F445787

General Info

Members Datasets Scaffolds Average Seq Length
446 194 892 390

Family's Representative Sequence

Representative Sequence 3300046471|Ga0495650_0000204|Ga0495650_0000204_104445_105689
Length 414
Sequence LSNAGLKPIPAPLYFAVINRIEAFMFDFDRVIDRHGSWCTQWDFVADRFGRDDLLPFTISDMDFATAPCILSALQHRVQHGVLGYSRWQHEDFLTAIDHWYQQRFALHVDRQQIVYGPSVIYMVAQLIRHWSSAGDAVLIHTPAYDAFYKAIEGNDRQVLSLPLVCNRAEWQCDMAALESLLSRDECKIMLLCSPHNPTGKVWRRDELQQMADLCQRHGVQVISDEIHMDMVMGDQPHVPWIAVARGRWALFTSASKSFNVPALTGAYGFISDEADREAWFHALKSADGLSSPAVMAVAAHIAAYREGAEWLDALRDYLRANLQQVARRLNQAFPQLNWQPPQATYLAWIDLNPLGLGDKALQKALIEQQKVAIMPGYTYGPQGNGYLRLNVGCPRSKLDDGLDRLIAAIESLL

Samples

Sample ID Description Type Environment
1 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
16 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
17 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
18 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
19 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
20 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
21 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
22 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
23 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
24 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
25 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
30 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
31 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
32 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
33 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
34 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
35 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
36 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
41 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
42 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
44 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
45 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
54 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
57 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
58 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
59 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
60 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
61 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
62 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
63 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
64 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
65 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
66 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
67 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
68 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
69 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
70 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
71 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
72 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
73 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
74 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
75 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
76 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
77 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
78 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
79 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
80 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
81 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
82 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
83 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
84 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
85 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
86 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
87 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
88 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
89 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
90 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
91 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
92 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
93 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
94 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
95 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
96 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
97 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
98 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
99 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
100 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
101 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
102 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
103 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
104 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
105 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
106 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
107 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
108 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
109 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
110 2506520008 Serratia plymuthica AS12 Isolate Unclassified
111 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
112 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
113 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
114 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
115 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
116 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
117 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
118 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
119 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
120 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
121 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
122 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
123 2636415599 Klebsiella variicola DX120E Isolate Unclassified
124 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
125 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
126 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
127 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
128 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
129 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
130 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
131 2751185917 Enterobacter sp. HK169 Isolate Unclassified
132 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
133 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
134 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
135 2775507074 Klebsiella sp. D5A Isolate Unclassified
136 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
137 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
138 2821118458 Enterobacter asburiae 609 Isolate Unclassified
139 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
140 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
141 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
142 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
143 2847085930 Erwinia persicina B64 Isolate Bulb
144 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
145 2865014394 Pantoea sp. R-71966 Isolate Unclassified
146 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
147 2876601092 Pantoea endophytica 596 Isolate Unclassified
148 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
149 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
150 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
151 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
152 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
153 2904504865 Serratia marcescens 1822 Isolate Unclassified
154 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
155 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
156 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
157 2919150387 Rahnella aceris 1817 Isolate Unclassified
158 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
159 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
160 2927143783 Rahnella sp. 2050 Isolate Unclassified
161 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
162 2932406140 Serratia sp. 2723 Isolate Rhizosphere
163 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
164 2937539931 Pantoea sp. LS15 Isolate Unclassified
165 2937967321 Serratia sp. YC16 Isolate Unclassified
166 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
167 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
168 2939577877 Serratia sp. 509 Isolate Rhizosphere
169 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
170 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
171 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
172 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
173 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
174 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
175 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
176 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
177 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
178 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
179 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
180 640753048 Serratia proteamaculans 568 Isolate Endosphere
181 8004592986 Serratia sp. S119 Isolate Unclassified
182 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
183 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
184 8018221730 Enterobacter sp. CM29 Isolate Unclassified
185 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
186 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
187 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
188 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
189 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
190 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
191 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
192 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
193 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
194 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.72
Metatranscriptomes 0
Isolates 19.28

Biome Distribution

Category Percentage (%)
Aerial Root 0.45
Bulb 0.22
Endosphere 5.61
Nodule 4.48
Rhizoplane 5.16
Rhizosphere 48.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495650_0000204 3300046471 Bacteria 129303
2 SwRhRL2b_contig_2730796 2162886007 Bacteria 3032
3 JGI25162J39368_1000009 3300002737 Bacteria 389795
4 JGI25163J39215_1000112 3300002771 Bacteria 33836
5 JGI25164J39214_1000002 3300002772 Bacteria 406570
6 Ga0055538_1000015 3300003751 Bacteria 311166
7 Ga0055539_1000009 3300003752 Bacteria 406566
8 Ga0055533_1000012 3300003756 Bacteria 406566
9 Ga0055525_1000014 3300003759 Bacteria 406566
10 Ga0055541_1000006 3300003841 Bacteria 406566
11 Ga0058692_1001389 3300003856 Bacteria 8957
12 Ga0058692_1005219 3300003856 Bacteria 3733
13 Ga0058692_1005220 3300003856 Bacteria 3733
14 Ga0058692_1007258 3300003856 Bacteria 2957
15 Ga0058692_1007497 3300003856 Bacteria 2888
16 Ga0065704_10000115 3300005289 Bacteria 75390
17 Ga0065704_10000297 3300005289 Bacteria 43486
18 Ga0065704_10000854 3300005289 Bacteria 11560
19 Ga0070665_100003098 3300005548 Bacteria 17905
20 Ga0068857_100000773 3300005577 Bacteria 23816
21 Ga0075364_10005738 3300006051 Bacteria 7238
22 Ga0075364_10049223 3300006051 Bacteria 2748
23 Ga0075364_10098235 3300006051 Bacteria 1948
24 Ga0079104_1000083 3300006946 Bacteria 137254
25 Ga0079104_1000218 3300006946 Bacteria 80243
26 Ga0079104_1000263 3300006946 Bacteria 69767
27 Ga0079104_1000292 3300006946 Bacteria 63382
28 Ga0079104_1000716 3300006946 Bacteria 29970
29 Ga0079104_1000733 3300006946 Bacteria 29076
30 Ga0079104_1001695 3300006946 Bacteria 14097
31 Ga0079104_1002113 3300006946 Bacteria 11343
32 Ga0079104_1002449 3300006946 Bacteria 10011
33 Ga0105251_10000002 3300009011 Bacteria 350843
34 Ga0105251_10000189 3300009011 Bacteria 62590
35 Ga0105251_10001242 3300009011 Bacteria 22091
36 Ga0105251_10003141 3300009011 Bacteria 12254
37 Ga0105251_10004870 3300009011 Bacteria 8959
38 Ga0105251_10006273 3300009011 Bacteria 7615
39 Ga0105251_10011006 3300009011 Bacteria 5197
40 Ga0105251_10012464 3300009011 Bacteria 4810
41 Ga0105251_10016137 3300009011 Bacteria 4049
42 Ga0105244_10000015 3300009036 Bacteria 256814
43 Ga0105244_10002160 3300009036 Bacteria 15082
44 Ga0105244_10002576 3300009036 Bacteria 13611
45 Ga0105244_10003001 3300009036 Bacteria 12376
46 Ga0105244_10003258 3300009036 Bacteria 11714
47 Ga0105244_10006949 3300009036 Bacteria 7250
48 Ga0105244_10029148 3300009036 Bacteria 2954
49 Ga0105244_10075016 3300009036 Bacteria 1681
50 Ga0105244_10077551 3300009036 Bacteria 1648
51 Ga0105250_10000002 3300009092 Bacteria 566949
52 Ga0105250_10000072 3300009092 Bacteria 94689
53 Ga0105250_10000113 3300009092 Bacteria 72385
54 Ga0105250_10003290 3300009092 Bacteria 7691
55 Ga0105250_10004663 3300009092 Bacteria 6270
56 Ga0105250_10006318 3300009092 Bacteria 5188
57 Ga0105250_10018996 3300009092 Bacteria 2779
58 Ga0105247_10000320 3300009101 Bacteria 43113
59 Ga0105243_10060358 3300009148 Bacteria 3029
60 Ga0105241_10000002 3300009174 Bacteria 869480
61 Ga0105246_10021366 3300011119 Bacteria 4165
62 Ga0105246_10041146 3300011119 Bacteria 3122
63 Ga0157373_10000405 3300013100 Bacteria 34603
64 Ga0157373_10001029 3300013100 Bacteria 21504
65 Ga0157373_10015376 3300013100 Bacteria 5594
66 Ga0157371_10000008 3300013102 Bacteria 393028
67 Ga0157371_10002962 3300013102 Bacteria 15794
68 Ga0157371_10010131 3300013102 Bacteria 7364
69 Ga0157371_10027004 3300013102 Bacteria 4167
70 Ga0157370_10002375 3300013104 Bacteria 22690
71 Ga0157370_10003134 3300013104 Bacteria 19581
72 Ga0157369_10020840 3300013105 Bacteria 7328
73 Ga0157372_10076707 3300013307 Bacteria 3774
74 Ga0182006_1000047 3300015261 Bacteria 187006
75 Ga0182006_1024408 3300015261 Bacteria 2494
76 Ga0183366_1001 3300015679 Bacteria 2743932
77 Ga0183370_1001 3300015680 Bacteria 2743932
78 Ga0183369_1001 3300015685 Bacteria 2743932
79 Ga0183368_1001 3300015687 Bacteria 2743932
80 Ga0163161_10000001 3300017792 Bacteria 2041488
81 Ga0209760_100120 3300025207 Bacteria 53842
82 Ga0209784_100001 3300025224 Bacteria 3600592
83 Ga0209566_100001 3300025225 Bacteria 3600765
84 Ga0209674_100002 3300025226 Bacteria 3600592
85 Ga0209563_100002 3300025230 Bacteria 2045675
86 Ga0207427_100020 3300025231 Bacteria 507515
87 Ga0209437_100001 3300025233 Bacteria 2045675
88 Ga0209437_100073 3300025233 Bacteria 302948
89 Ga0209677_100002 3300025253 Bacteria 2045675
90 Ga0209129_1000004 3300025258 Bacteria 884499
91 Ga0209233_1000610 3300025261 Bacteria 18314
92 Ga0207696_1000001 3300025711 Bacteria 2579611
93 Ga0207696_1000005 3300025711 Bacteria 642078
94 Ga0207696_1000042 3300025711 Bacteria 307256
95 Ga0207696_1000218 3300025711 Bacteria 83242
96 Ga0207696_1000292 3300025711 Bacteria 58466
97 Ga0207696_1000398 3300025711 Bacteria 40651
98 Ga0207696_1001059 3300025711 Bacteria 16268
99 Ga0207696_1002113 3300025711 Bacteria 9985
100 Ga0207696_1003125 3300025711 Bacteria 7717
101 Ga0207696_1013996 3300025711 Bacteria 2768
102 Ga0207655_1000001 3300025728 Bacteria 1866413
103 Ga0207655_1000009 3300025728 Bacteria 664676
104 Ga0207655_1000037 3300025728 Bacteria 354473
105 Ga0207655_1000061 3300025728 Bacteria 258893
106 Ga0207655_1000063 3300025728 Bacteria 257028
107 Ga0207655_1000373 3300025728 Bacteria 63082
108 Ga0207655_1001029 3300025728 Bacteria 28136
109 Ga0207655_1003246 3300025728 Bacteria 12211
110 Ga0207655_1005519 3300025728 Bacteria 8581
111 Ga0207713_1000001 3300025735 Bacteria 2295391
112 Ga0207713_1000002 3300025735 Bacteria 1061749
113 Ga0207713_1000003 3300025735 Bacteria 860698
114 Ga0207713_1000008 3300025735 Bacteria 553952
115 Ga0207713_1000016 3300025735 Bacteria 421689
116 Ga0207713_1000029 3300025735 Bacteria 285054
117 Ga0207713_1001124 3300025735 Bacteria 22760
118 Ga0207713_1001872 3300025735 Bacteria 15989
119 Ga0207713_1009037 3300025735 Bacteria 5661
120 Ga0207713_1014697 3300025735 Bacteria 4049
121 Ga0207713_1026145 3300025735 Bacteria 2681
122 Ga0207713_1040056 3300025735 Bacteria 1970
123 Ga0207710_10000113 3300025900 Bacteria 102300
124 Ga0207654_10000005 3300025911 Bacteria 869492
125 Ga0207657_10216616 3300025919 Bacteria 1535
126 Ga0207709_10037239 3300025935 Bacteria 2889
127 Ga0207709_10097551 3300025935 Bacteria 1936
128 Ga0207674_10003836 3300026116 Bacteria 18318
129 Ga0209281_1000001 3300027111 Bacteria 1933496
130 Ga0209281_1000003 3300027111 Bacteria 1260089
131 Ga0209281_1000006 3300027111 Bacteria 1170244
132 Ga0209281_1000130 3300027111 Bacteria 191756
133 Ga0209281_1000181 3300027111 Bacteria 146200
134 Ga0209281_1000287 3300027111 Bacteria 93918
135 Ga0209281_1000414 3300027111 Bacteria 64365
136 Ga0209281_1000494 3300027111 Bacteria 53600
137 Ga0209281_1000638 3300027111 Bacteria 38391
138 Ga0209281_1001424 3300027111 Bacteria 14249
139 Ga0209281_1001749 3300027111 Bacteria 11117
140 Ga0209371_1000001 3300027312 Bacteria 2771503
141 Ga0209371_1000005 3300027312 Bacteria 1061740
142 Ga0209371_1000041 3300027312 Bacteria 340377
143 Ga0209371_1000212 3300027312 Bacteria 80989
144 Ga0209371_1001290 3300027312 Bacteria 17602
145 Ga0209371_1002237 3300027312 Bacteria 11151
146 Ga0209371_1004804 3300027312 Bacteria 5680
147 Ga0209371_1011563 3300027312 Bacteria 2613
148 Ga0268266_10001737 3300028379 Bacteria 24933
149 Ga0268256_1000001 3300030500 Bacteria 2771065
150 Ga0268256_1000003 3300030500 Bacteria 1289401
151 Ga0268256_1000006 3300030500 Bacteria 1063991
152 Ga0268256_1001101 3300030500 Bacteria 17602
153 Ga0268256_1002885 3300030500 Bacteria 8251
154 Ga0268256_1011926 3300030500 Bacteria 2715
155 Ga0268256_1011927 3300030500 Bacteria 2715
156 Ga0268256_1012557 3300030500 Bacteria 2613
157 Ga0268256_1028824 3300030500 Bacteria 1365
158 Ga0439438_001385 3300041405 Bacteria 10689
159 Ga0439438_010039 3300041405 Bacteria 3025
160 Ga0439447_003034 3300041407 Bacteria 6009
161 Ga0439466_0000009 3300041411 Bacteria 232657
162 Ga0451853_3093388 3300041512 Bacteria 8241
163 Ga0439432_013185 3300042006 Bacteria 2812
164 Ga0439432_019692 3300042006 Bacteria 2246
165 Ga0439432_023040 3300042006 Bacteria 2053
166 Ga0439432_040182 3300042006 Bacteria 1484
167 Ga0439452_000002 3300042010 Bacteria 1377577
168 Ga0439452_000028 3300042010 Bacteria 204513
169 Ga0439452_000246 3300042010 Bacteria 37436
170 Ga0439452_000493 3300042010 Bacteria 21705
171 Ga0450907_000597 3300042146 Bacteria 9622
172 Ga0466981_0000002 3300044669 Bacteria 313036
173 Ga0495627_000116 3300046453 Bacteria 99916
174 Ga0495591_000013 3300046458 Bacteria 268106
175 Ga0495591_000100 3300046458 Bacteria 99473
176 Ga0495591_000763 3300046458 Bacteria 23259
177 Ga0495591_001170 3300046458 Bacteria 17125
178 Ga0495638_0001608 3300046460 Bacteria 20176
179 Ga0495650_0000005 3300046471 Bacteria 766553
180 Ga0495650_0000043 3300046471 Bacteria 357197
181 Ga0495650_0016261 3300046471 Bacteria 3775
182 Ga0495584_0036764 3300046491 Bacteria 2473
183 Ga0495585_0007998 3300046492 Bacteria 6428
184 Ga0495596_0014544 3300046500 Bacteria 3316
185 Ga0495606_0002305 3300046507 Bacteria 22488
186 Ga0495620_0004508 3300046515 Bacteria 7836
187 Ga0495631_0045391 3300046518 Bacteria 1935
188 Ga0495648_0014312 3300046524 Bacteria 5815
189 Ga0495654_0000041 3300046530 Bacteria 174733
190 Ga0495654_0000167 3300046530 Bacteria 64853
191 Ga0495654_0004539 3300046530 Bacteria 8217
192 Ga0495654_0004607 3300046530 Bacteria 8140
193 Ga0495654_0025098 3300046530 Bacteria 3073
194 Ga0495609_0049290 3300046538 Bacteria 1880
195 Ga0495609_0063797 3300046538 Bacteria 1626
196 Ga0495597_0002127 3300046542 Bacteria 13118
197 Ga0495611_0057081 3300046648 Bacteria 1769
198 Ga0495625_0004823 3300046660 Bacteria 12601
199 Ga0495671_0008104 3300046692 Bacteria 5930
200 Ga0495649_0001040 3300046694 Bacteria 21746
201 Ga0495649_0003204 3300046694 Bacteria 11183
202 Ga0495589_0000001 3300046794 Bacteria 888100
203 Ga0495589_0060498 3300046794 Bacteria 1860
204 Ga0495660_0000012 3300046810 Bacteria 350701
205 Ga0495660_0000048 3300046810 Bacteria 145350
206 Ga0495660_0034009 3300046810 Bacteria 2854
207 Ga0495672_0000002 3300047320 Bacteria 740116
208 Ga0495672_0000020 3300047320 Bacteria 432845
209 Ga0495672_0000043 3300047320 Bacteria 266893
210 Ga0495683_0013394 3300047323 Bacteria 4288
211 Ga0495679_000018 3300047446 Bacteria 239433
212 Ga0495679_001854 3300047446 Bacteria 11414
213 Ga0495679_007690 3300047446 Bacteria 4467
214 Ga0495679_019407 3300047446 Bacteria 2389
215 Ga0495673_0000070 3300047469 Bacteria 217453
216 Ga0495673_0000167 3300047469 Bacteria 111793
217 Ga0496100_0074374 3300048903 Bacteria 2276
218 Ga0496100_0143490 3300048903 Bacteria 1695
219 Ga0496101_0000055 3300048904 Bacteria 136176
220 Ga0496102_0005316 3300048905 Bacteria 10935
221 Ga0496103_0150705 3300048906 Bacteria 1490
222 Ga0496104_0000091 3300048907 Bacteria 87834
223 Ga0496104_0000233 3300048907 Bacteria 49075
224 Ga0496104_0007416 3300048907 Bacteria 9693
225 Ga0496104_0308087 3300048907 Bacteria 1496
226 Ga0496105_0007743 3300048908 Bacteria 8337
227 Ga0496105_0007901 3300048908 Bacteria 8263
228 Ga0496105_0038424 3300048908 Bacteria 3943
229 Ga0496116_0000001 3300048919 Bacteria 1501681
230 Ga0496116_0000066 3300048919 Bacteria 264035
231 Ga0496116_0000305 3300048919 Bacteria 82397
232 Ga0496116_0000822 3300048919 Bacteria 39198
233 Ga0496116_0017930 3300048919 Bacteria 5474
234 Ga0496116_0031503 3300048919 Bacteria 3794
235 Ga0496116_0031679 3300048919 Bacteria 3780
236 Ga0496117_0000020 3300048920 Bacteria 458405
237 Ga0496117_0000022 3300048920 Bacteria 439512
238 Ga0496117_0000453 3300048920 Bacteria 68285
239 Ga0496117_0001256 3300048920 Bacteria 37763
240 Ga0496117_0002666 3300048920 Bacteria 22108
241 Ga0496117_0003591 3300048920 Bacteria 17896
242 Ga0496117_0005868 3300048920 Bacteria 12695
243 Ga0496117_0009820 3300048920 Bacteria 8818
244 Ga0496117_0027200 3300048920 Bacteria 4462
245 Ga0496117_0032466 3300048920 Bacteria 3965
246 Ga0496117_0077455 3300048920 Bacteria 2200
247 Ga0496117_0139365 3300048920 Bacteria 1455
248 Ga0496117_0149664 3300048920 Bacteria 1383
249 Ga0496117_0151578 3300048920 Bacteria 1371
250 Ga0496118_0000007 3300048921 Bacteria 650986
251 Ga0496118_0000015 3300048921 Bacteria 551359
252 Ga0496118_0000085 3300048921 Bacteria 179731
253 Ga0496118_0004321 3300048921 Bacteria 16946
254 Ga0496118_0004655 3300048921 Bacteria 16095
255 Ga0496118_0004751 3300048921 Bacteria 15897
256 Ga0496118_0005928 3300048921 Bacteria 13665
257 Ga0496118_0038875 3300048921 Bacteria 3806
258 Ga0496118_0088942 3300048921 Bacteria 2134
259 Ga0496118_0103092 3300048921 Bacteria 1920
260 Ga0496118_0109227 3300048921 Bacteria 1841
261 Ga0496118_0124106 3300048921 Bacteria 1676
262 Ga0496119_0000001 3300048922 Bacteria 789520
263 Ga0496119_0000570 3300048922 Bacteria 49795
264 Ga0496119_0002980 3300048922 Bacteria 17974
265 Ga0496119_0004522 3300048922 Bacteria 13800
266 Ga0496119_0004672 3300048922 Bacteria 13500
267 Ga0496119_0008290 3300048922 Bacteria 9169
268 Ga0496119_0008327 3300048922 Bacteria 9138
269 Ga0496119_0008708 3300048922 Bacteria 8855
270 Ga0496119_0067806 3300048922 Bacteria 2102
271 Ga0496119_0088649 3300048922 Bacteria 1763
272 Ga0496119_0097431 3300048922 Bacteria 1658
273 Ga0496119_0115644 3300048922 Bacteria 1481
274 Ga0496120_0000016 3300048923 Bacteria 307608
275 Ga0496120_0000952 3300048923 Bacteria 39508
276 Ga0496120_0001357 3300048923 Bacteria 30064
277 Ga0496120_0001569 3300048923 Bacteria 26742
278 Ga0496120_0003772 3300048923 Bacteria 13386
279 Ga0496120_0004407 3300048923 Bacteria 11822
280 Ga0496120_0008528 3300048923 Bacteria 7425
281 Ga0496120_0009525 3300048923 Bacteria 6878
282 Ga0496120_0019382 3300048923 Bacteria 4353
283 Ga0496120_0024080 3300048923 Bacteria 3801
284 Ga0496120_0024401 3300048923 Bacteria 3771
285 Ga0496120_0025123 3300048923 Bacteria 3701
286 Ga0496120_0060577 3300048923 Bacteria 2116
287 Ga0496120_0064680 3300048923 Bacteria 2029
288 Ga0496120_0103955 3300048923 Bacteria 1495
289 Ga0496120_0129757 3300048923 Bacteria 1292
290 Ga0496121_0002456 3300048924 Bacteria 28303
291 Ga0496121_0002791 3300048924 Bacteria 25878
292 Ga0496121_0006576 3300048924 Bacteria 14344
293 Ga0496121_0007110 3300048924 Bacteria 13586
294 Ga0496121_0009657 3300048924 Bacteria 11051
295 Ga0496121_0011073 3300048924 Bacteria 10064
296 Ga0496121_0014137 3300048924 Bacteria 8504
297 Ga0496121_0017575 3300048924 Bacteria 7292
298 Ga0496121_0116594 3300048924 Bacteria 2025
299 Ga0496122_0000005 3300048925 Bacteria 630659
300 Ga0496122_0000110 3300048925 Bacteria 190142
301 Ga0496122_0001733 3300048925 Bacteria 33832
302 Ga0496122_0003163 3300048925 Bacteria 21971
303 Ga0496122_0008753 3300048925 Bacteria 10830
304 Ga0496122_0008934 3300048925 Bacteria 10659
305 Ga0496122_0013882 3300048925 Bacteria 7839
306 Ga0496122_0036870 3300048925 Bacteria 3945
307 Ga0496122_0053379 3300048925 Bacteria 3047
308 Ga0496122_0101817 3300048925 Bacteria 1917
309 Ga0496123_0000008 3300048926 Bacteria 630628
310 Ga0496123_0000081 3300048926 Bacteria 190142
311 Ga0496123_0001180 3300048926 Bacteria 38508
312 Ga0496123_0002658 3300048926 Bacteria 21604
313 Ga0496123_0003165 3300048926 Bacteria 18795
314 Ga0496123_0004613 3300048926 Bacteria 14336
315 Ga0496123_0006929 3300048926 Bacteria 10830
316 Ga0496123_0011714 3300048926 Bacteria 7564
317 Ga0496123_0019758 3300048926 Bacteria 5296
318 Ga0496123_0082611 3300048926 Bacteria 1946
319 Ga0496123_0115590 3300048926 Bacteria 1522
320 Ga0496124_0000066 3300048927 Bacteria 222815
321 Ga0496124_0000196 3300048927 Bacteria 119375
322 Ga0496124_0000199 3300048927 Bacteria 118647
323 Ga0496124_0000425 3300048927 Bacteria 75572
324 Ga0496124_0001064 3300048927 Bacteria 43365
325 Ga0496124_0002919 3300048927 Bacteria 21557
326 Ga0496124_0011009 3300048927 Bacteria 9084
327 Ga0496124_0011522 3300048927 Bacteria 8825
328 Ga0496124_0012744 3300048927 Bacteria 8265
329 Ga0496124_0012856 3300048927 Bacteria 8222
330 Ga0496124_0022183 3300048927 Bacteria 5829
331 Ga0496124_0028916 3300048927 Bacteria 4948
332 Ga0496124_0060139 3300048927 Bacteria 3188
333 Ga0496124_0120856 3300048927 Bacteria 2093
334 Ga0496124_0151839 3300048927 Bacteria 1816
335 Ga0496124_0249347 3300048927 Bacteria 1314
336 Ga0496125_0000009 3300048928 Bacteria 677678
337 Ga0496125_0000033 3300048928 Bacteria 351850
338 Ga0496125_0002253 3300048928 Bacteria 25624
339 Ga0496125_0006899 3300048928 Bacteria 12156
340 Ga0496125_0007926 3300048928 Bacteria 11213
341 Ga0496125_0008967 3300048928 Bacteria 10374
342 Ga0496125_0012428 3300048928 Bacteria 8453
343 Ga0496125_0017697 3300048928 Bacteria 6783
344 Ga0496125_0052763 3300048928 Bacteria 3341
345 Ga0496125_0057994 3300048928 Bacteria 3130
346 Ga0496125_0063959 3300048928 Bacteria 2929
347 Ga0496125_0152600 3300048928 Bacteria 1584
348 Ga0496126_0001084 3300048929 Bacteria 45796
349 Ga0496126_0001269 3300048929 Bacteria 40626
350 Ga0496126_0024781 3300048929 Bacteria 5785
351 Ga0496126_0041444 3300048929 Bacteria 4260
352 Ga0496126_0042012 3300048929 Bacteria 4226
353 Ga0496126_0043126 3300048929 Bacteria 4163
354 Ga0496126_0072657 3300048929 Bacteria 3059
355 Ga0496126_0122434 3300048929 Bacteria 2254
356 Ga0496126_0288093 3300048929 Bacteria 1359
357 Ga0495678_000354 3300049459 Bacteria 47217
358 Ga0495682_0000001 3300049460 Bacteria 1559116
359 nmdc:mga00v17_14820_c2 3300050491 Bacteria 2952
360 Ga0500621_000003 3300053126 Bacteria 596975
361 2506578286 2506520007 Bacteria 5442880
362 2506583424 2506520008 Bacteria 5443009
363 2508852295 2508501071 Bacteria 5454741
364 2511382790 2511231025 Bacteria 5324661
365 2511437671 2511231035 Bacteria 5341610
366 2548651226 2547132416 Bacteria 4633861
367 2555257574 2554235234 Bacteria 5762085
368 2585829641 2585427591 Bacteria 5482980
369 2585832853 2585427592 Bacteria 5370892
370 2603642624 2602042047 Bacteria 4697674
371 2603698335 2602042066 Bacteria 4423871
372 2603703215 2602042067 Bacteria 4863713
373 2603866592 2602042109 Bacteria 5152801
374 2608669382 2608642108 Bacteria 4104624
375 2637225535 2636415599 Bacteria 5718434
376 2671103148 2667528172 Bacteria 5170840
377 2671110001 2667528173 Bacteria 5375747
378 2671587567 2671180115 Bacteria 5353919
379 2681997701 2681812866 Bacteria 4552357
380 2682006772 2681812869 Bacteria 5014465
381 2689444837 2687453601 Bacteria 5546041
382 2712470031 2711768156 Bacteria 4471618
383 2753855778 2751185917 Bacteria 4551186
384 2765588775 2765235842 Bacteria 4799256
385 2772438868 2772190666 Bacteria 5117644
386 2775538780 2775506706 Bacteria 4873073
387 2777022891 2775507074 Bacteria 5532402
388 2793405700 2791355275 Bacteria 4429597
389 2807179535 2806310673 Bacteria 4801221
390 2821119585 2821118458 Bacteria 4714306
391 2823374566 2823373977 Bacteria 4779415
392 2844427332 2844425489 Bacteria 4854065
393 2844530833 2844528606 Bacteria 4733806
394 2846541246 2846540461 Bacteria 5471451
395 2847087742 2847085930 Bacteria 5070450
396 2852104835 2852103415 Bacteria 5193810
397 2865015205 2865014394 Bacteria 4764573
398 2869554244 2869551831 Bacteria 5474685
399 2876604332 2876601092 Bacteria 5114497
400 2884088953 2884086401 Bacteria 5005459
401 2888368890 2888366609 Bacteria 5155009
402 2888378086 2888373701 Bacteria 5098052
403 2891671734 2891670763 Bacteria 4967099
404 2904477167 2904474040 Bacteria 5504324
405 2904508606 2904504865 Bacteria 5152820
406 2904513604 2904513164 Bacteria 5476410
407 2908672383 2908669403 Bacteria 5740494
408 2919108771 2919108558 Bacteria 5897419
409 2919153334 2919150387 Bacteria 5500879
410 2919546239 2919543075 Bacteria 4728703
411 2923634652 2923634449 Bacteria 4753480
412 2927143960 2927143783 Bacteria 5504251
413 2927834298 2927833300 Bacteria 4923934
414 2932408122 2932406140 Bacteria 5134491
415 2935626844 2935625433 Bacteria 5042964
416 2937540362 2937539931 Bacteria 4639830
417 2937967484 2937967321 Bacteria 5094075
418 2939568992 2939568625 Bacteria 4542555
419 2939573720 2939573065 Bacteria 4926053
420 2939578579 2939577877 Bacteria 5132791
421 2939603403 2939602548 Bacteria 4950493
422 2939619413 2939617950 Bacteria 4820956
423 2939643960 2939642701 Bacteria 4475280
424 2945953045 2945951305 Bacteria 4918162
425 2969082531 2969079654 Bacteria 5439582
426 2971823341 2971820967 Bacteria 5823634
427 2974312302 2974310843 Bacteria 4947816
428 2974438291 2974435778 Bacteria 4876478
429 2984559589 2984559226 Bacteria 5683096
430 2984597676 2984595703 Bacteria 5682994
431 3000378794 3000376612 Bacteria 4705565
432 640937801 640753048 Bacteria 5495657
433 8004595777 8004592986 Bacteria 5122074
434 8015399356 8015394850 Bacteria 5064660
435 8016736016 8016733728 Bacteria 5274317
436 8018224745 8018221730 Bacteria 4616064
437 8018408331 8018405270 Bacteria 4978981
438 8019500585 8019499862 Bacteria 5169538
439 8019506297 8019504834 Bacteria 4819156
440 8054845720 8054844752 Bacteria 4450330
441 8054853086 8054849141 Bacteria 5232694
442 8055090955 8055087960 Bacteria 4784273
443 8055094585 8055092621 Bacteria 4873875
444 8055099961 8055097453 Bacteria 4865496
445 8055696153 8055693939 Bacteria 4772047
446 8057309381 8057304971 Bacteria 4649742
447 Ga0495650_0000204
448 SwRhRL2b_contig_2730796
449 JGI25162J39368_1000009
450 JGI25163J39215_1000112
451 JGI25164J39214_1000002
452 Ga0055538_1000015
453 Ga0055539_1000009
454 Ga0055533_1000012
455 Ga0055525_1000014
456 Ga0055541_1000006
457 Ga0058692_1001389
458 Ga0058692_1005219
459 Ga0058692_1005220
460 Ga0058692_1007258
461 Ga0058692_1007497
462 Ga0065704_10000115
463 Ga0065704_10000297
464 Ga0065704_10000854
465 Ga0070665_100003098
466 Ga0068857_100000773
467 Ga0075364_10005738
468 Ga0075364_10049223
469 Ga0075364_10098235
470 Ga0079104_1000083
471 Ga0079104_1000218
472 Ga0079104_1000263
473 Ga0079104_1000292
474 Ga0079104_1000716
475 Ga0079104_1000733
476 Ga0079104_1001695
477 Ga0079104_1002113
478 Ga0079104_1002449
479 Ga0105251_10000002
480 Ga0105251_10000189
481 Ga0105251_10001242
482 Ga0105251_10003141
483 Ga0105251_10004870
484 Ga0105251_10006273
485 Ga0105251_10011006
486 Ga0105251_10012464
487 Ga0105251_10016137
488 Ga0105244_10000015
489 Ga0105244_10002160
490 Ga0105244_10002576
491 Ga0105244_10003001
492 Ga0105244_10003258
493 Ga0105244_10006949
494 Ga0105244_10029148
495 Ga0105244_10075016
496 Ga0105244_10077551
497 Ga0105250_10000002
498 Ga0105250_10000072
499 Ga0105250_10000113
500 Ga0105250_10003290
501 Ga0105250_10004663
502 Ga0105250_10006318
503 Ga0105250_10018996
504 Ga0105247_10000320
505 Ga0105243_10060358
506 Ga0105241_10000002
507 Ga0105246_10021366
508 Ga0105246_10041146
509 Ga0157373_10000405
510 Ga0157373_10001029
511 Ga0157373_10015376
512 Ga0157371_10000008
513 Ga0157371_10002962
514 Ga0157371_10010131
515 Ga0157371_10027004
516 Ga0157370_10002375
517 Ga0157370_10003134
518 Ga0157369_10020840
519 Ga0157372_10076707
520 Ga0182006_1000047
521 Ga0182006_1024408
522 Ga0183366_1001
523 Ga0183370_1001
524 Ga0183369_1001
525 Ga0183368_1001
526 Ga0163161_10000001
527 Ga0209760_100120
528 Ga0209784_100001
529 Ga0209566_100001
530 Ga0209674_100002
531 Ga0209563_100002
532 Ga0207427_100020
533 Ga0209437_100001
534 Ga0209437_100073
535 Ga0209677_100002
536 Ga0209129_1000004
537 Ga0209233_1000610
538 Ga0207696_1000001
539 Ga0207696_1000005
540 Ga0207696_1000042
541 Ga0207696_1000218
542 Ga0207696_1000292
543 Ga0207696_1000398
544 Ga0207696_1001059
545 Ga0207696_1002113
546 Ga0207696_1003125
547 Ga0207696_1013996
548 Ga0207655_1000001
549 Ga0207655_1000009
550 Ga0207655_1000037
551 Ga0207655_1000061
552 Ga0207655_1000063
553 Ga0207655_1000373
554 Ga0207655_1001029
555 Ga0207655_1003246
556 Ga0207655_1005519
557 Ga0207713_1000001
558 Ga0207713_1000002
559 Ga0207713_1000003
560 Ga0207713_1000008
561 Ga0207713_1000016
562 Ga0207713_1000029
563 Ga0207713_1001124
564 Ga0207713_1001872
565 Ga0207713_1009037
566 Ga0207713_1014697
567 Ga0207713_1026145
568 Ga0207713_1040056
569 Ga0207710_10000113
570 Ga0207654_10000005
571 Ga0207657_10216616
572 Ga0207709_10037239
573 Ga0207709_10097551
574 Ga0207674_10003836
575 Ga0209281_1000001
576 Ga0209281_1000003
577 Ga0209281_1000006
578 Ga0209281_1000130
579 Ga0209281_1000181
580 Ga0209281_1000287
581 Ga0209281_1000414
582 Ga0209281_1000494
583 Ga0209281_1000638
584 Ga0209281_1001424
585 Ga0209281_1001749
586 Ga0209371_1000001
587 Ga0209371_1000005
588 Ga0209371_1000041
589 Ga0209371_1000212
590 Ga0209371_1001290
591 Ga0209371_1002237
592 Ga0209371_1004804
593 Ga0209371_1011563
594 Ga0268266_10001737
595 Ga0268256_1000001
596 Ga0268256_1000003
597 Ga0268256_1000006
598 Ga0268256_1001101
599 Ga0268256_1002885
600 Ga0268256_1011926
601 Ga0268256_1011927
602 Ga0268256_1012557
603 Ga0268256_1028824
604 Ga0439438_001385
605 Ga0439438_010039
606 Ga0439447_003034
607 Ga0439466_0000009
608 Ga0451853_3093388
609 Ga0439432_013185
610 Ga0439432_019692
611 Ga0439432_023040
612 Ga0439432_040182
613 Ga0439452_000002
614 Ga0439452_000028
615 Ga0439452_000246
616 Ga0439452_000493
617 Ga0450907_000597
618 Ga0466981_0000002
619 Ga0495627_000116
620 Ga0495591_000013
621 Ga0495591_000100
622 Ga0495591_000763
623 Ga0495591_001170
624 Ga0495638_0001608
625 Ga0495650_0000005
626 Ga0495650_0000043
627 Ga0495650_0016261
628 Ga0495584_0036764
629 Ga0495585_0007998
630 Ga0495596_0014544
631 Ga0495606_0002305
632 Ga0495620_0004508
633 Ga0495631_0045391
634 Ga0495648_0014312
635 Ga0495654_0000041
636 Ga0495654_0000167
637 Ga0495654_0004539
638 Ga0495654_0004607
639 Ga0495654_0025098
640 Ga0495609_0049290
641 Ga0495609_0063797
642 Ga0495597_0002127
643 Ga0495611_0057081
644 Ga0495625_0004823
645 Ga0495671_0008104
646 Ga0495649_0001040
647 Ga0495649_0003204
648 Ga0495589_0000001
649 Ga0495589_0060498
650 Ga0495660_0000012
651 Ga0495660_0000048
652 Ga0495660_0034009
653 Ga0495672_0000002
654 Ga0495672_0000020
655 Ga0495672_0000043
656 Ga0495683_0013394
657 Ga0495679_000018
658 Ga0495679_001854
659 Ga0495679_007690
660 Ga0495679_019407
661 Ga0495673_0000070
662 Ga0495673_0000167
663 Ga0496100_0074374
664 Ga0496100_0143490
665 Ga0496101_0000055
666 Ga0496102_0005316
667 Ga0496103_0150705
668 Ga0496104_0000091
669 Ga0496104_0000233
670 Ga0496104_0007416
671 Ga0496104_0308087
672 Ga0496105_0007743
673 Ga0496105_0007901
674 Ga0496105_0038424
675 Ga0496116_0000001
676 Ga0496116_0000066
677 Ga0496116_0000305
678 Ga0496116_0000822
679 Ga0496116_0017930
680 Ga0496116_0031503
681 Ga0496116_0031679
682 Ga0496117_0000020
683 Ga0496117_0000022
684 Ga0496117_0000453
685 Ga0496117_0001256
686 Ga0496117_0002666
687 Ga0496117_0003591
688 Ga0496117_0005868
689 Ga0496117_0009820
690 Ga0496117_0027200
691 Ga0496117_0032466
692 Ga0496117_0077455
693 Ga0496117_0139365
694 Ga0496117_0149664
695 Ga0496117_0151578
696 Ga0496118_0000007
697 Ga0496118_0000015
698 Ga0496118_0000085
699 Ga0496118_0004321
700 Ga0496118_0004655
701 Ga0496118_0004751
702 Ga0496118_0005928
703 Ga0496118_0038875
704 Ga0496118_0088942
705 Ga0496118_0103092
706 Ga0496118_0109227
707 Ga0496118_0124106
708 Ga0496119_0000001
709 Ga0496119_0000570
710 Ga0496119_0002980
711 Ga0496119_0004522
712 Ga0496119_0004672
713 Ga0496119_0008290
714 Ga0496119_0008327
715 Ga0496119_0008708
716 Ga0496119_0067806
717 Ga0496119_0088649
718 Ga0496119_0097431
719 Ga0496119_0115644
720 Ga0496120_0000016
721 Ga0496120_0000952
722 Ga0496120_0001357
723 Ga0496120_0001569
724 Ga0496120_0003772
725 Ga0496120_0004407
726 Ga0496120_0008528
727 Ga0496120_0009525
728 Ga0496120_0019382
729 Ga0496120_0024080
730 Ga0496120_0024401
731 Ga0496120_0025123
732 Ga0496120_0060577
733 Ga0496120_0064680
734 Ga0496120_0103955
735 Ga0496120_0129757
736 Ga0496121_0002456
737 Ga0496121_0002791
738 Ga0496121_0006576
739 Ga0496121_0007110
740 Ga0496121_0009657
741 Ga0496121_0011073
742 Ga0496121_0014137
743 Ga0496121_0017575
744 Ga0496121_0116594
745 Ga0496122_0000005
746 Ga0496122_0000110
747 Ga0496122_0001733
748 Ga0496122_0003163
749 Ga0496122_0008753
750 Ga0496122_0008934
751 Ga0496122_0013882
752 Ga0496122_0036870
753 Ga0496122_0053379
754 Ga0496122_0101817
755 Ga0496123_0000008
756 Ga0496123_0000081
757 Ga0496123_0001180
758 Ga0496123_0002658
759 Ga0496123_0003165
760 Ga0496123_0004613
761 Ga0496123_0006929
762 Ga0496123_0011714
763 Ga0496123_0019758
764 Ga0496123_0082611
765 Ga0496123_0115590
766 Ga0496124_0000066
767 Ga0496124_0000196
768 Ga0496124_0000199
769 Ga0496124_0000425
770 Ga0496124_0001064
771 Ga0496124_0002919
772 Ga0496124_0011009
773 Ga0496124_0011522
774 Ga0496124_0012744
775 Ga0496124_0012856
776 Ga0496124_0022183
777 Ga0496124_0028916
778 Ga0496124_0060139
779 Ga0496124_0120856
780 Ga0496124_0151839
781 Ga0496124_0249347
782 Ga0496125_0000009
783 Ga0496125_0000033
784 Ga0496125_0002253
785 Ga0496125_0006899
786 Ga0496125_0007926
787 Ga0496125_0008967
788 Ga0496125_0012428
789 Ga0496125_0017697
790 Ga0496125_0052763
791 Ga0496125_0057994
792 Ga0496125_0063959
793 Ga0496125_0152600
794 Ga0496126_0001084
795 Ga0496126_0001269
796 Ga0496126_0024781
797 Ga0496126_0041444
798 Ga0496126_0042012
799 Ga0496126_0043126
800 Ga0496126_0072657
801 Ga0496126_0122434
802 Ga0496126_0288093
803 Ga0495678_000354
804 Ga0495682_0000001
805 nmdc:mga00v17_14820_c2
806 Ga0500621_000003
807 2506578286
808 2506583424
809 2508852295
810 2511382790
811 2511437671
812 2548651226
813 2555257574
814 2585829641
815 2585832853
816 2603642624
817 2603698335
818 2603703215
819 2603866592
820 2608669382
821 2637225535
822 2671103148
823 2671110001
824 2671587567
825 2681997701
826 2682006772
827 2689444837
828 2712470031
829 2753855778
830 2765588775
831 2772438868
832 2775538780
833 2777022891
834 2793405700
835 2807179535
836 2821119585
837 2823374566
838 2844427332
839 2844530833
840 2846541246
841 2847087742
842 2852104835
843 2865015205
844 2869554244
845 2876604332
846 2884088953
847 2888368890
848 2888378086
849 2891671734
850 2904477167
851 2904508606
852 2904513604
853 2908672383
854 2919108771
855 2919153334
856 2919546239
857 2923634652
858 2927143960
859 2927834298
860 2932408122
861 2935626844
862 2937540362
863 2937967484
864 2939568992
865 2939573720
866 2939578579
867 2939603403
868 2939619413
869 2939643960
870 2945953045
871 2969082531
872 2971823341
873 2974312302
874 2974438291
875 2984559589
876 2984597676
877 3000378794
878 640937801
879 8004595777
880 8015399356
881 8016736016
882 8018224745
883 8018408331
884 8019500585
885 8019506297
886 8054845720
887 8054853086
888 8055090955
889 8055094585
890 8055099961
891 8055696153
892 8057309381

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

52

406

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1d2f-assembly1.cif.gz_A x-ray structure of maly from escherichia coli: a pyridoxal-5'-phosphate-dependent enzyme acting as a modulator in mal gene expression 0.9888 30 390
8bob-assembly1.cif.gz_B structural basis for negative regulation of the maltose system 0.9861 1 390
1d2f-assembly1.cif.gz_A x-ray structure of maly from escherichia coli: a pyridoxal-5'-phosphate-dependent enzyme acting as a modulator in mal gene expression 0.9861 30 390
6qp3-assembly2.cif.gz_C crystal structure of the plp-bound c-s lyase from bacillus subtilis (strain 168) 0.9629 2 385
6qp3-assembly2.cif.gz_C crystal structure of the plp-bound c-s lyase from bacillus subtilis (strain 168) 0.9556 2 385
ID Description Score Start End Superfamily
af_P23256_285_389_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 1.005 286 388 3.90.1150.10
1d2fA01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9967 285 390 3.90.1150.10
1d2fB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9872 42 283 3.40.640.10
1d2fB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9792 42 283 3.40.640.10
af_P23256_285_389_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9759 286 388 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A242HBR9-F1-model_v4 deleted 0.972 1 389
AF-A0A6B1XCA5-F1-model_v4 cysteine-S-conjugate beta-lyase (EC 4.4.1.13) 0.9689 150 387 GO:0008483
GO:0009058
GO:0016829
GO:0030170
AF-A0A165S0L9-F1-model_v4 cysteine-S-conjugate beta-lyase (EC 4.4.1.13) 0.9678 1 266 GO:0009058
GO:0016829
GO:0030170
AF-A0A242HBR9-F1-model_v4 deleted 0.9671 1 389
AF-A0A1F9L863-F1-model_v4 cysteine-S-conjugate beta-lyase (EC 4.4.1.13) 0.9636 3 388 GO:0009058
GO:0016829
GO:0030170

Map