F445789

General Info

Members Datasets Scaffolds Average Seq Length
446 237 892 432

Family's Representative Sequence

Representative Sequence 3300046474|Ga0495605_0049018|Ga0495605_0049018_482_1777
Length 431
Sequence MMSTRAAESPRLPGAGERVLQGKSRWGVIPFLGPAFIACVAYMDPGNFATNIAGGSKFGFTLVWVIVASNLMAMLIQTLSAKLGIATGRNLPEVCRERFSRRTSIGLWIQAELIAMATDLAEFLGAALGIKLLLHIQLFPAAVITGVITFLILGLQRYGFRPLEAVITAFIAVIGICYLAELWFAHPPLGEVAKHAVVPDFAGSESVLLAVGIIGATVMPHVIYLHSALTQNRVVPRNDDEAKRLYRYTRIDVLIAMLIAGLINMAMLVVAATVFFESGLTNVDSLEGAHRTLEPLLGGASSVLFALALTASGLSSSAVGTMSGQVVMQGFIQRRIPLFVRRLVTMIPAFVVIAIQGDGDVSRTLVISQVVLSFGIPFALIPLVMFTSRRDIMGVLVNARLTIAAAVGVAAIISALNIFLLAQTFGLLGSG

Samples

Sample ID Description Type Environment
1 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
130 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
131 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
132 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
133 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
134 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
135 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
138 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
139 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
140 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
141 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
142 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
143 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
144 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
150 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
169 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
170 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
173 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
180 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
183 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
184 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
185 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
186 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
187 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
188 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
189 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
194 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
195 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
196 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
202 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
221 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
222 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
223 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
226 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
232 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
233 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
234 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.04
Nodule 0
Rhizoplane 16.37
Rhizosphere 78.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495605_0049018 3300046474 Bacteria 2065
2 JGI24740J21852_10003186 3300001979 Bacteria 7243
3 Ga0070658_10017126 3300005327 Bacteria 5799
4 Ga0070683_100003109 3300005329 Bacteria 13374
5 Ga0070683_100012149 3300005329 Bacteria 7473
6 Ga0070683_100012949 3300005329 Bacteria 7260
7 Ga0070683_100016966 3300005329 Bacteria 6426
8 Ga0070690_100003538 3300005330 Bacteria 8563
9 Ga0070677_10000022 3300005333 Bacteria 45355
10 Ga0070666_10027363 3300005335 Bacteria 3734
11 Ga0070682_100000099 3300005337 Bacteria 77574
12 Ga0070682_100040412 3300005337 Bacteria 2870
13 Ga0070682_100045299 3300005337 Bacteria 2726
14 Ga0068868_100000450 3300005338 Bacteria 27515
15 Ga0068868_100013140 3300005338 Bacteria 6065
16 Ga0068868_100016195 3300005338 Bacteria 5531
17 Ga0070660_100105097 3300005339 Bacteria 2240
18 Ga0070691_10000379 3300005341 Bacteria 16112
19 Ga0070661_100000102 3300005344 Bacteria 69941
20 Ga0070661_100157146 3300005344 Bacteria 1721
21 Ga0070692_10020205 3300005345 Bacteria 3227
22 Ga0070668_100020258 3300005347 Bacteria 5018
23 Ga0070675_100000027 3300005354 Bacteria 106172
24 Ga0070674_100000090 3300005356 Bacteria 42115
25 Ga0070674_100000683 3300005356 Bacteria 17159
26 Ga0070673_100005169 3300005364 Bacteria 8331
27 Ga0070673_100183158 3300005364 Bacteria 1794
28 Ga0070688_100000738 3300005365 Bacteria 16106
29 Ga0070688_100003810 3300005365 Bacteria 7820
30 Ga0070688_100007428 3300005365 Bacteria 5908
31 Ga0070659_100061011 3300005366 Bacteria 2979
32 Ga0070713_100306158 3300005436 Bacteria 1464
33 Ga0070710_10012125 3300005437 Bacteria 4272
34 Ga0070701_10008254 3300005438 Bacteria 4494
35 Ga0070711_100000734 3300005439 Bacteria 17090
36 Ga0070711_100090241 3300005439 Bacteria 2207
37 Ga0070700_100003530 3300005441 Bacteria 8067
38 Ga0070700_100003961 3300005441 Bacteria 7691
39 Ga0070694_100024513 3300005444 Bacteria 3893
40 Ga0070663_100010392 3300005455 Bacteria 5801
41 Ga0070678_100001355 3300005456 Bacteria 13027
42 Ga0070678_100142066 3300005456 Bacteria 1922
43 Ga0070662_100000004 3300005457 Bacteria 195534
44 Ga0070681_10083373 3300005458 Bacteria 3150
45 Ga0068867_100000796 3300005459 Bacteria 21356
46 Ga0070685_10000141 3300005466 Bacteria 46333
47 Ga0070685_10000616 3300005466 Bacteria 19644
48 Ga0070685_10035052 3300005466 Bacteria 2830
49 Ga0070685_10122448 3300005466 Bacteria 1617
50 Ga0070706_100015559 3300005467 Bacteria 7027
51 Ga0070706_100025446 3300005467 Bacteria 5447
52 Ga0070707_100004648 3300005468 Bacteria 12854
53 Ga0070699_100019861 3300005518 Bacteria 5792
54 Ga0070679_100000243 3300005530 Bacteria 45435
55 Ga0070684_100042950 3300005535 Bacteria 3904
56 Ga0068853_100003775 3300005539 Bacteria 11609
57 Ga0070672_100031007 3300005543 Bacteria 4021
58 Ga0070686_100000601 3300005544 Bacteria 21265
59 Ga0070665_100000106 3300005548 Bacteria 157315
60 Ga0070665_100000950 3300005548 Bacteria 36935
61 Ga0070665_100037770 3300005548 Bacteria 4855
62 Ga0070665_100124655 3300005548 Bacteria 2578
63 Ga0070664_100033040 3300005564 Bacteria 4330
64 Ga0070664_100050508 3300005564 Bacteria 3520
65 Ga0070664_100168855 3300005564 Bacteria 1940
66 Ga0068854_100000156 3300005578 Bacteria 46593
67 Ga0068856_100000629 3300005614 Bacteria 38394
68 Ga0068856_100007081 3300005614 Bacteria 10950
69 Ga0068856_100009027 3300005614 Bacteria 9700
70 Ga0070702_100008617 3300005615 Bacteria 4949
71 Ga0068852_100000006 3300005616 Bacteria 159569
72 Ga0068866_10000001 3300005718 Bacteria 519680
73 Ga0068866_10000685 3300005718 Bacteria 15430
74 Ga0068866_10012660 3300005718 Bacteria 3681
75 Ga0068866_10032932 3300005718 Bacteria 2509
76 Ga0068866_10057774 3300005718 Bacteria 2001
77 Ga0068866_10087580 3300005718 Bacteria 1688
78 Ga0068861_100025203 3300005719 Bacteria 4311
79 Ga0068861_100139096 3300005719 Bacteria 1980
80 Ga0068851_10001416 3300005834 Bacteria 10485
81 Ga0068863_100000342 3300005841 Bacteria 47536
82 Ga0068858_100000009 3300005842 Bacteria 237748
83 Ga0068860_100075111 3300005843 Bacteria 3215
84 Ga0081455_10007955 3300005937 Bacteria 11088
85 Ga0081540_1000449 3300005983 Bacteria 40724
86 Ga0081539_10000246 3300005985 Bacteria 127353
87 Ga0081539_10019737 3300005985 Bacteria 4597
88 Ga0075365_10001932 3300006038 Bacteria 9782
89 Ga0075365_10002660 3300006038 Bacteria 8870
90 Ga0075365_10007452 3300006038 Bacteria 6128
91 Ga0075365_10031523 3300006038 Bacteria 3401
92 Ga0075365_10075182 3300006038 Bacteria 2279
93 Ga0075363_100077146 3300006048 Bacteria 1818
94 Ga0075364_10006609 3300006051 Bacteria 6827
95 Ga0075364_10009364 3300006051 Bacteria 5872
96 Ga0075364_10013659 3300006051 Bacteria 5000
97 Ga0075364_10124272 3300006051 Bacteria 1729
98 Ga0070715_10000001 3300006163 Bacteria 693690
99 Ga0070716_100031197 3300006173 Bacteria 2897
100 Ga0070712_100019861 3300006175 Bacteria 4391
101 Ga0070712_100021026 3300006175 Bacteria 4278
102 Ga0097621_100005876 3300006237 Bacteria 8669
103 Ga0097621_100136682 3300006237 Bacteria 2091
104 Ga0075431_100000536 3300006847 Bacteria 31867
105 Ga0075434_100001678 3300006871 Bacteria 18909
106 Ga0075434_100155239 3300006871 Bacteria 2308
107 Ga0111539_10005066 3300009094 Bacteria 17115
108 Ga0105245_10000020 3300009098 Bacteria 181774
109 Ga0105245_10000254 3300009098 Bacteria 50918
110 Ga0105245_10010405 3300009098 Bacteria 8101
111 Ga0105245_10019458 3300009098 Bacteria 5948
112 Ga0114129_10006865 3300009147 Bacteria 16187
113 Ga0114129_10166647 3300009147 Bacteria 3006
114 Ga0105243_10006240 3300009148 Bacteria 9212
115 Ga0105243_10012846 3300009148 Bacteria 6328
116 Ga0105242_10000032 3300009176 Bacteria 98198
117 Ga0105242_10000454 3300009176 Bacteria 32662
118 Ga0105248_10071294 3300009177 Bacteria 3903
119 Ga0105238_10000011 3300009551 Bacteria 261080
120 Ga0105238_10166005 3300009551 Bacteria 2183
121 Ga0105249_10000080 3300009553 Bacteria 138080
122 Ga0105239_10003834 3300010375 Bacteria 18258
123 Ga0105239_10152616 3300010375 Bacteria 2578
124 Ga0105239_10184946 3300010375 Bacteria 2332
125 Ga0157369_10000020 3300013105 Bacteria 241679
126 Ga0157374_10001772 3300013296 Bacteria 18163
127 Ga0157378_10066419 3300013297 Bacteria 3231
128 Ga0163162_10000583 3300013306 Bacteria 33791
129 Ga0157372_10000112 3300013307 Bacteria 85902
130 Ga0157375_10037053 3300013308 Bacteria 4670
131 Ga0157375_10055094 3300013308 Bacteria 3919
132 Ga0157375_10063321 3300013308 Bacteria 3679
133 Ga0157375_10064237 3300013308 Bacteria 3654
134 Ga0157379_10003159 3300014968 Bacteria 13936
135 Ga0157376_10005263 3300014969 Bacteria 9036
136 Ga0163161_10002086 3300017792 Bacteria 14485
137 Ga0207682_10000005 3300025893 Bacteria 95617
138 Ga0207642_10000002 3300025899 Bacteria 658166
139 Ga0207642_10000281 3300025899 Bacteria 15233
140 Ga0207642_10004706 3300025899 Bacteria 4411
141 Ga0207710_10000458 3300025900 Bacteria 26155
142 Ga0207688_10046442 3300025901 Bacteria 2425
143 Ga0207647_10096381 3300025904 Bacteria 1760
144 Ga0207685_10000027 3300025905 Bacteria 102101
145 Ga0207705_10032908 3300025909 Bacteria 3705
146 Ga0207707_10072992 3300025912 Bacteria 2992
147 Ga0207693_10000778 3300025915 Bacteria 28589
148 Ga0207693_10005539 3300025915 Bacteria 10504
149 Ga0207693_10015289 3300025915 Bacteria 6159
150 Ga0207663_10000498 3300025916 Bacteria 17164
151 Ga0207663_10020039 3300025916 Bacteria 3782
152 Ga0207660_10008386 3300025917 Bacteria 6684
153 Ga0207657_10009635 3300025919 Bacteria 9691
154 Ga0207649_10000009 3300025920 Bacteria 295544
155 Ga0207652_10002027 3300025921 Bacteria 17455
156 Ga0207652_10015699 3300025921 Bacteria 6168
157 Ga0207646_10000865 3300025922 Bacteria 39159
158 Ga0207694_10000004 3300025924 Bacteria 967075
159 Ga0207659_10000010 3300025926 Bacteria 286639
160 Ga0207659_10059348 3300025926 Bacteria 2750
161 Ga0207687_10000007 3300025927 Bacteria 604185
162 Ga0207687_10000013 3300025927 Bacteria 299826
163 Ga0207687_10002226 3300025927 Bacteria 13218
164 Ga0207687_10005882 3300025927 Bacteria 8110
165 Ga0207687_10040263 3300025927 Bacteria 3203
166 Ga0207687_10066105 3300025927 Bacteria 2569
167 Ga0207687_10084410 3300025927 Bacteria 2302
168 Ga0207700_10000027 3300025928 Bacteria 137708
169 Ga0207664_10024144 3300025929 Bacteria 4567
170 Ga0207706_10000012 3300025933 Bacteria 195475
171 Ga0207686_10000048 3300025934 Bacteria 115595
172 Ga0207686_10000447 3300025934 Bacteria 27400
173 Ga0207709_10029668 3300025935 Bacteria 3175
174 Ga0207669_10000018 3300025937 Bacteria 114254
175 Ga0207669_10000096 3300025937 Bacteria 44213
176 Ga0207669_10093578 3300025937 Bacteria 1964
177 Ga0207704_10000159 3300025938 Bacteria 36005
178 Ga0207665_10044289 3300025939 Bacteria 2978
179 Ga0207665_10045813 3300025939 Bacteria 2929
180 Ga0207691_10005986 3300025940 Bacteria 11745
181 Ga0207691_10015355 3300025940 Bacteria 7285
182 Ga0207711_10000006 3300025941 Bacteria 792692
183 Ga0207661_10000253 3300025944 Bacteria 34627
184 Ga0207661_10000347 3300025944 Bacteria 29715
185 Ga0207661_10011874 3300025944 Bacteria 6327
186 Ga0207679_10208271 3300025945 Bacteria 1638
187 Ga0207651_10033652 3300025960 Bacteria 3308
188 Ga0207651_10156507 3300025960 Bacteria 1781
189 Ga0207712_10000007 3300025961 Bacteria 539589
190 Ga0207712_10003829 3300025961 Bacteria 9499
191 Ga0207640_10000038 3300025981 Bacteria 108630
192 Ga0207640_10003186 3300025981 Bacteria 8830
193 Ga0207677_10000200 3300026023 Bacteria 48320
194 Ga0207677_10013068 3300026023 Bacteria 4797
195 Ga0207703_10000023 3300026035 Bacteria 222018
196 Ga0207639_10108827 3300026041 Bacteria 2254
197 Ga0207708_10000468 3300026075 Bacteria 31201
198 Ga0207708_10005074 3300026075 Bacteria 9711
199 Ga0207702_10000158 3300026078 Bacteria 79984
200 Ga0207702_10004125 3300026078 Bacteria 13025
201 Ga0207702_10074400 3300026078 Bacteria 2932
202 Ga0207641_10000238 3300026088 Bacteria 71152
203 Ga0207648_10008647 3300026089 Bacteria 9832
204 Ga0207674_10238110 3300026116 Bacteria 1767
205 Ga0207675_100050607 3300026118 Bacteria 3876
206 Ga0207675_100160408 3300026118 Bacteria 2145
207 Ga0207683_10000041 3300026121 Bacteria 94017
208 Ga0207683_10004283 3300026121 Bacteria 12324
209 Ga0207683_10106454 3300026121 Bacteria 2508
210 Ga0207683_10181464 3300026121 Bacteria 1908
211 Ga0207698_10000013 3300026142 Bacteria 255414
212 Ga0207698_10049913 3300026142 Bacteria 3188
213 Ga0207698_10051367 3300026142 Bacteria 3152
214 Ga0207428_10021246 3300027907 Bacteria 5497
215 Ga0268266_10000047 3300028379 Bacteria 310996
216 Ga0268266_10006385 3300028379 Bacteria 10799
217 Ga0268266_10109698 3300028379 Bacteria 2444
218 Ga0268265_10255098 3300028380 Bacteria 1556
219 Ga0265337_1000807 3300028556 Bacteria 16498
220 Ga0265326_10000252 3300028558 Bacteria 25133
221 Ga0265319_1000020 3300028563 Bacteria 153921
222 Ga0265319_1002134 3300028563 Bacteria 11067
223 Ga0265318_10000604 3300028577 Bacteria 25020
224 Ga0265318_10000968 3300028577 Bacteria 18432
225 Ga0265323_10006182 3300028653 Bacteria 5049
226 Ga0265322_10000001 3300028654 Bacteria 543854
227 Ga0265336_10021526 3300028666 Bacteria 2060
228 Ga0265338_10001248 3300028800 Bacteria 41926
229 Ga0265338_10006184 3300028800 Bacteria 15349
230 Ga0265324_10000755 3300029957 Bacteria 21443
231 Ga0265330_10003122 3300031235 Bacteria 8773
232 Ga0265328_10000719 3300031239 Bacteria 15346
233 Ga0265328_10001094 3300031239 Bacteria 12441
234 Ga0265320_10000002 3300031240 Bacteria 542875
235 Ga0265325_10002559 3300031241 Bacteria 12232
236 Ga0265325_10027972 3300031241 Bacteria 3044
237 Ga0265329_10010994 3300031242 Bacteria 3303
238 Ga0265340_10002638 3300031247 Bacteria 10198
239 Ga0265331_10007296 3300031250 Bacteria 6406
240 Ga0265331_10009837 3300031250 Bacteria 5330
241 Ga0265327_10000011 3300031251 Bacteria 543807
242 Ga0265327_10006079 3300031251 Bacteria 9793
243 Ga0265327_10015893 3300031251 Bacteria 4822
244 Ga0265316_10002341 3300031344 Bacteria 19753
245 Ga0265316_10011610 3300031344 Bacteria 7932
246 Ga0265313_10050483 3300031595 Bacteria 1995
247 Ga0265314_10000062 3300031711 Bacteria 159496
248 Ga0265314_10007971 3300031711 Bacteria 9136
249 Ga0265314_10012920 3300031711 Bacteria 6781
250 Ga0265342_10029532 3300031712 Bacteria 3403
251 Ga0316578_10024138 3300031728 Bacteria 3410
252 Ga0307416_100215792 3300032002 Bacteria 1835
253 Ga0373943_0077568 3300035170 Bacteria 1697
254 Ga0395899_0244141 3300037312 Bacteria 1235
255 Ga0395900_0002249 3300037418 Bacteria 21466
256 Ga0395900_0014396 3300037418 Bacteria 8073
257 Ga0395898_0001408 3300037466 Bacteria 34249
258 Ga0395898_0035326 3300037466 Bacteria 4972
259 Ga0395898_0088007 3300037466 Bacteria 2991
260 Ga0395905_0004021 3300037471 Bacteria 15433
261 Ga0436364_1554384 3300037853 Bacteria 1642
262 Ga0395901_0000809 3300038443 Bacteria 34767
263 Ga0395901_0004783 3300038443 Bacteria 13666
264 Ga0395901_0028296 3300038443 Bacteria 5764
265 Ga0395901_0085659 3300038443 Bacteria 3294
266 Ga0451577_0000243 3300042876 Bacteria 107789
267 Ga0466963_0000153 3300044694 Bacteria 27553
268 Ga0453684_0000804 3300044712 Bacteria 106902
269 Ga0466957_0044462 3300044842 Bacteria 2691
270 Ga0466958_0030687 3300045836 Bacteria 3194
271 Ga0466967_0000009 3300045976 Bacteria 122610
272 Ga0466967_0001283 3300045976 Bacteria 14292
273 Ga0495592_0102659 3300046454 Bacteria 2035
274 Ga0495603_0001462 3300046455 Bacteria 13743
275 Ga0495603_0081390 3300046455 Bacteria 1897
276 Ga0495629_0003113 3300046459 Bacteria 12579
277 Ga0495629_0045971 3300046459 Bacteria 3063
278 Ga0495641_0000228 3300046461 Bacteria 43671
279 Ga0495641_0076043 3300046461 Bacteria 1505
280 Ga0495582_0000081 3300046473 Bacteria 48557
281 Ga0495662_0094228 3300046476 Bacteria 1462
282 Ga0495594_0000029 3300046499 Bacteria 66789
283 Ga0495594_0061289 3300046499 Bacteria 2082
284 Ga0495606_0000072 3300046507 Bacteria 173678
285 Ga0495608_0000060 3300046511 Bacteria 88189
286 Ga0495608_0000529 3300046511 Bacteria 26174
287 Ga0495618_0000008 3300046514 Bacteria 204578
288 Ga0495620_0000824 3300046515 Bacteria 19119
289 Ga0495628_0009655 3300046516 Bacteria 8232
290 Ga0495628_0041865 3300046516 Bacteria 3655
291 Ga0495628_0122216 3300046516 Bacteria 1996
292 Ga0495630_0000020 3300046517 Bacteria 176389
293 Ga0495630_0139721 3300046517 Bacteria 1841
294 Ga0495652_0000407 3300046529 Bacteria 50232
295 Ga0495652_0045375 3300046529 Bacteria 3779
296 Ga0495586_0071704 3300046535 Bacteria 1893
297 Ga0495587_0019281 3300046536 Bacteria 4224
298 Ga0495645_0006445 3300046543 Bacteria 8142
299 Ga0495645_0019986 3300046543 Bacteria 4828
300 Ga0495622_0000550 3300046557 Bacteria 22511
301 Ga0495667_0000018 3300046559 Bacteria 188610
302 Ga0495634_0015499 3300046642 Bacteria 5475
303 Ga0495634_0132262 3300046642 Bacteria 1589
304 Ga0495635_0000044 3300046663 Bacteria 83945
305 Ga0495588_0000134 3300046674 Bacteria 117581
306 Ga0495657_0000004 3300046675 Bacteria 266465
307 Ga0495657_0022928 3300046675 Bacteria 4468
308 Ga0495657_0051214 3300046675 Bacteria 2773
309 Ga0495599_0018403 3300046678 Bacteria 4352
310 Ga0495647_0000018 3300046681 Bacteria 81701
311 Ga0495647_0000156 3300046681 Bacteria 17539
312 Ga0495658_0000034 3300046683 Bacteria 69176
313 Ga0495669_0014521 3300046684 Bacteria 3365
314 Ga0495669_0018748 3300046684 Bacteria 2978
315 Ga0495613_0000801 3300046689 Bacteria 24391
316 Ga0495613_0004320 3300046689 Bacteria 10639
317 Ga0495613_0071867 3300046689 Bacteria 2522
318 Ga0495613_0090691 3300046689 Bacteria 2214
319 Ga0495624_0000647 3300046690 Bacteria 27259
320 Ga0495624_0002509 3300046690 Bacteria 13903
321 Ga0495624_0088870 3300046690 Bacteria 1907
322 Ga0495649_0008541 3300046694 Bacteria 6154
323 Ga0495600_0099031 3300046809 Bacteria 1900
324 Ga0495581_0013243 3300047315 Bacteria 4783
325 Ga0495604_0000055 3300047317 Bacteria 100430
326 Ga0495604_0000137 3300047317 Bacteria 62542
327 Ga0495604_0009878 3300047317 Bacteria 7555
328 Ga0495674_0000064 3300047319 Bacteria 71275
329 Ga0495674_0112482 3300047319 Bacteria 2307
330 Ga0495676_0000130 3300047321 Bacteria 56693
331 Ga0495676_0021340 3300047321 Bacteria 5660
332 Ga0495676_0117044 3300047321 Bacteria 1945
333 Ga0495680_0000550 3300047322 Bacteria 42291
334 Ga0495680_0003958 3300047322 Bacteria 14324
335 Ga0495680_0004286 3300047322 Bacteria 13686
336 Ga0495675_0000842 3300047444 Bacteria 18758
337 Ga0495679_010145 3300047446 Bacteria 3718
338 Ga0495602_0000041 3300048088 Bacteria 126954
339 Ga0495602_0013815 3300048088 Bacteria 8231
340 Ga0496100_0000002 3300048903 Bacteria 489057
341 Ga0496100_0000005 3300048903 Bacteria 312112
342 Ga0496100_0003241 3300048903 Bacteria 8456
343 Ga0496100_0005439 3300048903 Bacteria 6860
344 Ga0496101_0000001 3300048904 Bacteria 489057
345 Ga0496101_0000101 3300048904 Bacteria 89424
346 Ga0496101_0002936 3300048904 Bacteria 10480
347 Ga0496101_0013582 3300048904 Bacteria 5460
348 Ga0496102_0000115 3300048905 Bacteria 114224
349 Ga0496102_0005991 3300048905 Bacteria 10353
350 Ga0496102_0012047 3300048905 Bacteria 7473
351 Ga0496103_0000008 3300048906 Bacteria 340474
352 Ga0496103_0001248 3300048906 Bacteria 17374
353 Ga0496104_0000004 3300048907 Bacteria 641830
354 Ga0496104_0000009 3300048907 Bacteria 488055
355 Ga0496104_0006952 3300048907 Bacteria 9977
356 Ga0496104_0011990 3300048907 Bacteria 7776
357 Ga0496105_0000001 3300048908 Bacteria 1328178
358 Ga0496105_0000007 3300048908 Bacteria 339658
359 Ga0496105_0000650 3300048908 Bacteria 23286
360 Ga0496105_0002671 3300048908 Bacteria 12983
361 Ga0496105_0062754 3300048908 Bacteria 3066
362 Ga0496106_0000084 3300048909 Bacteria 74135
363 Ga0496106_0000151 3300048909 Bacteria 51430
364 Ga0496106_0000682 3300048909 Bacteria 24335
365 Ga0496106_0003662 3300048909 Bacteria 11458
366 Ga0496106_0004801 3300048909 Bacteria 9999
367 Ga0496106_0109106 3300048909 Bacteria 2153
368 Ga0496107_0000003 3300048910 Bacteria 304038
369 Ga0496107_0000011 3300048910 Bacteria 201631
370 Ga0496107_0005800 3300048910 Bacteria 8453
371 Ga0496107_0006797 3300048910 Bacteria 7878
372 Ga0496107_0009590 3300048910 Bacteria 6713
373 Ga0496108_0000001 3300048911 Bacteria 919044
374 Ga0496108_0000175 3300048911 Bacteria 59373
375 Ga0496108_0029134 3300048911 Bacteria 4570
376 Ga0496108_0070281 3300048911 Bacteria 2954
377 Ga0496108_0294858 3300048911 Bacteria 1412
378 Ga0496109_0000003 3300048912 Bacteria 420862
379 Ga0496109_0000121 3300048912 Bacteria 81487
380 Ga0496109_0000249 3300048912 Bacteria 51718
381 Ga0496109_0002789 3300048912 Bacteria 14634
382 Ga0496109_0004424 3300048912 Bacteria 11742
383 Ga0496109_0004990 3300048912 Bacteria 11082
384 Ga0496109_0013347 3300048912 Bacteria 7122
385 Ga0496109_0121266 3300048912 Bacteria 2436
386 Ga0496110_0000021 3300048913 Bacteria 77064
387 Ga0496110_0004679 3300048913 Bacteria 10644
388 Ga0496110_0023470 3300048913 Bacteria 5247
389 Ga0496110_0028592 3300048913 Bacteria 4790
390 Ga0496110_0080736 3300048913 Bacteria 2898
391 Ga0496111_0000009 3300048914 Bacteria 93943
392 Ga0496111_0011152 3300048914 Bacteria 6050
393 Ga0496111_0019839 3300048914 Bacteria 4675
394 Ga0496111_0094164 3300048914 Bacteria 2197
395 Ga0496112_0000006 3300048915 Bacteria 365227
396 Ga0496112_0056312 3300048915 Bacteria 3869
397 Ga0496112_0067246 3300048915 Bacteria 3537
398 Ga0496112_0075670 3300048915 Bacteria 3329
399 Ga0496112_0085412 3300048915 Bacteria 3122
400 Ga0496112_0108075 3300048915 Bacteria 2752
401 Ga0496112_0205549 3300048915 Bacteria 1927
402 Ga0496113_0000004 3300048916 Bacteria 109489
403 Ga0496114_0000101 3300048917 Bacteria 61589
404 Ga0496114_0002457 3300048917 Bacteria 14154
405 Ga0496114_0012931 3300048917 Bacteria 6686
406 Ga0496114_0024341 3300048917 Bacteria 4940
407 Ga0496114_0054067 3300048917 Bacteria 3347
408 Ga0496114_0066853 3300048917 Bacteria 3015
409 Ga0496115_0000003 3300048918 Bacteria 354994
410 Ga0496115_0000200 3300048918 Bacteria 55755
411 Ga0496115_0005151 3300048918 Bacteria 9511
412 Ga0496115_0057641 3300048918 Bacteria 3124
413 Ga0496116_0000735 3300048919 Bacteria 41771
414 Ga0496118_0093077 3300048921 Bacteria 2066
415 Ga0496119_0001290 3300048922 Bacteria 30949
416 Ga0496119_0029762 3300048922 Bacteria 3693
417 Ga0501069_0044708 3300049585 Bacteria 2452
418 Ga0501070_0085465 3300049586 Bacteria 2612
419 nmdc:mga00v17_26204_c1 3300050491 Bacteria 3395
420 nmdc:mga00v17_77461_c1 3300050491 Bacteria 2070
421 nmdc:mga0yw44_11863_c1 3300050492 Bacteria 4521
422 nmdc:mga0yw44_20151_c1 3300050492 Bacteria 3695
423 nmdc:mga0yw44_208360_c1 3300050492 Bacteria 1293
424 nmdc:mga0yw44_43697_c1 3300050492 Bacteria 2677
425 nmdc:mga0yw44_62154_c1 3300050492 Bacteria 2293
426 nmdc:mga05p37_43026_c1 3300050507 Bacteria 5553
427 nmdc:mga06r32_5859_c1 3300050510 Bacteria 11060
428 nmdc:mga08y16_9469_c1 3300050511 Bacteria 10222
429 nmdc:mga0n895_111605_c1 3300050512 Bacteria 2750
430 nmdc:mga0n895_35202_c1 3300050512 Bacteria 4825
431 nmdc:mga0n895_41795_c1 3300050512 Bacteria 4458
432 nmdc:mga0n895_55001_c1 3300050512 Bacteria 3916
433 Ga0495601_0000855 3300053077 Bacteria 16586
434 Ga0495601_0073067 3300053077 Bacteria 2192
435 Ga0495601_0167943 3300053077 Bacteria 1434
436 Ga0495612_0000164 3300053078 Bacteria 27579
437 Ga0495612_0006025 3300053078 Bacteria 4995
438 Ga0495655_0000001 3300053083 Bacteria 419518
439 Ga0495595_0000003 3300053084 Bacteria 266465
440 Ga0495595_0001270 3300053084 Bacteria 9828
441 Ga0495619_0000116 3300053085 Bacteria 58748
442 Ga0495619_0000131 3300053085 Bacteria 55500
443 Ga0495619_0001204 3300053085 Bacteria 16989
444 Ga0495619_0003131 3300053085 Bacteria 10732
445 Ga0500628_000033 3300053129 Bacteria 52431
446 Ga0501084_0051196 3300054114 Bacteria 3456
447 Ga0495605_0049018
448 JGI24740J21852_10003186
449 Ga0070658_10017126
450 Ga0070683_100003109
451 Ga0070683_100012149
452 Ga0070683_100012949
453 Ga0070683_100016966
454 Ga0070690_100003538
455 Ga0070677_10000022
456 Ga0070666_10027363
457 Ga0070682_100000099
458 Ga0070682_100040412
459 Ga0070682_100045299
460 Ga0068868_100000450
461 Ga0068868_100013140
462 Ga0068868_100016195
463 Ga0070660_100105097
464 Ga0070691_10000379
465 Ga0070661_100000102
466 Ga0070661_100157146
467 Ga0070692_10020205
468 Ga0070668_100020258
469 Ga0070675_100000027
470 Ga0070674_100000090
471 Ga0070674_100000683
472 Ga0070673_100005169
473 Ga0070673_100183158
474 Ga0070688_100000738
475 Ga0070688_100003810
476 Ga0070688_100007428
477 Ga0070659_100061011
478 Ga0070713_100306158
479 Ga0070710_10012125
480 Ga0070701_10008254
481 Ga0070711_100000734
482 Ga0070711_100090241
483 Ga0070700_100003530
484 Ga0070700_100003961
485 Ga0070694_100024513
486 Ga0070663_100010392
487 Ga0070678_100001355
488 Ga0070678_100142066
489 Ga0070662_100000004
490 Ga0070681_10083373
491 Ga0068867_100000796
492 Ga0070685_10000141
493 Ga0070685_10000616
494 Ga0070685_10035052
495 Ga0070685_10122448
496 Ga0070706_100015559
497 Ga0070706_100025446
498 Ga0070707_100004648
499 Ga0070699_100019861
500 Ga0070679_100000243
501 Ga0070684_100042950
502 Ga0068853_100003775
503 Ga0070672_100031007
504 Ga0070686_100000601
505 Ga0070665_100000106
506 Ga0070665_100000950
507 Ga0070665_100037770
508 Ga0070665_100124655
509 Ga0070664_100033040
510 Ga0070664_100050508
511 Ga0070664_100168855
512 Ga0068854_100000156
513 Ga0068856_100000629
514 Ga0068856_100007081
515 Ga0068856_100009027
516 Ga0070702_100008617
517 Ga0068852_100000006
518 Ga0068866_10000001
519 Ga0068866_10000685
520 Ga0068866_10012660
521 Ga0068866_10032932
522 Ga0068866_10057774
523 Ga0068866_10087580
524 Ga0068861_100025203
525 Ga0068861_100139096
526 Ga0068851_10001416
527 Ga0068863_100000342
528 Ga0068858_100000009
529 Ga0068860_100075111
530 Ga0081455_10007955
531 Ga0081540_1000449
532 Ga0081539_10000246
533 Ga0081539_10019737
534 Ga0075365_10001932
535 Ga0075365_10002660
536 Ga0075365_10007452
537 Ga0075365_10031523
538 Ga0075365_10075182
539 Ga0075363_100077146
540 Ga0075364_10006609
541 Ga0075364_10009364
542 Ga0075364_10013659
543 Ga0075364_10124272
544 Ga0070715_10000001
545 Ga0070716_100031197
546 Ga0070712_100019861
547 Ga0070712_100021026
548 Ga0097621_100005876
549 Ga0097621_100136682
550 Ga0075431_100000536
551 Ga0075434_100001678
552 Ga0075434_100155239
553 Ga0111539_10005066
554 Ga0105245_10000020
555 Ga0105245_10000254
556 Ga0105245_10010405
557 Ga0105245_10019458
558 Ga0114129_10006865
559 Ga0114129_10166647
560 Ga0105243_10006240
561 Ga0105243_10012846
562 Ga0105242_10000032
563 Ga0105242_10000454
564 Ga0105248_10071294
565 Ga0105238_10000011
566 Ga0105238_10166005
567 Ga0105249_10000080
568 Ga0105239_10003834
569 Ga0105239_10152616
570 Ga0105239_10184946
571 Ga0157369_10000020
572 Ga0157374_10001772
573 Ga0157378_10066419
574 Ga0163162_10000583
575 Ga0157372_10000112
576 Ga0157375_10037053
577 Ga0157375_10055094
578 Ga0157375_10063321
579 Ga0157375_10064237
580 Ga0157379_10003159
581 Ga0157376_10005263
582 Ga0163161_10002086
583 Ga0207682_10000005
584 Ga0207642_10000002
585 Ga0207642_10000281
586 Ga0207642_10004706
587 Ga0207710_10000458
588 Ga0207688_10046442
589 Ga0207647_10096381
590 Ga0207685_10000027
591 Ga0207705_10032908
592 Ga0207707_10072992
593 Ga0207693_10000778
594 Ga0207693_10005539
595 Ga0207693_10015289
596 Ga0207663_10000498
597 Ga0207663_10020039
598 Ga0207660_10008386
599 Ga0207657_10009635
600 Ga0207649_10000009
601 Ga0207652_10002027
602 Ga0207652_10015699
603 Ga0207646_10000865
604 Ga0207694_10000004
605 Ga0207659_10000010
606 Ga0207659_10059348
607 Ga0207687_10000007
608 Ga0207687_10000013
609 Ga0207687_10002226
610 Ga0207687_10005882
611 Ga0207687_10040263
612 Ga0207687_10066105
613 Ga0207687_10084410
614 Ga0207700_10000027
615 Ga0207664_10024144
616 Ga0207706_10000012
617 Ga0207686_10000048
618 Ga0207686_10000447
619 Ga0207709_10029668
620 Ga0207669_10000018
621 Ga0207669_10000096
622 Ga0207669_10093578
623 Ga0207704_10000159
624 Ga0207665_10044289
625 Ga0207665_10045813
626 Ga0207691_10005986
627 Ga0207691_10015355
628 Ga0207711_10000006
629 Ga0207661_10000253
630 Ga0207661_10000347
631 Ga0207661_10011874
632 Ga0207679_10208271
633 Ga0207651_10033652
634 Ga0207651_10156507
635 Ga0207712_10000007
636 Ga0207712_10003829
637 Ga0207640_10000038
638 Ga0207640_10003186
639 Ga0207677_10000200
640 Ga0207677_10013068
641 Ga0207703_10000023
642 Ga0207639_10108827
643 Ga0207708_10000468
644 Ga0207708_10005074
645 Ga0207702_10000158
646 Ga0207702_10004125
647 Ga0207702_10074400
648 Ga0207641_10000238
649 Ga0207648_10008647
650 Ga0207674_10238110
651 Ga0207675_100050607
652 Ga0207675_100160408
653 Ga0207683_10000041
654 Ga0207683_10004283
655 Ga0207683_10106454
656 Ga0207683_10181464
657 Ga0207698_10000013
658 Ga0207698_10049913
659 Ga0207698_10051367
660 Ga0207428_10021246
661 Ga0268266_10000047
662 Ga0268266_10006385
663 Ga0268266_10109698
664 Ga0268265_10255098
665 Ga0265337_1000807
666 Ga0265326_10000252
667 Ga0265319_1000020
668 Ga0265319_1002134
669 Ga0265318_10000604
670 Ga0265318_10000968
671 Ga0265323_10006182
672 Ga0265322_10000001
673 Ga0265336_10021526
674 Ga0265338_10001248
675 Ga0265338_10006184
676 Ga0265324_10000755
677 Ga0265330_10003122
678 Ga0265328_10000719
679 Ga0265328_10001094
680 Ga0265320_10000002
681 Ga0265325_10002559
682 Ga0265325_10027972
683 Ga0265329_10010994
684 Ga0265340_10002638
685 Ga0265331_10007296
686 Ga0265331_10009837
687 Ga0265327_10000011
688 Ga0265327_10006079
689 Ga0265327_10015893
690 Ga0265316_10002341
691 Ga0265316_10011610
692 Ga0265313_10050483
693 Ga0265314_10000062
694 Ga0265314_10007971
695 Ga0265314_10012920
696 Ga0265342_10029532
697 Ga0316578_10024138
698 Ga0307416_100215792
699 Ga0373943_0077568
700 Ga0395899_0244141
701 Ga0395900_0002249
702 Ga0395900_0014396
703 Ga0395898_0001408
704 Ga0395898_0035326
705 Ga0395898_0088007
706 Ga0395905_0004021
707 Ga0436364_1554384
708 Ga0395901_0000809
709 Ga0395901_0004783
710 Ga0395901_0028296
711 Ga0395901_0085659
712 Ga0451577_0000243
713 Ga0466963_0000153
714 Ga0453684_0000804
715 Ga0466957_0044462
716 Ga0466958_0030687
717 Ga0466967_0000009
718 Ga0466967_0001283
719 Ga0495592_0102659
720 Ga0495603_0001462
721 Ga0495603_0081390
722 Ga0495629_0003113
723 Ga0495629_0045971
724 Ga0495641_0000228
725 Ga0495641_0076043
726 Ga0495582_0000081
727 Ga0495662_0094228
728 Ga0495594_0000029
729 Ga0495594_0061289
730 Ga0495606_0000072
731 Ga0495608_0000060
732 Ga0495608_0000529
733 Ga0495618_0000008
734 Ga0495620_0000824
735 Ga0495628_0009655
736 Ga0495628_0041865
737 Ga0495628_0122216
738 Ga0495630_0000020
739 Ga0495630_0139721
740 Ga0495652_0000407
741 Ga0495652_0045375
742 Ga0495586_0071704
743 Ga0495587_0019281
744 Ga0495645_0006445
745 Ga0495645_0019986
746 Ga0495622_0000550
747 Ga0495667_0000018
748 Ga0495634_0015499
749 Ga0495634_0132262
750 Ga0495635_0000044
751 Ga0495588_0000134
752 Ga0495657_0000004
753 Ga0495657_0022928
754 Ga0495657_0051214
755 Ga0495599_0018403
756 Ga0495647_0000018
757 Ga0495647_0000156
758 Ga0495658_0000034
759 Ga0495669_0014521
760 Ga0495669_0018748
761 Ga0495613_0000801
762 Ga0495613_0004320
763 Ga0495613_0071867
764 Ga0495613_0090691
765 Ga0495624_0000647
766 Ga0495624_0002509
767 Ga0495624_0088870
768 Ga0495649_0008541
769 Ga0495600_0099031
770 Ga0495581_0013243
771 Ga0495604_0000055
772 Ga0495604_0000137
773 Ga0495604_0009878
774 Ga0495674_0000064
775 Ga0495674_0112482
776 Ga0495676_0000130
777 Ga0495676_0021340
778 Ga0495676_0117044
779 Ga0495680_0000550
780 Ga0495680_0003958
781 Ga0495680_0004286
782 Ga0495675_0000842
783 Ga0495679_010145
784 Ga0495602_0000041
785 Ga0495602_0013815
786 Ga0496100_0000002
787 Ga0496100_0000005
788 Ga0496100_0003241
789 Ga0496100_0005439
790 Ga0496101_0000001
791 Ga0496101_0000101
792 Ga0496101_0002936
793 Ga0496101_0013582
794 Ga0496102_0000115
795 Ga0496102_0005991
796 Ga0496102_0012047
797 Ga0496103_0000008
798 Ga0496103_0001248
799 Ga0496104_0000004
800 Ga0496104_0000009
801 Ga0496104_0006952
802 Ga0496104_0011990
803 Ga0496105_0000001
804 Ga0496105_0000007
805 Ga0496105_0000650
806 Ga0496105_0002671
807 Ga0496105_0062754
808 Ga0496106_0000084
809 Ga0496106_0000151
810 Ga0496106_0000682
811 Ga0496106_0003662
812 Ga0496106_0004801
813 Ga0496106_0109106
814 Ga0496107_0000003
815 Ga0496107_0000011
816 Ga0496107_0005800
817 Ga0496107_0006797
818 Ga0496107_0009590
819 Ga0496108_0000001
820 Ga0496108_0000175
821 Ga0496108_0029134
822 Ga0496108_0070281
823 Ga0496108_0294858
824 Ga0496109_0000003
825 Ga0496109_0000121
826 Ga0496109_0000249
827 Ga0496109_0002789
828 Ga0496109_0004424
829 Ga0496109_0004990
830 Ga0496109_0013347
831 Ga0496109_0121266
832 Ga0496110_0000021
833 Ga0496110_0004679
834 Ga0496110_0023470
835 Ga0496110_0028592
836 Ga0496110_0080736
837 Ga0496111_0000009
838 Ga0496111_0011152
839 Ga0496111_0019839
840 Ga0496111_0094164
841 Ga0496112_0000006
842 Ga0496112_0056312
843 Ga0496112_0067246
844 Ga0496112_0075670
845 Ga0496112_0085412
846 Ga0496112_0108075
847 Ga0496112_0205549
848 Ga0496113_0000004
849 Ga0496114_0000101
850 Ga0496114_0002457
851 Ga0496114_0012931
852 Ga0496114_0024341
853 Ga0496114_0054067
854 Ga0496114_0066853
855 Ga0496115_0000003
856 Ga0496115_0000200
857 Ga0496115_0005151
858 Ga0496115_0057641
859 Ga0496116_0000735
860 Ga0496118_0093077
861 Ga0496119_0001290
862 Ga0496119_0029762
863 Ga0501069_0044708
864 Ga0501070_0085465
865 nmdc:mga00v17_26204_c1
866 nmdc:mga00v17_77461_c1
867 nmdc:mga0yw44_11863_c1
868 nmdc:mga0yw44_20151_c1
869 nmdc:mga0yw44_208360_c1
870 nmdc:mga0yw44_43697_c1
871 nmdc:mga0yw44_62154_c1
872 nmdc:mga05p37_43026_c1
873 nmdc:mga06r32_5859_c1
874 nmdc:mga08y16_9469_c1
875 nmdc:mga0n895_111605_c1
876 nmdc:mga0n895_35202_c1
877 nmdc:mga0n895_41795_c1
878 nmdc:mga0n895_55001_c1
879 Ga0495601_0000855
880 Ga0495601_0073067
881 Ga0495601_0167943
882 Ga0495612_0000164
883 Ga0495612_0006025
884 Ga0495655_0000001
885 Ga0495595_0000003
886 Ga0495595_0001270
887 Ga0495619_0000116
888 Ga0495619_0000131
889 Ga0495619_0001204
890 Ga0495619_0003131
891 Ga0500628_000033
892 Ga0501084_0051196

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01566

Nramp

Natural resistance-associated macrophage protein-like

48

400

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c3i-assembly2.cif.gz_B crystal structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter g45r mutant in an inward occluded state 0.9501 46 437
8e5v-assembly1.cif.gz_A x-ray structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter wtsoak in an occluded state 0.9496 45 437
6c3i-assembly1.cif.gz_A crystal structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter g45r mutant in an inward occluded state 0.9479 46 437
8e5v-assembly1.cif.gz_A x-ray structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter wtsoak in an occluded state 0.9473 45 437
8e6h-assembly1.cif.gz_A x-ray structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter a47w mutant in an occluded, manganese-bound state 0.9459 45 437
ID Description Score Start End Superfamily
af_P0A769_38_384_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9489 61 410 1.20.1740.10
af_P0A769_38_384_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9436 61 410 1.20.1740.10
af_Q2G2G3_53_420_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9338 61 409 1.20.1740.10
af_P9WIZ5_52_401_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9217 61 410 1.20.1740.10
af_Q653V6_68_493_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9193 59 435 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A6N7ZNB7-F1-model_v4 Divalent metal cation transporter 0.9519 34 399 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0034755
AF-A0A0F2JGB0-F1-model_v4 Manganese transport protein MntH 0.9487 85 435 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0034755
AF-A0A0X3AN95-F1-model_v4 Divalent metal cation transporter MntH 0.9365 35 433 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0015293
GO:0034755
GO:0046872
AF-A0A2Z6TAC0-F1-model_v4 deleted 0.9365 33 434
AF-A0A522QGR2-F1-model_v4 Divalent metal cation transporter MntH 0.936 34 434 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0015293
GO:0034755
GO:0046872

Map