1.10.10.60

ID	Description	Score	Start	End	GO Terms
AF-A0A1S1N1U4-F1-model_v4	TetR family transcriptional regulator	0.9901	1	146	GO:0000976 GO:0003700 GO:0045892 GO:0046677 GO:0046872
AF-A0A7I7SZ01-F1-model_v4	HTH tetR-type domain-containing protein	0.9814	1	188	GO:0000976 GO:0003700 GO:0045892 GO:0046677 GO:0046872
AF-A0A1S1N1U4-F1-model_v4	TetR family transcriptional regulator	0.9703	1	146	GO:0000976 GO:0003700 GO:0045892 GO:0046677 GO:0046872
AF-A0A5N0IDE0-F1-model_v4	TetR family transcriptional regulator	0.9452	1	196	GO:0000976 GO:0003700 GO:0045892 GO:0046677 GO:0046872
AF-A0A1S1L3F5-F1-model_v4	TetR family transcriptional regulator	0.9452	2	190	GO:0000976 GO:0003700 GO:0045892 GO:0046677 GO:0046872

Feature Viewer

pLDDT	pTM	Quality
89.81	0.86	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F445785

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

39

85

0.96

PF02909

TetR_C_1

Tetracyclin repressor-like, C-terminal domain

91

219

0.84

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map